{ "uniprot_canonical_ac": "P07316-1", "uniprot_ac": "P07316", "uniprot_id": "CRGB_HUMAN", "mass": { "chemical_mass": 20908.0, "monoisotopic_mass": 20908.0 }, "refseq": { "ac": "NP_005201", "name": "gamma-crystallin B", "summary": "Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" }, "gene_names": [ { "name": "CRYGB", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07316", "id": "P07316" }, { "name": "CRYG2; CTRCT39", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201", "id": "NP_005201" }, { "name": "CRYG2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07316", "id": "P07316" }, { "name": "CRYGB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201", "id": "NP_005201" } ], "protein_names": [ { "name": "Gamma-crystallin B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07316" }, { "name": "Gamma-B-crystallin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07316" }, { "name": "Gamma-crystallin 1-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07316" }, { "name": "crystallin, gamma 1-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201", "id": "NP_005201" }, { "name": "gamma-crystallin B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201", "id": "NP_005201" } ], "function": [ { "annotation": "-47C allele of rs2289917 in CRYGB showed the strongest association with cataract.", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" }, { "database": "PubMed", "id": "21941057", "url": "https://glygen.org/publication/PubMed/21941057" } ] }, { "annotation": "Allelic variant frequency of the gamma-crystallin promoter (g(-47) ->a) affects the level of its expression in platelets from cataract patients.", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" }, { "database": "PubMed", "id": "26552302", "url": "https://glygen.org/publication/PubMed/26552302" } ] }, { "annotation": "Complex heterogeneous mutations in the gammaB crystallin gene have been described resulting in autosomal dominant congenital cataracts with three distinct phenotypes (lamellar, anterior polar, and complete cataracts) in the same family.", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" }, { "database": "PubMed", "id": "23288985", "url": "https://glygen.org/publication/PubMed/23288985" } ] }, { "annotation": "Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" } ] }, { "annotation": "Crystallins are the dominant structural components of the vertebrate eye lens.", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316#function" } ] }, { "annotation": "Glycation of human gammaB-crystallin", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" }, { "database": "PubMed", "id": "28013006", "url": "https://glygen.org/publication/PubMed/28013006" } ] }, { "annotation": "The alphaB-crystallin oligomers formed long-lived stable complexes with their gammaD-crystallin substrates.", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" }, { "database": "PubMed", "id": "20621668", "url": "https://glygen.org/publication/PubMed/20621668" } ] } ], "disease": [ { "disease_id": "DOID:0110236", "recommended_name": { "id": "DOID:0110236", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110236", "name": "cataract 39 multiple types", "description": "A cataract that has_material_basis_in heterozygous mutation in the CRYGB gene on chromosome 2q34." }, "synonyms": [ { "id": "DOID:0110236", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110236", "name": "CTRCT39", "description": "" }, { "id": "DOID:0110236", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110236", "name": "autosomal dominant cataract 39 multiple types", "description": "" }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "cataract 39 multiple types", "description": "Any early-onset non-syndromic cataract in which the cause of the disease is a mutation in the CRYGB gene." }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "CRYGB early-onset non-syndromic cataract", "description": "" }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "CTRCT39", "description": "" }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "autosomal dominant cataract 39 multiple types", "description": "" }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "cataract 39, multiple types, autosomal dominant", "description": "" }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "early-onset non-syndromic cataract caused by mutation in CRYGB", "description": "" }, { "id": "MONDO:0014075", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014075", "name": "cataract 39, multiple types", "description": "" }, { "id": "MIM:615188", "resource": "MIM", "url": "https://www.omim.org/entry/615188", "name": "Cataract 39, multiple types", "description": "Cataract 39, multiple types" } ], "evidence": [ { "id": "615188", "database": "MIM", "url": "https://www.omim.org/entry/615188" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "16.34", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "17.08", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "14.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "14.63", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07316", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07316" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07316", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07316" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07316", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07316" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07316", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07316" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "common_name": "Human" } ], "gene": [ { "name": "CRYGB", "url": "https://www.uniprot.org/uniprot/P07316", "locus": { "chromosome": "2", "start_pos": 208142573, "end_pos": 208146158, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000182187", "url": "https://www.ensembl.org/id/ENSG00000182187" } ] } } ], "crossref": [ { "id": "ENSG00000182187", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182187", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CRYGB", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CRYGB", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1419", "url": "https://www.ncbi.nlm.nih.gov/gene/1419", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2409", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2409", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07316", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07316*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001064", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001064", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1419", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1419", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "123670", "url": "http://www.omim.org/entry/123670", "database": "MIM", "categories": [ "Other" ] }, { "id": "615188", "url": "http://www.omim.org/entry/615188", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07316", "url": "https://www.nextprot.org/entry/NX_P07316", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "AYRMKIY", "url": "https://omabrowser.org/oma/group/AYRMKIY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3998747at2759", "url": "http://www.orthodb.org/?query=3998747at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11818", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11818", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11818:SF101", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11818:SF101", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2JDF", "url": "https://www.rcsb.org/structure/2JDF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JDG", "url": "https://www.rcsb.org/structure/2JDG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00030", "url": "http://pfam.xfam.org/family/PF00030", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07316", "url": "https://pharos.nih.gov/targets/P07316", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P07316", "url": "http://purl.obolibrary.org/obo/PR_P07316", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07316-1", "url": "https://www.uniprot.org/uniprot/P07316-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY", "length": 175, "header": "sp|P07316-1|CRGB_HUMAN Isoform 1 of Gamma-crystallin B OS=Homo sapiens OX=9606 GN=CRYGB PE=1 SV=3 CANONICAL=P07316-1" }, "isoforms": [ { "isoform_ac": "P07316-1", "url": "", "sequence": { "sequence": "MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY", "length": 175, "header": "sp|P07316-1|CRGB_HUMAN Isoform 1 of Gamma-crystallin B OS=Homo sapiens OX=9606 GN=CRYGB PE=1 SV=3 CANONICAL=P07316-1" }, "locus": { "chromosome": "2", "start_pos": 208146120, "end_pos": 208142641, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000260988.5", "url": "https://www.ensembl.org/id/ENST00000260988.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000260988.4", "url": "https://www.ensembl.org/id/ENSP00000260988.4" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07316", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07316" }, { "database": "PubMed", "id": "12060738", "url": "https://glygen.org/publication/PubMed/12060738" }, { "database": "phospho.ELM", "id": "P07316", "url": "http://phospho.elm.eu.org/byAccession/P07316.html" } ], "site_lbl": "Tyr63" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07316", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07316" }, { "database": "PubMed", "id": "12060738", "url": "https://glygen.org/publication/PubMed/12060738" }, { "database": "phospho.ELM", "id": "P07316", "url": "http://phospho.elm.eu.org/byAccession/P07316.html" } ], "site_lbl": "Tyr66" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Novel mutations in the gamma-crystallin genes cause autosomal dominant congenital cataracts.", "journal": "J. Med. Genet.", "date": "2002", "authors": "Santhiya ST, Shyam Manohar M, Rawlley D, Vijayalakshmi P, Namperumalsamy P, Gopinath PM, Loster J, Graw J", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "12011157", "url": "https://glygen.org/publication/PubMed/12011157" } ] }, { "title": "Shotgun identification of protein modifications from protein complexes and lens tissue.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "MacCoss MJ, McDonald WH, Saraf A, Sadygov R, Clark JM, Tasto JJ, Gould KL, Wolters D, Washburn M, Weiss A, Clark JI, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P07316", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07316" } ], "reference": [ { "type": "PubMed", "id": "12060738", "url": "https://glygen.org/publication/PubMed/12060738" } ] }, { "title": "Homology models of human gamma-crystallins: structural study of the extensive charge network in gamma-crystallins.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Salim A, Zaidi ZH", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "12507494", "url": "https://glygen.org/publication/PubMed/12507494" } ] }, { "title": "Gamma-D crystallin gene (CRYGD) mutation causes autosomal dominant congenital cerulean cataracts.", "journal": "J. Med. Genet.", "date": "2003", "authors": "Nandrot E, Slingsby C, Basak A, Cherif-Chefchaouni M, Benazzouz B, Hajaji Y, Boutayeb S, Gribouval O, Arbogast L, Berraho A, Abitbol M, Hilal L", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "12676897", "url": "https://glygen.org/publication/PubMed/12676897" } ] }, { "title": "Prediction of possible sites for posttranslational modifications in human gamma crystallins: effect of glycation on the structure of human gamma-B-crystallin as analyzed by molecular modeling.", "journal": "Proteins", "date": "2003", "authors": "Salim Asmat, Bano Asifa, Zaidi Zafar H", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "14517968", "url": "https://glygen.org/publication/PubMed/14517968" } ] }, { "title": "Affilin-novel binding molecules based on human gamma-B-crystallin, an all beta-sheet protein.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Ebersbach Hilmar, Fiedler Erik, Scheuermann Tanja, Fiedler Markus, Stubbs Milton T, Reimann Carola, Proetzel Gabriele, Rudolph Rainer, Fiedler Ulrike", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "17628592", "url": "https://glygen.org/publication/PubMed/17628592" } ] }, { "title": "Partially folded aggregation intermediates of human gammaD-, gammaC-, and gammaS-crystallin are recognized and bound by human alphaB-crystallin chaperone.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Acosta-Sampson L, King J", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" } ], "reference": [ { "type": "PubMed", "id": "20621668", "url": "https://glygen.org/publication/PubMed/20621668" } ] }, { "title": "Polymorphisms of the gamma crystallin A and B genes among Indian patients with pediatric cataract.", "journal": "Journal of postgraduate medicine", "date": "2011", "authors": "Mehra S, Kapur S, Vasavada AR", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" } ], "reference": [ { "type": "PubMed", "id": "21941057", "url": "https://glygen.org/publication/PubMed/21941057" } ] }, { "title": "Novel crystallin gamma B mutations in a Kuwaiti family with autosomal dominant congenital cataracts reveal genetic and clinical heterogeneity.", "journal": "Mol. Vis.", "date": "2012", "authors": "AlFadhli S, Abdelmoaty S, Al-Hajeri A, Behbehani A, Alkuraya F", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" }, { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" } ], "reference": [ { "type": "PubMed", "id": "23288985", "url": "https://glygen.org/publication/PubMed/23288985" } ] }, { "title": "[ALLELIC VARIANT FREQUENCY OF PROMOTER (G(-47)-->A) gamma-CRYSTALLIN GENE AFFECTS THE LEVEL OF ITS EXPRESSION IN PLATELETS].", "journal": "Fiziolohichnyi zhurnal (Kiev, Ukraine : 1994)", "date": "2015", "authors": "Rykov SA, Byts YY, Goncharov SV, Dosenko VE", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" } ], "reference": [ { "type": "PubMed", "id": "26552302", "url": "https://glygen.org/publication/PubMed/26552302" } ] }, { "title": "Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region.", "journal": "Gene", "date": "1989", "authors": "den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH, Schoenmakers JG", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "2777080", "url": "https://glygen.org/publication/PubMed/2777080" } ] }, { "title": "Glycation of human gammaB-crystallin: A biophysical investigation.", "journal": "International journal of biological macromolecules", "date": "2017", "authors": "Chaudhury S, Ghosh P, Parveen S, Dasgupta S", "evidence": [ { "database": "RefSeq", "id": "NP_005201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005201" } ], "reference": [ { "type": "PubMed", "id": "28013006", "url": "https://glygen.org/publication/PubMed/28013006" } ] }, { "title": "Two human gamma-crystallin genes are linked and riddled with Alu-repeats.", "journal": "Gene", "date": "1985", "authors": "den Dunnen J T, Moormann R J, Cremers F P, Schoenmakers J G", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "reference": [ { "type": "PubMed", "id": "4065573", "url": "https://glygen.org/publication/PubMed/4065573" } ] } ], "pathway": [ { "id": "hsa:1419", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1419", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P04344-1", "protein_name": "Gamma-crystallin B", "gene_name": "Crygb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGKITFFEDRSFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGEYPDYQQWMGFSDSIRSCCLIPQHSGTYRMRIYEKDDFRGQMSEITDDCLSLQDRFHFSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY", "length": 175 }, "evidence": [ { "id": "45917621", "url": "http://www.informatics.jax.org/homology/45917621", "database": "MGI" }, { "id": "P07316", "url": "https://omabrowser.org/oma/group/P07316/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P10066-1", "protein_name": "Gamma-crystallin B", "gene_name": "Crygb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY", "length": 175 }, "evidence": [ { "id": "45917621", "url": "http://www.informatics.jax.org/homology/45917621", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "pmid": "" }, { "name": "lens development in camera-type eye", "id": "GO:0002088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002088", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "pmid": "" }, { "name": "lens fiber cell morphogenesis", "id": "GO:0070309", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070309", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural constituent of eye lens", "id": "GO:0005212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005212", "evidence": [ { "database": "UniProtKB", "id": "P07316", "url": "https://www.uniprot.org/uniprot/P07316" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 63, 66 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }