{ "uniprot_canonical_ac": "P07288-1", "uniprot_ac": "P07288", "uniprot_id": "KLK3_HUMAN", "mass": { "chemical_mass": 28741.0, "monoisotopic_mass": 28741.0 }, "refseq": { "ac": "NP_001025218", "name": "prostate-specific antigen isoform 3 preproprotein", "summary": "Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease which is synthesized in the epithelial cells of the prostate gland, and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Dec 2019].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" }, "gene_names": [ { "name": "KLK3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07288", "id": "P07288" }, { "name": "APS; hK3; KLK2A1; PSA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218", "id": "NP_001025218" }, { "name": "APS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07288", "id": "P07288" }, { "name": "KLK3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218", "id": "NP_001025218" }, { "name": "hCG_22929", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07288", "id": "P07288" } ], "protein_names": [ { "name": "Prostate-specific antigen", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07288" }, { "name": "3.4.21.77", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "Gamma-seminoprotein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "Kallikrein-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "P-30 antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "PSA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "Semenogelase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "Seminin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07288" }, { "name": "gamma-seminoprotein; semenogelase; seminin; P-30 antigen; prostate-specific antigen; kallikrein-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218", "id": "NP_001025218" }, { "name": "prostate-specific antigen isoform 3 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218", "id": "NP_001025218" } ], "function": [ { "annotation": "Association of Kallikrein Related Peptidase 3 (KLK3) gene with dermatophytosis in the UK biobank cohort.", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" }, { "database": "PubMed", "id": "37592324", "url": "https://glygen.org/publication/PubMed/37592324" } ] }, { "annotation": "Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288#function" } ] }, { "annotation": "Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease which is synthesized in the epithelial cells of the prostate gland, and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Dec 2019].", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" } ] }, { "annotation": "Ki67 and prostate specific antigen are prognostic in metastatic hormone naive prostate cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" }, { "database": "PubMed", "id": "37713321", "url": "https://glygen.org/publication/PubMed/37713321" } ] }, { "annotation": "Prostate-Specific Antigen Level at the Time of Salvage Therapy After Radical Prostatectomy for Prostate Cancer and the Risk of Death.", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" }, { "database": "PubMed", "id": "36857638", "url": "https://glygen.org/publication/PubMed/36857638" } ] }, { "annotation": "RNA-binding protein 14 promotes phase separation to sustain prostate specific antigen expression under androgen deprivation in human prostate cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" }, { "database": "PubMed", "id": "37806532", "url": "https://glygen.org/publication/PubMed/37806532" } ] }, { "annotation": "The effect of encomir-93 mimic transfection on the expression of miR-93 and PSA and androgen receptor in prostate cancer LNcap cell line. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" }, { "database": "PubMed", "id": "36995990", "url": "https://glygen.org/publication/PubMed/36995990" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs61752561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61752561" }, { "id": "rs61752561", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61752561" }, { "id": "rs61752561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61752561" }, { "id": "rs61752561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61752561#frequency_tab" }, { "id": "rs61752561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61752561" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 102, "end_pos": 102, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DMS->NMS).", "chr_id": "19", "chr_pos": "50858126", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.008387", "site_lbl": "D102", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs866995758", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs866995758" }, { "id": "rs866995758", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs866995758" }, { "id": "rs866995758", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs866995758" }, { "id": "rs766084011", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766084011" }, { "id": "rs766084011", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766084011" }, { "id": "rs766084011", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766084011#frequency_tab" }, { "id": "rs766084011", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766084011" }, { "id": "rs1175456687", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175456687" }, { "id": "rs1175456687", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1175456687#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 115, "end_pos": 115, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDS->NDS).", "chr_id": "19", "chr_pos": "50858165", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D115", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776860388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776860388" }, { "id": "rs776860388", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776860388" }, { "id": "rs776860388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776860388" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 116, "end_pos": 116, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "19", "chr_pos": "50858168", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D116", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1030647036", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1030647036" }, { "id": "rs1030647036", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1030647036" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 71, "end_pos": 71, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->NKI).", "chr_id": "19", "chr_pos": "50858034", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S71", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1599993043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1599993043" }, { "id": "rs1599993043", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1599993043" }, { "id": "rs756104515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756104515" }, { "id": "rs756104515", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756104515" }, { "id": "rs756104515", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756104515#frequency_tab" }, { "id": "rs756104515", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756104515" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 71, "end_pos": 71, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->NKR).", "chr_id": "19", "chr_pos": "50858033", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S71", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs923247750", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs923247750" }, { "id": "rs923247750", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs923247750" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 93, "end_pos": 93, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SHS->NHS).", "chr_id": "19", "chr_pos": "50858100", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S93", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368127664", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368127664" }, { "id": "rs368127664", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368127664#frequency_tab" }, { "id": "rs368127664", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368127664" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 9, "end_pos": 9, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLS->NLS).", "chr_id": "19", "chr_pos": "50854981", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T9", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "63.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "56.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "34.17", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "65.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "59.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "70.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "65.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "56.77", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "63.56", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "65.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "28.52", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "57.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07288", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07288" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "common_name": "Human" } ], "gene": [ { "name": "KLK3", "url": "https://www.uniprot.org/uniprot/P07288", "locus": { "chromosome": "19", "start_pos": 50860764, "end_pos": 50854915, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000142515", "url": "https://www.ensembl.org/id/ENSG00000142515" } ] } } ], "crossref": [ { "id": "ENSG00000142515", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142515", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.4.21.77", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.21.77&UniProtAcc=P07288", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00190", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2099", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2099", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "KLK3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KLK3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "354", "url": "https://www.ncbi.nlm.nih.gov/gene/354", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6364", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6364", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07288", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07288*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001254", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001254", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001314", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001314", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018114", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018114", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:354", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:354", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "176820", "url": "http://www.omim.org/entry/176820", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07288", "url": "https://www.nextprot.org/entry/NX_P07288", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "IGGRECL", "url": "https://omabrowser.org/oma/group/IGGRECL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4629979at2759", "url": "http://www.orthodb.org/?query=4629979at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24271", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24271", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24271:SF73", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24271:SF73", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2ZCH", "url": "https://www.rcsb.org/structure/2ZCH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZCK", "url": "https://www.rcsb.org/structure/2ZCK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZCL", "url": "https://www.rcsb.org/structure/2ZCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3QUM", "url": "https://www.rcsb.org/structure/3QUM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00089", "url": "http://pfam.xfam.org/family/PF00089", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07288", "url": "https://pharos.nih.gov/targets/P07288", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053645", "url": "https://proconsortium.org/app/entry/PR:000053645", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053646", "url": "https://proconsortium.org/app/entry/PR:000053646", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053647", "url": "https://proconsortium.org/app/entry/PR:000053647", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053648", "url": "https://proconsortium.org/app/entry/PR:000053648", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053649", "url": "https://proconsortium.org/app/entry/PR:000053649", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053650", "url": "https://proconsortium.org/app/entry/PR:000053650", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053651", "url": "https://proconsortium.org/app/entry/PR:000053651", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053652", "url": "https://proconsortium.org/app/entry/PR:000053652", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053653", "url": "https://proconsortium.org/app/entry/PR:000053653", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053654", "url": "https://proconsortium.org/app/entry/PR:000053654", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053655", "url": "https://proconsortium.org/app/entry/PR:000053655", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053656", "url": "https://proconsortium.org/app/entry/PR:000053656", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053657", "url": "https://proconsortium.org/app/entry/PR:000053657", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053658", "url": "https://proconsortium.org/app/entry/PR:000053658", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053659", "url": "https://proconsortium.org/app/entry/PR:000053659", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053660", "url": "https://proconsortium.org/app/entry/PR:000053660", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053661", "url": "https://proconsortium.org/app/entry/PR:000053661", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053662", "url": "https://proconsortium.org/app/entry/PR:000053662", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053663", "url": "https://proconsortium.org/app/entry/PR:000053663", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053664", "url": "https://proconsortium.org/app/entry/PR:000053664", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053665", "url": "https://proconsortium.org/app/entry/PR:000053665", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053666", "url": "https://proconsortium.org/app/entry/PR:000053666", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053667", "url": "https://proconsortium.org/app/entry/PR:000053667", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053668", "url": "https://proconsortium.org/app/entry/PR:000053668", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053669", "url": "https://proconsortium.org/app/entry/PR:000053669", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053670", "url": "https://proconsortium.org/app/entry/PR:000053670", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053671", "url": "https://proconsortium.org/app/entry/PR:000053671", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053672", "url": "https://proconsortium.org/app/entry/PR:000053672", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053673", "url": "https://proconsortium.org/app/entry/PR:000053673", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053674", "url": "https://proconsortium.org/app/entry/PR:000053674", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053675", "url": "https://proconsortium.org/app/entry/PR:000053675", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053676", "url": "https://proconsortium.org/app/entry/PR:000053676", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053677", "url": "https://proconsortium.org/app/entry/PR:000053677", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053678", "url": "https://proconsortium.org/app/entry/PR:000053678", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053679", "url": "https://proconsortium.org/app/entry/PR:000053679", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053680", "url": "https://proconsortium.org/app/entry/PR:000053680", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053681", "url": "https://proconsortium.org/app/entry/PR:000053681", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053682", "url": "https://proconsortium.org/app/entry/PR:000053682", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053683", "url": "https://proconsortium.org/app/entry/PR:000053683", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053684", "url": "https://proconsortium.org/app/entry/PR:000053684", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053685", "url": "https://proconsortium.org/app/entry/PR:000053685", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053686", "url": "https://proconsortium.org/app/entry/PR:000053686", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053687", "url": "https://proconsortium.org/app/entry/PR:000053687", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053688", "url": "https://proconsortium.org/app/entry/PR:000053688", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053689", "url": "https://proconsortium.org/app/entry/PR:000053689", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053690", "url": "https://proconsortium.org/app/entry/PR:000053690", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053691", "url": "https://proconsortium.org/app/entry/PR:000053691", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053692", "url": "https://proconsortium.org/app/entry/PR:000053692", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053693", "url": "https://proconsortium.org/app/entry/PR:000053693", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053694", "url": "https://proconsortium.org/app/entry/PR:000053694", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053695", "url": "https://proconsortium.org/app/entry/PR:000053695", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053696", "url": "https://proconsortium.org/app/entry/PR:000053696", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053697", "url": "https://proconsortium.org/app/entry/PR:000053697", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053698", "url": "https://proconsortium.org/app/entry/PR:000053698", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053699", "url": "https://proconsortium.org/app/entry/PR:000053699", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053700", "url": "https://proconsortium.org/app/entry/PR:000053700", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053701", "url": "https://proconsortium.org/app/entry/PR:000053701", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053702", "url": "https://proconsortium.org/app/entry/PR:000053702", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053703", "url": "https://proconsortium.org/app/entry/PR:000053703", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053704", "url": "https://proconsortium.org/app/entry/PR:000053704", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053705", "url": "https://proconsortium.org/app/entry/PR:000053705", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053706", "url": "https://proconsortium.org/app/entry/PR:000053706", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053707", "url": "https://proconsortium.org/app/entry/PR:000053707", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053708", "url": "https://proconsortium.org/app/entry/PR:000053708", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053709", "url": "https://proconsortium.org/app/entry/PR:000053709", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053710", "url": "https://proconsortium.org/app/entry/PR:000053710", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053711", "url": "https://proconsortium.org/app/entry/PR:000053711", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053712", "url": "https://proconsortium.org/app/entry/PR:000053712", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053713", "url": "https://proconsortium.org/app/entry/PR:000053713", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053714", "url": "https://proconsortium.org/app/entry/PR:000053714", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053715", "url": "https://proconsortium.org/app/entry/PR:000053715", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053716", "url": "https://proconsortium.org/app/entry/PR:000053716", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053717", "url": "https://proconsortium.org/app/entry/PR:000053717", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053718", "url": "https://proconsortium.org/app/entry/PR:000053718", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053719", "url": "https://proconsortium.org/app/entry/PR:000053719", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053720", "url": "https://proconsortium.org/app/entry/PR:000053720", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053721", "url": "https://proconsortium.org/app/entry/PR:000053721", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053722", "url": "https://proconsortium.org/app/entry/PR:000053722", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053723", "url": "https://proconsortium.org/app/entry/PR:000053723", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053724", "url": "https://proconsortium.org/app/entry/PR:000053724", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053725", "url": "https://proconsortium.org/app/entry/PR:000053725", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053726", "url": "https://proconsortium.org/app/entry/PR:000053726", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P07288", "url": "http://purl.obolibrary.org/obo/PR_P07288", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07288", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0B4J1X3", "url": "https://www.uniprot.org/uniprot/A0A0B4J1X3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4J1X3-1", "url": "https://www.uniprot.org/uniprot/A0A0B4J1X3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QX57", "url": "https://www.uniprot.org/uniprot/M0QX57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QX57-1", "url": "https://www.uniprot.org/uniprot/M0QX57-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QZF9", "url": "https://www.uniprot.org/uniprot/M0QZF9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QZF9-1", "url": "https://www.uniprot.org/uniprot/M0QZF9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R1F0", "url": "https://www.uniprot.org/uniprot/M0R1F0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R1F0-1", "url": "https://www.uniprot.org/uniprot/M0R1F0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R1Z7", "url": "https://www.uniprot.org/uniprot/M0R1Z7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R1Z7-1", "url": "https://www.uniprot.org/uniprot/M0R1Z7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R294", "url": "https://www.uniprot.org/uniprot/M0R294", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R294-1", "url": "https://www.uniprot.org/uniprot/M0R294-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07288-1", "url": "https://www.uniprot.org/uniprot/P07288-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07288-2", "url": "https://www.uniprot.org/uniprot/P07288-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07288-3", "url": "https://www.uniprot.org/uniprot/P07288-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07288-4", "url": "https://www.uniprot.org/uniprot/P07288-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07288-5", "url": "https://www.uniprot.org/uniprot/P07288-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7LBD2", "url": "https://www.uniprot.org/uniprot/Q7LBD2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7LBD2-1", "url": "https://www.uniprot.org/uniprot/Q7LBD2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP", "length": 261, "header": "sp|P07288-1|KLK3_HUMAN Isoform 1 of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2 CANONICAL=P07288-1" }, "isoforms": [ { "isoform_ac": "A0A0B4J1X3-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQAR", "length": 90, "header": "tr|A0A0B4J1X3-1|KLK3_HUMAN Computationally mapped isoform of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=1 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50858163, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000422986.6", "url": "https://www.ensembl.org/id/ENST00000422986.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000393628.2", "url": "https://www.ensembl.org/id/ENSP00000393628.2" } ] } }, { "isoform_ac": "M0QX57-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSTLNQRSS", "length": 124, "header": "tr|M0QX57-1|M0QX57_HUMAN Computationally mapped isoform of Kallikrein 3, (Prostate specific antigen), isoform CRA_a OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=1 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50858461, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000595392.5", "url": "https://www.ensembl.org/id/ENST00000595392.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000468912.1", "url": "https://www.ensembl.org/id/ENSP00000468912.1" } ] } }, { "isoform_ac": "M0QZF9-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTC", "length": 172, "header": "tr|M0QZF9-1|KLK3_HUMAN Computationally mapped isoform of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=1 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50858592, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000597286.5", "url": "https://www.ensembl.org/id/ENST00000597286.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000470523.1", "url": "https://www.ensembl.org/id/ENSP00000470523.1" } ] } }, { "isoform_ac": "M0R1F0-1", "url": "", "sequence": { "sequence": "XFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEECTPGPDVLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP", "length": 262, "header": "tr|M0R1F0-1|M0R1F0_HUMAN Computationally mapped isoform of Kallikrein related peptidase 3 OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=1 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50860125, "end_pos": 50854972, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000598145.1", "url": "https://www.ensembl.org/id/ENST00000598145.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000471827.1", "url": "https://www.ensembl.org/id/ENSP00000471827.1" } ] } }, { "isoform_ac": "M0R1Z7-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIAPPLQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQK", "length": 172, "header": "tr|M0R1Z7-1|KLK3_HUMAN Computationally mapped isoform of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=8 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50858538, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000601503.5", "url": "https://www.ensembl.org/id/ENST00000601503.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000472213.1", "url": "https://www.ensembl.org/id/ENSP00000472213.1" } ] } }, { "isoform_ac": "M0R294-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRKPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSWVILITELTMPALPMVLHGSLVPWRGGV", "length": 195, "header": "tr|M0R294-1|M0R294_HUMAN Computationally mapped isoform of Kallikrein 3, (Prostate specific antigen), isoform CRA_d OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=1 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50859613, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000597483.5", "url": "https://www.ensembl.org/id/ENST00000597483.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000472411.1", "url": "https://www.ensembl.org/id/ENSP00000472411.1" } ] } }, { "isoform_ac": "P07288-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP", "length": 261, "header": "sp|P07288-1|KLK3_HUMAN Isoform 1 of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50860124, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000326003.7", "url": "https://www.ensembl.org/id/ENST00000326003.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000314151.1", "url": "https://www.ensembl.org/id/ENSP00000314151.1" } ] } }, { "isoform_ac": "P07288-2", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSWVILITELTMPALPMVLHGSLVPWRGGV", "length": 238, "header": "sp|P07288-2|KLK3_HUMAN Isoform 2 of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50859613, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000360617.7", "url": "https://www.ensembl.org/id/ENST00000360617.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000353829.2", "url": "https://www.ensembl.org/id/ENSP00000353829.2" } ] } }, { "isoform_ac": "P07288-3", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRKPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP", "length": 218, "header": "sp|P07288-3|KLK3_HUMAN Isoform 3 of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50860124, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000595952.5", "url": "https://www.ensembl.org/id/ENST00000595952.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000471155.1", "url": "https://www.ensembl.org/id/ENSP00000471155.1" } ] } }, { "isoform_ac": "P07288-4", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRK", "length": 69, "header": "sp|P07288-4|KLK3_HUMAN Isoform 4 of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2 CANONICAL=P07288-1" }, "locus": {} }, { "isoform_ac": "P07288-5", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSVSHPYSQDLEGKGEWGP", "length": 227, "header": "sp|P07288-5|KLK3_HUMAN Isoform 5 of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2 CANONICAL=P07288-1" }, "locus": { "chromosome": "19", "start_pos": 50858646, "end_pos": 50854956, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000593997.5", "url": "https://www.ensembl.org/id/ENST00000593997.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000472907.1", "url": "https://www.ensembl.org/id/ENSP00000472907.1" } ] } }, { "isoform_ac": "Q7LBD2-1", "url": "", "sequence": { "sequence": "MWVPVVFLTLSVTWIGERGHGWGDAGEGASPDCQAEALSPPTQHPSPDRELGSFLSLPAPLQAHTPSPSILQQSSLPHQVPAPSHLPQNFLPIAQPAPCSQLLY", "length": 104, "header": "tr|Q7LBD2-1|KLK3_HUMAN Computationally mapped isoform of Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=1 CANONICAL=P07288-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G00281HB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G00553AN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G03127AL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G03693IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G04576KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=34", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G06601SQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=35", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G12511VU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G12708JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G14176QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G14985NB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=13", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G15363AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G16204NU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G16265MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=43", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=20", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G17409FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=53", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G20732FY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" } ] }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G23869AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G24005JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G24164CX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G26915XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G28975ZZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G29068FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G29078QN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=23", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G29239NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=15", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G29568VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G29898ES", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G31618AH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G33556XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G34306IB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G34730YF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G35305EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G36923NX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G37588ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G37605QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=11", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G38946SH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G40245CP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=19", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G42440OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G45841FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" } ] }, { "glytoucan_ac": "G46422KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G46754UW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G46759WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G47748JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G47909JD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G49043NO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G49278EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G49991UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G50903RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G51114UP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=18", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G51793MY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=48", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G53604QR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G54042WO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=51", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G54059XR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G55783TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G55982TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=10", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=55", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G56903ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G59576IJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G59616TT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G59655SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=54", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G60041XW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G61138BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G61170KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G61726TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G61884GF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=12", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G62067NB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G62091GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G62792OG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G63276XU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G63640QH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=17", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G65059GX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G65896IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G68698AP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G71681UC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=27", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G72978AW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G74120KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=24", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=47", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G77561JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=21", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=29", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G79939YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G80962OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=25", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G81413UE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=42", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G82514MH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G83951ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G84331QL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G84362VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=49", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G85228QD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G86500WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G87139BK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G87433AX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=36", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G89738LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G89941FZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=45", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G90245IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G91337ZP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=31", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G92654OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G93180LE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G95835XS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ] }, { "glytoucan_ac": "G96091TT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=39", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G96095QD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Pooled samples of the healthy contols (N=41", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "glytoucan_ac": "G98455QP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "glytoucan_ac": "G98472XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "glytoucan_ac": "G98611JV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "glytoucan_ac": "G98666DD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "id": "33618028", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "666", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/666" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "790", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "P07288", "database": "UniCarbKB", "url": "" }, { "id": "25327667", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25327667" }, { "id": "17956937", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17956937" }, { "id": "24393138", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24393138" }, { "id": "33167210", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33167210" }, { "id": "10.1016/j.talanta.2020.121495", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" }, { "id": "P07288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07288#ptm_processing" }, { "id": "26022737", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/26022737" }, { "id": "26022737", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26022737" }, { "id": "25327667", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25327667" } ] } ], "phosphorylation": [ { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07288", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07288" }, { "database": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ], "site_lbl": "Thr143" }, { "start_pos": 167, "end_pos": 167, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07288", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07288" }, { "database": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ], "site_lbl": "Thr167" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS", "journal": "Talanta", "date": "2021", "authors": "Wang W., Ka\u0142u\u017ca A., Nouta J., Nicolardi S., Ferens-Sieczkowska M., Wuhrer M., Lageveen-Kammeijer G.S.M., de Haan N.", "evidence": [ { "database": "UniCarbKB", "id": "P07288", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1016/j.talanta.2020.121495", "url": "https://glygen.org/publication/DOI/10.1016/j.talanta.2020.121495" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.", "journal": "Gene", "date": "2000", "authors": "Gan L, Lee I, Smith R, Argonza-Barrett R, Lei H, McCuaig J, Moss P, Paeper B, Wang K", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "11054574", "url": "https://glygen.org/publication/PubMed/11054574" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Unusual alternative splicing within the human kallikrein genes KLK2 and KLK3 gives rise to novel prostate-specific proteins.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "David Anat, Mabjeesh Nicola, Azar Idit, Biton Sharon, Engel Sharon, Bernstein Jeanne, Romano Jacob, Avidor Yoav, Waks Tova, Eshhar Zelig, Langer Salomon Z, Lifschitz-Mercer Beatriz, Matzkin Haim, Rotman Galit, Toporik Amir, Savitsky Kinneret, Mintz Liat", "evidence": [ { "database": "UniProtKB", "id": "Q7LBD2", "url": "https://www.uniprot.org/uniprot/Q7LBD2" } ], "reference": [ { "type": "PubMed", "id": "11834722", "url": "https://glygen.org/publication/PubMed/11834722" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "A novel inducible transactivation domain in the androgen receptor: implications for PRK in prostate cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Metzger E, Muller JM, Ferrari S, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "12514133", "url": "https://glygen.org/publication/PubMed/12514133" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "LSD1 demethylates repressive histone marks to promote androgen-receptor-dependent transcription.", "journal": "Nature", "date": "2005", "authors": "Metzger E, Wissmann M, Yin N, Muller JM, Schneider R, Peters AH, Gunther T, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "16079795", "url": "https://glygen.org/publication/PubMed/16079795" } ] }, { "title": "Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.", "journal": "Cell", "date": "2006", "authors": "Whetstine JR, Nottke A, Lan F, Huarte M, Smolikov S, Chen Z, Spooner E, Li E, Zhang G, Colaiacovo M, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "16603238", "url": "https://glygen.org/publication/PubMed/16603238" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen.", "journal": "Thromb. Res.", "date": "1991", "authors": "Espana F, Gilabert J, Estelles A, Romeu A, Aznar J, Cabo A", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "1725227", "url": "https://glygen.org/publication/PubMed/1725227" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "Oligosaccharide profiles of the prostate specific antigen in free and complexed forms from the prostate cancer patient serum and in seminal plasma: a glycopeptide approach.", "journal": "Glycobiology", "date": "2008", "authors": "Tajiri M, Ohyama C, Wada Y", "evidence": [ { "database": "UniCarbKB", "id": "P07288", "url": "" } ], "reference": [ { "type": "PubMed", "id": "17956937", "url": "https://glygen.org/publication/PubMed/17956937" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.", "journal": "Nature cell biology", "date": "2008", "authors": "Metzger E, Yin N, Wissmann M, Kunowska N, Fischer K, Friedrichs N, Patnaik D, Higgins JM, Potier N, Scheidtmann KH, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "18066052", "url": "https://glygen.org/publication/PubMed/18066052" } ] }, { "title": "Profiling of UV-induced ATM/ATR signaling pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Stokes MP, Rush J, Macneill J, Ren JM, Sprott K, Nardone J, Yang V, Beausoleil SA, Gygi SP, Livingstone M, Zhang H, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P07288-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07288-1" } ], "reference": [ { "type": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ] }, { "title": "Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Menez R, Michel S, Muller BH, Bossus M, Ducancel F, Jolivet-Reynaud C, Stura EA", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "18187150", "url": "https://glygen.org/publication/PubMed/18187150" } ] }, { "title": "Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring.", "journal": "Mol. Cell. Proteomics", "date": "2013", "authors": "V\u00e9gv\u00e1ri Akos, Sj\u00f6din Karin, Rezeli Melinda, Malm Johan, Lilja Hans, Laurell Thomas, Marko-Varga Gy\u00f6rgy", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "23842001", "url": "https://glygen.org/publication/PubMed/23842001" } ] }, { "title": "Human prostate-specific antigen: structural and functional similarity with serine proteases.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Watt KW, Lee PJ, M'Timkulu T, Chan WP, Loor R", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2422647", "url": "https://glygen.org/publication/PubMed/2422647" } ] }, { "title": "Molecular cloning of human prostate specific antigen cDNA.", "journal": "FEBS Lett.", "date": "1987", "authors": "Lundwall A, Lilja H", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2436946", "url": "https://glygen.org/publication/PubMed/2436946" } ] }, { "title": "Glycan analysis of Prostate Specific Antigen (PSA) directly from the intact glycoprotein by HR-ESI/TOF-MS.", "journal": "Journal of proteome research", "date": "2014", "authors": "Behnken HN, Ruthenbeck A, Schulz JM, Meyer B", "evidence": [ { "database": "UniCarbKB", "id": "P07288", "url": "" } ], "reference": [ { "type": "PubMed", "id": "24393138", "url": "https://glygen.org/publication/PubMed/24393138" } ] }, { "title": "Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Schulz P, Stucka R, Feldmann H, Combriato G, Klobeck H G, Fittler F", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2456523", "url": "https://glygen.org/publication/PubMed/2456523" } ] }, { "title": "Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Riegman P H, Vlietstra R J, van der Korput J A, Romijn J C, Trapman J", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2466464", "url": "https://glygen.org/publication/PubMed/2466464" } ] }, { "title": "Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Digby M, Zhang X Y, Richards R I", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2467258", "url": "https://glygen.org/publication/PubMed/2467258" } ] }, { "title": "cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Henttu P, Vihko P", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2470373", "url": "https://glygen.org/publication/PubMed/2470373" } ] }, { "title": "Genomic sequence of human prostate specific antigen (PSA).", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Klobeck H G, Combriato G, Schulz P, Arbusow V, Fittler F", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2471958", "url": "https://glygen.org/publication/PubMed/2471958" } ] }, { "title": "Characterization of the gene for prostate-specific antigen, a human glandular kallikrein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Lundwall A", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "2472789", "url": "https://glygen.org/publication/PubMed/2472789" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Glycoproteomics: identifying the glycosylation of prostate specific antigen at normal and high isoelectric points by LC-MS/MS.", "journal": "Journal of proteome research", "date": "2014", "authors": "Song E, Mayampurath A, Yu CY, Tang H, Mechref Y", "evidence": [ { "database": "UniCarbKB", "id": "P07288", "url": "" }, { "database": "Automatic Literature Mining", "id": "25327667", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25327667" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" }, { "database": "GlyConnect", "id": "666", "url": "https://glyconnect.expasy.org/browser/proteins/666" } ], "reference": [ { "type": "PubMed", "id": "25327667", "url": "https://glygen.org/publication/PubMed/25327667" } ] }, { "title": "Serum fucosylated prostate-specific antigen (PSA) improves the differentiation of aggressive from non-aggressive prostate cancers.", "journal": "Theranostics", "date": "2015", "authors": "Li Qing Kay, Chen Li, Ao Ming-Hui, Chiu Joyce Hanching, Zhang Zhen, Zhang Hui, Chan Daniel W", "evidence": [ { "database": "GlyGen", "id": "A0504", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "25553114", "url": "https://glygen.org/publication/PubMed/25553114" } ] }, { "title": "Characterization of the Glycosylation Site of Human PSA Prompted by Missense Mutation using LC-MS/MS.", "journal": "Journal of proteome research", "date": "2015", "authors": "Song E, Hu Y, Hussein A, Yu CY, Tang H, Mechref Y", "evidence": [ { "database": "Automatic Literature Mining", "id": "26022737", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/26022737" } ], "reference": [ { "type": "PubMed", "id": "26022737", "url": "https://glygen.org/publication/PubMed/26022737" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS.", "journal": "Talanta", "date": "2021", "authors": "Wang W, Kaluza A, Nouta J, Nicolardi S, Ferens-Sieczkowska M, Wuhrer M, Lageveen-Kammeijer GSM, de Haan N", "evidence": [ { "database": "UniCarbKB", "id": "P07288", "url": "" }, { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ], "reference": [ { "type": "PubMed", "id": "33167210", "url": "https://glygen.org/publication/PubMed/33167210" } ] }, { "title": "Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis - mass spectrometry.", "journal": "Journal of proteomics", "date": "2021", "authors": "Moran AB, Dominguez-Vega E, Nouta J, Pongracz T, de Reijke TM, Wuhrer M, Lageveen-Kammeijer GSM", "evidence": [ { "database": "GlyConnect", "id": "790", "url": "https://glyconnect.expasy.org/browser/proteins/790" } ], "reference": [ { "type": "PubMed", "id": "33618028", "url": "https://glygen.org/publication/PubMed/33618028" } ] }, { "title": "Prostate-Specific Antigen Level at the Time of Salvage Therapy After Radical Prostatectomy for Prostate Cancer and the Risk of Death.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2023-03-01", "authors": "Tilki Derya, Chen Ming-Hui, Wu Jing, Huland Hartwig, Graefen Markus, Mohamad Osama, Cowan Janet E, Feng Felix Y, Carroll Peter R, D'Amico Anthony V", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" } ], "reference": [ { "type": "PubMed", "id": "36857638", "url": "https://glygen.org/publication/PubMed/36857638" } ] }, { "title": "Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma.", "journal": "Eur. J. Biochem.", "date": "1987", "authors": "Schaller J, Akiyama K, Tsuda R, Hara M, Marti T, Rickli E E", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "3691515", "url": "https://glygen.org/publication/PubMed/3691515" } ] }, { "title": "The effect of encomir-93 mimic transfection on the expression of miR-93 and PSA and androgen receptor in prostate cancer LNcap cell line.", "journal": "Hormone molecular biology and clinical investigation", "date": "2023-03-31", "authors": "Mokhtari Hossein, Ebrahimi Ali, Nejati Mohaddeseh, Barartabar Zeinab, Damchi Mehdi, Khonakdar-Tarsi Abbas, Zahedi Mahlagha", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" } ], "reference": [ { "type": "PubMed", "id": "36995990", "url": "https://glygen.org/publication/PubMed/36995990" } ] }, { "title": "Association of Kallikrein Related Peptidase 3 (KLK3) gene with dermatophytosis in the UK biobank cohort.", "journal": "Mycoses", "date": "2023-08-17", "authors": "Lehrer Steven, Rheinstein Peter H", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" } ], "reference": [ { "type": "PubMed", "id": "37592324", "url": "https://glygen.org/publication/PubMed/37592324" } ] }, { "title": "Ki67 and prostate specific antigen are prognostic in metastatic hormone na\u00efve prostate cancer.", "journal": "Acta oncologica (Stockholm, Sweden)", "date": "2023-12", "authors": "Spyratou Vasiliki, Freyhult Eva, Bergh Anders, Thellenberg-Karlsson Camilla, Wikstr\u00f6m Pernilla, Wel\u00e9n Karin, Josefsson Andreas", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" } ], "reference": [ { "type": "PubMed", "id": "37713321", "url": "https://glygen.org/publication/PubMed/37713321" } ] }, { "title": "RNA-binding protein 14 promotes phase separation to sustain prostate specific antigen expression under androgen deprivation in human prostate cancer.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2023-12", "authors": "Tsuji Kentaro, Kawata Hirotoshi, Kamiakito Tomoko, Nakaya Takeo, Tanaka Akira", "evidence": [ { "database": "RefSeq", "id": "NP_001025218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025218" } ], "reference": [ { "type": "PubMed", "id": "37806532", "url": "https://glygen.org/publication/PubMed/37806532" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors.", "journal": "Cancer Res.", "date": "1994", "authors": "Monne M, Croce C M, Yu H, Diamandis E P", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "7527295", "url": "https://glygen.org/publication/PubMed/7527295" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "A structural model for the prostate disease marker, human prostate-specific antigen.", "journal": "Protein Sci.", "date": "1994", "authors": "Villoutreix B O, Getzoff E D, Griffin J H", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "7535613", "url": "https://glygen.org/publication/PubMed/7535613" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue.", "journal": "Urology", "date": "1996", "authors": "Baffa R, Moreno J G, Monne M, Veronese M L, Gomella L G", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "8677566", "url": "https://glygen.org/publication/PubMed/8677566" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Substrate specificity of prostate-specific antigen (PSA).", "journal": "Chem. Biol.", "date": "1998", "authors": "Coombs G S, Bergstrom R C, Pellequer J L, Baker S I, Navre M, Smith M M, Tainer J A, Madison E L, Corey D R", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "reference": [ { "type": "PubMed", "id": "9751643", "url": "https://glygen.org/publication/PubMed/9751643" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] } ], "pathway": [ { "id": "hsa:354", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:354", "resource": "KEGG Pathway" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-5625886", "name": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886", "resource": "Reactome", "description": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2KAN9-1", "protein_name": "tissue kallikrein", "gene_name": "Klk1c3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "IWTEILSLSLSLSLSLSLSLSLSLPFPTSSGHVLALPNCVPQHYIHNPYLFQPYPHPRLLLTDAAPPGQSRVVGGFKCEKNSQPWQVAVINEDLCGGVLIDPSWVITAAHCYSDNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSETWLGSCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSWIKEVMKKNP", "length": 299 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "G3V8H1-1", "protein_name": "tissue kallikrein", "gene_name": "Klk1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWFLILFLDLSLGQIDAAPPGQSRVIGGYKCEKNSQPWQVALYSFSKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP", "length": 261 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P00755-1", "protein_name": "Kallikrein 1-related peptidase b1", "gene_name": "Klk1b1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYKEYICGGVLLDANWVLTAAHCYYEKNNVWLGKNNLYQDEPSAQHRLVSKSFLHPCYNMSLHRNRIQNPQDDYSYDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSIIPVKFQYAKDLQCVNLKLLPNEDCDKAYVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDGVLQGLTSWGYNPCGEPKKPGVYTKLIKFTSWIKDTLAQNP", "length": 261 }, "evidence": [ { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P00756-1", "protein_name": "Kallikrein 1-related peptidase b3", "gene_name": "Klk1b3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLCGGVLLDPNWVLTAAHCYDDNYKVWLGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMRKHIRFLEYDYSNDLMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWGSITPTKFQFTDDLYCVNLKLLPNEDCAKAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGEPDMPGVYTKLNKFTSWIKDTMAKNP", "length": 261 }, "evidence": [ { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P00757-1", "protein_name": "Kallikrein 1-related peptidase-like b4", "gene_name": "Klk1b4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSQVDCENSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP", "length": 256 }, "evidence": [ { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P00758-1", "protein_name": "Kallikrein-1", "gene_name": "Ngfg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWFLILFLALSLGRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHCATDNYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNGVLQGITSWGFNPCGEPKKPGIYTKLIKFTPWIKEVMKENP", "length": 261 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P00759-1", "protein_name": "Tonin", "gene_name": "Klk2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWLQILSLVLSVGRIDAAPPGQSRIVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP", "length": 259 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04071-1", "protein_name": "Kallikrein 1-related peptidase b16", "gene_name": "Klk1b16", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWVLTAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSNDLMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKWQKPDDLQCMFTKLLPNENCAKAYLLKVTDVMLCTIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGIPGVSAIYTNLVKFNSWIKDTMMKNA", "length": 261 }, "evidence": [ { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P06870-1", "protein_name": "Kallikrein-1", "gene_name": "KLK1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS", "length": 262 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P07628-1", "protein_name": "Kallikrein 1-related peptidase b8", "gene_name": "Klk1b8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRFLILFLALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEIPPGADFSNDLMLLRLSKPADITDAVKPITLPTKESKLGSTCLASGWGSITPTKWQKPDDLQCVFLKLLPIKNCIENHNVKVTDVMLCAGEMSGGKNICKGDSGGPLICDSVLQGITSTGPIPCGKPGVPAMYTNLIKFNSWIKDTMTKNS", "length": 261 }, "evidence": [ { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P07647-1", "protein_name": "Submandibular glandular kallikrein-9", "gene_name": "Klk9", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWFLILFLALSLGQIDAAPPGQSRVVGGYNCETNSQPWQVAVIGTTFCGGVLIDPSWVITAAHCYSKNYRVLLGRNNLVKDEPFAQRRLVSQSFQHPDYIPVFMRNHTRQRAYDHNNDLMLLHLSKPADITGGVKVIDLPTEEPKVGSICLASGWGMTNPSEMKLSHDLQCVNIHLLSNEKCIETYKNIETDVTLCAGEMDGGKDTCTGDSGGPLICDGVLQGLTSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP", "length": 259 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P15945-1", "protein_name": "Kallikrein 1-related peptidase b5", "gene_name": "Klk1b5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSRIFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLTAAHCHNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAKNA", "length": 261 }, "evidence": [ { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P15946-1", "protein_name": "Kallikrein 1-related peptidase b11", "gene_name": "Klk1b11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWHVAVYRYNKYICGGVLLDRNWVLTAAHCHVSQYNVWLGKTKLFQREPSAQHRMVSKSFPHPDYNMSLLIIHNPEPEDDESNDLMLLRLSEPADITDAVKPIALPTEEPKLGSTCLVSGWGSITPTKFQTPDDLQCVSIKLLPNEVCVKNHNQKVTDVMLCAGEMGGGKDTCKGDSGGPLICDGVLHGITAWGPIPCGKPNTPGVYTKLIKFTNWIKDTMAKNP", "length": 261 }, "evidence": [ { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P15947-1", "protein_name": "Kallikrein-1", "gene_name": "Klk1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND", "length": 261 }, "evidence": [ { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P15948-1", "protein_name": "Kallikrein 1-related peptidase b22", "gene_name": "Klk1b22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP", "length": 259 }, "evidence": [ { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P15949-1", "protein_name": "Kallikrein 1-related peptidase b9", "gene_name": "Klk1b9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRFLILFLALSLGGIDAAPPVHSRIVGGFKCEKNSQPWHVAVYRYNEYICGGVLLDANWVLTAAHCYYEENKVSLGKNNLYEEEPSAQHRLVSKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSTTPFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAGETDGGKDTCKGDSGGPLICDGVLQGITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTMAKNL", "length": 261 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P20151-1", "protein_name": "Kallikrein-2", "gene_name": "KLK2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP", "length": 261 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P36369-1", "protein_name": "Kallikrein 1-related peptidase b26", "gene_name": "Klk1b26", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFPALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTTPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSTCLASGWGSITPTRWQKSDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGILQGTTSNGPEPCGKPGVPAIYTNLIKFNSWIKDTMMKNA", "length": 261 }, "evidence": [ { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P36374-1", "protein_name": "Prostatic glandular kallikrein-6", "gene_name": "Klk6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWLLILFLILSLGWNDAAPPGQSRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHPSWVITAAHCYSVNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDIIKNHTRKPGNDYSNDLMLLHLKTPADITDGVKVIDLPTEEPKVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNEKCIKAYNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLIKFTSWMKKVMKENP", "length": 261 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P36375-1", "protein_name": "Glandular kallikrein-10", "gene_name": "Klk10", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPGQSRIVGGYKCEKNSQPWQVAIINEYLCGGVLIDPSWVITAAHCYSNYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSNDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLNWELPDDLQCVNIHLLSNEKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIKEVMKENP", "length": 259 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P36376-1", "protein_name": "Glandular kallikrein-12, submandibular/renal", "gene_name": "Klk12", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWLQILFLVLSVGRIDAAPPGQSRVVGGYKCEKNSQPWQVAVINRYLCGGVLIDPSWVITAAHCYSHNYHVLLGRNNLFKDEPFAQYRVVNQSFPHPDYNPFFMKNHTLFPGDDHSNDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWSSTKPLEWEFPDDLQCVNINILSNEKCIKAHTQMVTDVMLCAGELEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIYTKLIKFTSWIKEVMKENS", "length": 259 }, "evidence": [ { "id": "45934254", "url": "http://www.informatics.jax.org/homology/45934254", "database": "MGI" }, { "id": "45934261", "url": "http://www.informatics.jax.org/homology/45934261", "database": "MGI" }, { "id": "45934257", "url": "http://www.informatics.jax.org/homology/45934257", "database": "MGI" }, { "id": "45934251", "url": "http://www.informatics.jax.org/homology/45934251", "database": "MGI" }, { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" }, { "id": "45934247", "url": "http://www.informatics.jax.org/homology/45934247", "database": "MGI" }, { "id": "45934260", "url": "http://www.informatics.jax.org/homology/45934260", "database": "MGI" }, { "id": "45934259", "url": "http://www.informatics.jax.org/homology/45934259", "database": "MGI" }, { "id": "45934253", "url": "http://www.informatics.jax.org/homology/45934253", "database": "MGI" }, { "id": "45934258", "url": "http://www.informatics.jax.org/homology/45934258", "database": "MGI" }, { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" }, { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" }, { "id": "45934250", "url": "http://www.informatics.jax.org/homology/45934250", "database": "MGI" }, { "id": "45934252", "url": "http://www.informatics.jax.org/homology/45934252", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q61754-1", "protein_name": "Kallikrein 1-related peptidase b24", "gene_name": "Klk1b24", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGNATSQYNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQKPNDLQCVFIKLLPNENCTKPYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPNAPAIYTKLIKFASWIKDTMAKNP", "length": 263 }, "evidence": [ { "id": "45934255", "url": "http://www.informatics.jax.org/homology/45934255", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q61759-1", "protein_name": "Kallikrein 1-related peptidase b21", "gene_name": "Klk1b21", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRFLILFLALSLGEIDAAPPVQSRIVGGFNCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGNQYNVWLGKNKLFQHESSAQHRLVSKSFPHPDYNMSLMNDHTPHPEDDYSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQIPNDLQCGFIKPLPNENCAKAYIHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGVLQGITSWGSIPCAKPNAPAIYTKLIKFTSWIKDTMAKNP", "length": 261 }, "evidence": [ { "id": "45934256", "url": "http://www.informatics.jax.org/homology/45934256", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JM71-1", "protein_name": "Kallikrein 1-related peptidase b27", "gene_name": "Klk1b27", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRFLILFLALSLGGIDAAPPVQSRIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAHCYGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAYVHKVTDVMLCVGETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKFTSWIKDTMAKNP", "length": 263 }, "evidence": [ { "id": "45934249", "url": "http://www.informatics.jax.org/homology/45934249", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "serine-type endopeptidase activity", "id": "GO:0004252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "endopeptidase activity", "id": "GO:0004175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004175", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides", "id": "GO:0016811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016811", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "serine-type peptidase activity", "id": "GO:0008236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008236", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "protein metabolic process", "id": "GO:0019538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019538", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "positive regulation of antibacterial peptide production", "id": "GO:0002803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002803", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "secretory granule", "id": "GO:0030141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030141", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P07288", "url": "https://www.uniprot.org/uniprot/P07288" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "prostate-specific antigen N-glycosylated 1 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G00281HB. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G00281HB. [PRO:DNx, PMID:17956937, PMID:25327667]", "evidence": [ { "id": "PR:000053645", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053645" } ] }, { "name": "prostate-specific antigen N-glycosylated 2 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G00553AN. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G00553AN. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053646", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053646" } ] }, { "name": "prostate-specific antigen N-glycosylated 3 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053647", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053647" } ] }, { "name": "prostate-specific antigen N-glycosylated 4 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053648", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053648" } ] }, { "name": "prostate-specific antigen N-glycosylated 5 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G03574QJ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G03574QJ. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053649", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053649" } ] }, { "name": "prostate-specific antigen N-glycosylated 6 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17956937, PMID:25327667]", "evidence": [ { "id": "PR:000053650", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053650" } ] }, { "name": "prostate-specific antigen N-glycosylated 7 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053651", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053651" } ] }, { "name": "prostate-specific antigen N-glycosylated 8 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G09528DL. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G09528DL. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053652", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053652" } ] }, { "name": "prostate-specific antigen N-glycosylated 9 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G12511VU. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G12511VU. [PRO:DNx, PMID:25327667]", "evidence": [ { "id": "PR:000053653", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053653" } ] }, { "name": "prostate-specific antigen N-glycosylated 10 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G12580WI. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G12580WI. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053654", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053654" } ] }, { "name": "prostate-specific antigen N-glycosylated 11 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G12708JQ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G12708JQ. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053655", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053655" } ] }, { "name": "prostate-specific antigen N-glycosylated 12 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G14176QY. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G14176QY. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053656", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053656" } ] }, { "name": "prostate-specific antigen N-glycosylated 13 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G15038BD. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G15038BD. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053657", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053657" } ] }, { "name": "prostate-specific antigen N-glycosylated 14 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G16204NU. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G16204NU. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053658", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053658" } ] }, { "name": "prostate-specific antigen N-glycosylated 15 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G17409FQ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G17409FQ. [PRO:DNx, PMID:25327667]", "evidence": [ { "id": "PR:000053659", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053659" } ] }, { "name": "prostate-specific antigen N-glycosylated 16 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:17956937, PMID:25327667]", "evidence": [ { "id": "PR:000053660", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053660" } ] }, { "name": "prostate-specific antigen N-glycosylated 17 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G23505EP. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G23505EP. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053661", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053661" } ] }, { "name": "prostate-specific antigen N-glycosylated 18 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G23675NT. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G23675NT. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053662", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053662" } ] }, { "name": "prostate-specific antigen N-glycosylated 19 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G24005JZ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G24005JZ. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053663", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053663" } ] }, { "name": "prostate-specific antigen N-glycosylated 20 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G25987BV. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G25987BV. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053664", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053664" } ] }, { "name": "prostate-specific antigen N-glycosylated 21 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G28541PG. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G28541PG. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053665", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053665" } ] }, { "name": "prostate-specific antigen N-glycosylated 22 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G29068FM. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053666", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053666" } ] }, { "name": "prostate-specific antigen N-glycosylated 23 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G29898ES. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G29898ES. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053667", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053667" } ] }, { "name": "prostate-specific antigen N-glycosylated 24 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G31618AH. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G31618AH. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053668", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053668" } ] }, { "name": "prostate-specific antigen N-glycosylated 25 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G33556XM. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G33556XM. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053669", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053669" } ] }, { "name": "prostate-specific antigen N-glycosylated 26 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G34306IB. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G34306IB. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053670", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053670" } ] }, { "name": "prostate-specific antigen N-glycosylated 27 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G36923NX. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G36923NX. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053671", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053671" } ] }, { "name": "prostate-specific antigen N-glycosylated 28 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053672", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053672" } ] }, { "name": "prostate-specific antigen N-glycosylated 29 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G37412TK. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G37412TK. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053673", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053673" } ] }, { "name": "prostate-specific antigen N-glycosylated 30 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G37588ZB. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G37588ZB. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053674", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053674" } ] }, { "name": "prostate-specific antigen N-glycosylated 31 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G37868ZX. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G37868ZX. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053675", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053675" } ] }, { "name": "prostate-specific antigen N-glycosylated 32 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G38946SH. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G38946SH. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053676", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053676" } ] }, { "name": "prostate-specific antigen N-glycosylated 33 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G40834TG. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G40834TG. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053677", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053677" } ] }, { "name": "prostate-specific antigen N-glycosylated 34 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17956937, PMID:25327667]", "evidence": [ { "id": "PR:000053678", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053678" } ] }, { "name": "prostate-specific antigen N-glycosylated 35 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G42440OJ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G42440OJ. [PRO:DNx, PMID:25327667]", "evidence": [ { "id": "PR:000053679", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053679" } ] }, { "name": "prostate-specific antigen N-glycosylated 36 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G44953PJ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G44953PJ. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053680", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053680" } ] }, { "name": "prostate-specific antigen N-glycosylated 37 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G45495MK. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G45495MK. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053681", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053681" } ] }, { "name": "prostate-specific antigen N-glycosylated 38 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G45504EY. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G45504EY. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053682", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053682" } ] }, { "name": "prostate-specific antigen N-glycosylated 39 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G46754UW. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G46754UW. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053683", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053683" } ] }, { "name": "prostate-specific antigen N-glycosylated 40 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G46759WS. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G46759WS. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053684", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053684" } ] }, { "name": "prostate-specific antigen N-glycosylated 41 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G49043NO. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G49043NO. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053685", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053685" } ] }, { "name": "prostate-specific antigen N-glycosylated 42 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G49991UY. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G49991UY. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053686", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053686" } ] }, { "name": "prostate-specific antigen N-glycosylated 43 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G50903RY. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G50903RY. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053687", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053687" } ] }, { "name": "prostate-specific antigen N-glycosylated 44 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G53604QR. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G53604QR. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053688", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053688" } ] }, { "name": "prostate-specific antigen N-glycosylated 45 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G54059XR. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G54059XR. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053689", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053689" } ] }, { "name": "prostate-specific antigen N-glycosylated 46 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G54600FO. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G54600FO. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053690", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053690" } ] }, { "name": "prostate-specific antigen N-glycosylated 47 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G54682XF. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G54682XF. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053691", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053691" } ] }, { "name": "prostate-specific antigen N-glycosylated 48 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G55382TU. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G55382TU. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053692", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053692" } ] }, { "name": "prostate-specific antigen N-glycosylated 49 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G55783TD. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G55783TD. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053693", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053693" } ] }, { "name": "prostate-specific antigen N-glycosylated 50 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G56903ZB. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G56903ZB. [PRO:DNx, PMID:25327667]", "evidence": [ { "id": "PR:000053694", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053694" } ] }, { "name": "prostate-specific antigen N-glycosylated 51 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G57818FI. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G57818FI. [PRO:DNx, PMID:17956937, PMID:25327667]", "evidence": [ { "id": "PR:000053695", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053695" } ] }, { "name": "prostate-specific antigen N-glycosylated 52 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G59576IJ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G59576IJ. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053696", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053696" } ] }, { "name": "prostate-specific antigen N-glycosylated 53 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G59616TT. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G59616TT. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053697", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053697" } ] }, { "name": "prostate-specific antigen N-glycosylated 54 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053698", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053698" } ] }, { "name": "prostate-specific antigen N-glycosylated 55 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G60041XW. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G60041XW. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053699", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053699" } ] }, { "name": "prostate-specific antigen N-glycosylated 56 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G61170KL. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G61170KL. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053700", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053700" } ] }, { "name": "prostate-specific antigen N-glycosylated 57 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G61726TP. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G61726TP. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053701", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053701" } ] }, { "name": "prostate-specific antigen N-glycosylated 58 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G62091GQ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G62091GQ. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053702", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053702" } ] }, { "name": "prostate-specific antigen N-glycosylated 59 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G62792OG. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G62792OG. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053703", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053703" } ] }, { "name": "prostate-specific antigen N-glycosylated 60 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G63276XU. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G63276XU. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053704", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053704" } ] }, { "name": "prostate-specific antigen N-glycosylated 61 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G65896IX. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G65896IX. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053705", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053705" } ] }, { "name": "prostate-specific antigen N-glycosylated 62 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G68698AP. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G68698AP. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053706", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053706" } ] }, { "name": "prostate-specific antigen N-glycosylated 63 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G72791KH. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G72791KH. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053707", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053707" } ] }, { "name": "prostate-specific antigen N-glycosylated 64 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G75798PH. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G75798PH. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053708", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053708" } ] }, { "name": "prostate-specific antigen N-glycosylated 65 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G82348BZ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G82348BZ. [PRO:DNx, PMID:25327667]", "evidence": [ { "id": "PR:000053709", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053709" } ] }, { "name": "prostate-specific antigen N-glycosylated 66 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G82514MH. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G82514MH. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053710", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053710" } ] }, { "name": "prostate-specific antigen N-glycosylated 67 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053711", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053711" } ] }, { "name": "prostate-specific antigen N-glycosylated 68 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G83646BJ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G83646BJ. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053712", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053712" } ] }, { "name": "prostate-specific antigen N-glycosylated 69 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G84331QL. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G84331QL. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053713", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053713" } ] }, { "name": "prostate-specific antigen N-glycosylated 70 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G84362VL. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G84362VL. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053714", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053714" } ] }, { "name": "prostate-specific antigen N-glycosylated 71 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053715", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053715" } ] }, { "name": "prostate-specific antigen N-glycosylated 72 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G86182NS. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G86182NS. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053716", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053716" } ] }, { "name": "prostate-specific antigen N-glycosylated 73 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053717", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053717" } ] }, { "name": "prostate-specific antigen N-glycosylated 74 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G87139BK. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G87139BK. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053718", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053718" } ] }, { "name": "prostate-specific antigen N-glycosylated 75 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053719", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053719" } ] }, { "name": "prostate-specific antigen N-glycosylated 76 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G89738LW. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G89738LW. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053720", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053720" } ] }, { "name": "prostate-specific antigen N-glycosylated 77 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G90245IA. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G90245IA. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053721", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053721" } ] }, { "name": "prostate-specific antigen N-glycosylated 78 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G95835XS. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G95835XS. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053722", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053722" } ] }, { "name": "prostate-specific antigen N-glycosylated 79 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G95865ZB. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G95865ZB. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053723", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053723" } ] }, { "name": "prostate-specific antigen N-glycosylated 80 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G98455QP. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G98455QP. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053724", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053724" } ] }, { "name": "prostate-specific antigen N-glycosylated 81 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan composition is represented by GlyTouCan:G98611JV. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G98611JV. [PRO:DNx, PMID:24393138]", "evidence": [ { "id": "PR:000053725", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053725" } ] }, { "name": "prostate-specific antigen N-glycosylated 82 (human)", "definition": "A prostate-specific antigen (human) that has been N-glycosylated at the residue equivalent to Asn-69 of the amino acid sequence represented by UniProtKB:P07288-1, in which the glycan structure is represented by GlyTouCan:G98666DD. Example: UniProtKB:P07288-1, Asn-69, MOD:00160~GNO:G98666DD. [PRO:DNx, PMID:17956937]", "evidence": [ { "id": "PR:000053726", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053726" } ] } ], "site_annotation": [ { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-HSA-381466", "name": "Prostate-specific Antigen proteolyzes IGF:IGFBP3:ALS", "equation": "", "summary": "Prostate specific Antigen (PSA, KLK3) cleaves IGFBP-3 in the IGF:IGFBP-3:ALS Complex between amino acids 186 and 187. Other cleavage sites were observed but not reproducibly. These may have been caused by impurities in the PSA preparation.", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07288-1", "P06870-1", "P20151-1", "Q9UKR3-1" ], "evidence": [ { "id": "R-HSA-381466", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381466" } ] }, { "id": "R-HSA-5625883", "name": "PKN1 in complex with AR positively regulates expression of KLK2 and KLK3", "equation": "", "summary": "PKN1-facilitated demethylation of histones at promoters of KLK2 and KLK3 genes stimulates transcription of KLK2 and KLK3 (Metzger et al. 2005, Metzger et al. 2008).", "cellular_location": "extracellular region, nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07288-1", "Q16512-1", "P20151-1" ], "evidence": [ { "id": "R-HSA-5625883", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625883" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P06870", "gene_name": "KLK1", "activity": [ { "ec_number": "3.4.21.35", "activity": "Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.", "evidence": [ { "id": "P06870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06870" } ] }, { "ec_number": "3.4.21.35", "activity": "", "evidence": [ { "id": "P06870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06870" } ] } ] }, { "uniprot_ac": "P07288", "gene_name": "KLK3", "activity": [ { "ec_number": "3.4.21.77", "activity": "Preferential cleavage: -Tyr-|-Xaa-.", "evidence": [ { "id": "P07288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07288" } ] }, { "ec_number": "3.4.21.77", "activity": "", "evidence": [ { "id": "P07288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07288" } ] } ] }, { "uniprot_ac": "P20151", "gene_name": "KLK2", "activity": [ { "ec_number": "3.4.21.35", "activity": "Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.", "evidence": [ { "id": "P20151", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20151" } ] }, { "ec_number": "3.4.21.35", "activity": "", "evidence": [ { "id": "P20151", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20151" } ] } ] }, { "uniprot_ac": "Q16512", "gene_name": "PKN1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16512" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q16512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16512" } ] } ] }, { "uniprot_ac": "Q9UKR3", "gene_name": "KLK13", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "Q9UKR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKR3" } ] } ] } ], "biomarkers": [ { "assessed_biomarker_entity": "Fucosylated PSA", "biomarker_id": "A0504", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "25553114", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25553114" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "increased fucosylated PSA level", "disease": { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000737", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000737" }, { "id": "25553114", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25553114" }, { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 69 ], "o_linked_sites": [], "snv_sites": [ 9, 71, 93, 102, 115, 116 ], "glycation_sites": [], "phosphorylation_sites": [ 143, 167 ], "sequon_annotation_sites": [ { "start_pos": 69, "end_pos": 71 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 194 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 193 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 193 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 193 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 97 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }