{ "uniprot_canonical_ac": "P06756-1", "uniprot_ac": "P06756", "uniprot_id": "ITAV_HUMAN", "mass": { "chemical_mass": 116038.0, "monoisotopic_mass": 116038.0 }, "refseq": { "ac": "NP_001138471", "name": "integrin alpha-V isoform 2 precursor", "summary": "The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" }, "gene_names": [ { "name": "ITGAV", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06756", "id": "P06756" }, { "name": "CD51; MSK8; VNRA; VTNR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471", "id": "NP_001138471" }, { "name": "ITGAV", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471", "id": "NP_001138471" }, { "name": "MSK8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06756", "id": "P06756" }, { "name": "VNRA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06756", "id": "P06756" }, { "name": "VTNR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06756", "id": "P06756" } ], "protein_names": [ { "name": "Integrin alpha-V", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06756" }, { "name": "Vitronectin receptor subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06756" }, { "name": "Vitronectin receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06756" }, { "name": "antigen identified by monoclonal antibody L230; integrin alpha-V; vitronectin receptor subunit alpha; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); integrin alphaVbeta3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471", "id": "NP_001138471" }, { "name": "integrin alpha-V isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471", "id": "NP_001138471" } ], "function": [ { "annotation": "(Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "10397733", "url": "https://glygen.org/publication/PubMed/10397733" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "18045938", "url": "https://glygen.org/publication/PubMed/18045938" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Human parechovirus 1.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "11160695", "url": "https://glygen.org/publication/PubMed/11160695" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "23658209", "url": "https://glygen.org/publication/PubMed/23658209" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for Adenovirus type C.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "20615244", "url": "https://glygen.org/publication/PubMed/20615244" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB5 and ITGAV:ITGB3 act as receptors for Coxsackievirus A9 and B1.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "7519807", "url": "https://glygen.org/publication/PubMed/7519807" }, { "database": "PubMed", "id": "9426447", "url": "https://glygen.org/publication/PubMed/9426447" }, { "database": "PubMed", "id": "15194773", "url": "https://glygen.org/publication/PubMed/15194773" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB6 acts as a receptor for herpes simplex 1/HHV-1.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "24367260", "url": "https://glygen.org/publication/PubMed/24367260" } ] }, { "annotation": "Combined inhibition of surface CD51 and gamma-secretase-mediated CD51 cleavage improves therapeutic efficacy in experimental metastatic hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" }, { "database": "PubMed", "id": "37604269", "url": "https://glygen.org/publication/PubMed/37604269" } ] }, { "annotation": "Integrin alphavbeta1 facilitates ACE2-mediated entry of SARS-CoV-2.", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" }, { "database": "PubMed", "id": "37884208", "url": "https://glygen.org/publication/PubMed/37884208" } ] }, { "annotation": "Integrin-alphavbeta3 is a Therapeutically Targetable Fundamental Factor in Medulloblastoma Tumorigenicity and Radioresistance.", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" }, { "database": "PubMed", "id": "38009896", "url": "https://glygen.org/publication/PubMed/38009896" } ] }, { "annotation": "Interaction of Integrin alphavbeta8 With Type I Collagen Promotes Squamous Cell Carcinoma Cell Motility via RAC1 Activation.", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" }, { "database": "PubMed", "id": "37909974", "url": "https://glygen.org/publication/PubMed/37909974" } ] }, { "annotation": "Regulation of the integrin alphaVbeta3- actin filaments axis in early osteogenic differentiation of human mesenchymal stem cells under cyclic tensile stress. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" }, { "database": "PubMed", "id": "37904190", "url": "https://glygen.org/publication/PubMed/37904190" } ] }, { "annotation": "The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415). ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling (PubMed:18441324). ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling (PubMed:28302677). ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:19578119). ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed:28873464). ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling (PubMed:29030430). ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGAV:ITGB3 and ITGAV:ITGB6 act as receptors for fibrillin-1 (FBN1) and mediate R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887, PubMed:17158881). Integrin alpha-V/beta-6 or alpha-V/beta-8 (ITGAV:ITGB6 or ITGAV:ITGB8) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation (PubMed:15184403, PubMed:22278742, PubMed:28117447). ITGAV:ITGB3 acts as a receptor for CD40LG (PubMed:31331973).", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#function" }, { "database": "PubMed", "id": "23125415", "url": "https://glygen.org/publication/PubMed/23125415" }, { "database": "PubMed", "id": "28117447", "url": "https://glygen.org/publication/PubMed/28117447" }, { "database": "PubMed", "id": "20682778", "url": "https://glygen.org/publication/PubMed/20682778" }, { "database": "PubMed", "id": "22278742", "url": "https://glygen.org/publication/PubMed/22278742" }, { "database": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" }, { "database": "PubMed", "id": "18441324", "url": "https://glygen.org/publication/PubMed/18441324" }, { "database": "PubMed", "id": "17158881", "url": "https://glygen.org/publication/PubMed/17158881" }, { "database": "PubMed", "id": "28873464", "url": "https://glygen.org/publication/PubMed/28873464" }, { "database": "PubMed", "id": "19578119", "url": "https://glygen.org/publication/PubMed/19578119" }, { "database": "PubMed", "id": "28302677", "url": "https://glygen.org/publication/PubMed/28302677" }, { "database": "PubMed", "id": "29030430", "url": "https://glygen.org/publication/PubMed/29030430" }, { "database": "PubMed", "id": "25398877", "url": "https://glygen.org/publication/PubMed/25398877" }, { "database": "PubMed", "id": "31331973", "url": "https://glygen.org/publication/PubMed/31331973" }, { "database": "PubMed", "id": "18635536", "url": "https://glygen.org/publication/PubMed/18635536" }, { "database": "PubMed", "id": "15184403", "url": "https://glygen.org/publication/PubMed/15184403" } ] }, { "annotation": "The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs755351300", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755351300" }, { "id": "rs755351300", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755351300" }, { "id": "rs755351300", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755351300" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 876, "end_pos": 876, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDA); o-glyco-site-loss (T->A).", "chr_id": "2", "chr_pos": "186675700", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T876", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756" }, { "id": "rs368269954", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368269954" }, { "id": "rs368269954", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368269954" }, { "id": "rs368269954", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368269954" }, { "id": "rs368269954", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368269954" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 876, "end_pos": 876, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NDT->NDM); o-glyco-site-loss (T->M).", "chr_id": "2", "chr_pos": "186669735", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T876", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756" }, { "id": "rs200733186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200733186" }, { "id": "rs200733186", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200733186" }, { "id": "rs200733186", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200733186" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 945, "end_pos": 945, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->SHS); n-glyco-sequon-gain (NQN->NQS).", "chr_id": "2", "chr_pos": "186675833", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N945", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1391724682", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1391724682" }, { "id": "rs1391724682", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1391724682" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 290, "end_pos": 290, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->DMS).", "chr_id": "2", "chr_pos": "186638430", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1406835401", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1406835401" }, { "id": "rs1406835401", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1406835401" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 290, "end_pos": 290, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->KMS).", "chr_id": "2", "chr_pos": "186638432", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs370560229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370560229" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 292, "end_pos": 292, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->NMP).", "chr_id": "2", "chr_pos": "186638436", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S292", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777559283", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777559283" }, { "id": "rs777559283", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777559283" }, { "id": "rs777559283", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777559283#frequency_tab" }, { "id": "rs777559283", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777559283" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 296, "end_pos": 296, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "2", "chr_pos": "186638449", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N296", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377123218", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377123218" }, { "id": "rs377123218", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377123218#frequency_tab" }, { "id": "rs377123218", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377123218" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 388, "end_pos": 388, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDI->NDT).", "chr_id": "2", "chr_pos": "186646689", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I388", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200310686", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200310686" }, { "id": "rs200310686", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200310686" }, { "id": "rs200310686", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200310686" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 476, "end_pos": 476, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAG->NAS).", "chr_id": "2", "chr_pos": "186652010", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G476", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200705825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200705825" }, { "id": "rs200705825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200705825" }, { "id": "rs200705825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200705825#frequency_tab" }, { "id": "rs200705825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200705825" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 488, "end_pos": 488, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "2", "chr_pos": "186652047", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N488", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 488, "end_pos": 488, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->TKT).", "chr_id": "2", "chr_pos": "186652047", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N488", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs142779223", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142779223" }, { "id": "rs142779223", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142779223" }, { "id": "rs142779223", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142779223#frequency_tab" }, { "id": "rs142779223", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142779223" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 488, "end_pos": 488, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "2", "chr_pos": "186652046", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N488", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 550, "end_pos": 550, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SHS->NHS).", "chr_id": "2", "chr_pos": "186656331", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S550", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1364945613", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1364945613" }, { "id": "rs1364945613", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1364945613#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 554, "end_pos": 554, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->KMT).", "chr_id": "2", "chr_pos": "186656344", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N554", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1255182395", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1255182395" }, { "id": "rs1255182395", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1255182395#frequency_tab" }, { "id": "rs1255182395", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1255182395" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 574, "end_pos": 574, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "2", "chr_pos": "186659038", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D574", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1201170163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1201170163" }, { "id": "rs1201170163", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1201170163#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 617, "end_pos": 617, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->NIG).", "chr_id": "2", "chr_pos": "186659167", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S617", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs953658594", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs953658594" }, { "id": "rs953658594", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs953658594" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 617, "end_pos": 617, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->NIP).", "chr_id": "2", "chr_pos": "186664594", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S617", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1559063831", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1559063831" }, { "id": "rs1559063831", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1559063831" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 617, "end_pos": 617, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->NIR).", "chr_id": "2", "chr_pos": "186659169", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S617", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1321639888", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1321639888" }, { "id": "rs1321639888", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1321639888" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 617, "end_pos": 617, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->NIY).", "chr_id": "2", "chr_pos": "186664595", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S617", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776165007", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776165007" }, { "id": "rs776165007", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776165007" }, { "id": "rs776165007", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776165007" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 632, "end_pos": 632, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVC->NVS).", "chr_id": "2", "chr_pos": "186663805", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C632", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760496817", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760496817" }, { "id": "rs760496817", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760496817" }, { "id": "rs760496817", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760496817" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 704, "end_pos": 704, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->DQT).", "chr_id": "2", "chr_pos": "186665162", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N704", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs55719435", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs55719435" }, { "id": "rs55719435", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs55719435" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTA).", "chr_id": "2", "chr_pos": "186602061", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 835, "end_pos": 835, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->HNT).", "chr_id": "2", "chr_pos": "186668831", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N835", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs781075410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781075410" }, { "id": "rs781075410", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781075410" }, { "id": "rs781075410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781075410" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 947, "end_pos": 947, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NHS->NHA).", "chr_id": "2", "chr_pos": "186675919", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S947", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06756", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 947, "end_pos": 947, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->NHF).", "chr_id": "2", "chr_pos": "186675839", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S947", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1280838410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1280838410" }, { "id": "rs1280838410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1280838410" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 959, "end_pos": 959, "sequence_org": "I", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVI->NVS).", "chr_id": "2", "chr_pos": "186676874", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I959", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1373702457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1373702457" }, { "id": "rs1373702457", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1373702457#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 972, "end_pos": 972, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TNS->NNS).", "chr_id": "2", "chr_pos": "186675914", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T972", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746931798", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746931798" }, { "id": "rs746931798", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746931798" }, { "id": "rs746931798", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746931798#frequency_tab" }, { "id": "rs746931798", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746931798" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 973, "end_pos": 973, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "2", "chr_pos": "186675917", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N973", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748927654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748927654" }, { "id": "rs748927654", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748927654" }, { "id": "rs748927654", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748927654#frequency_tab" }, { "id": "rs748927654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748927654" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 980, "end_pos": 980, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "2", "chr_pos": "186676822", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N980", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1314317412", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1314317412" }, { "id": "rs1314317412", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1314317412#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 980, "end_pos": 980, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "2", "chr_pos": "186676823", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N980", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1020, "end_pos": 1021, "sequence_org": "FF", "sequence_mut": "AA", "comment": "Increases ligand-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" }, { "database": "PubMed", "id": "19704023", "url": "https://glygen.org/publication/PubMed/19704023" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "93.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "98.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "91.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "81.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "86.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06756" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "common_name": "Human" } ], "gene": [ { "name": "ITGAV", "url": "https://www.uniprot.org/uniprot/P06756", "locus": { "chromosome": "2", "start_pos": 186680901, "end_pos": 186590010, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000138448", "url": "https://www.ensembl.org/id/ENSG00000138448" } ] } } ], "crossref": [ { "id": "ENSG00000138448", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000138448", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P06756", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06756", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL3660", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3660", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ITGAV", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ITGAV", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3685", "url": "https://www.ncbi.nlm.nih.gov/gene/3685", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6150", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6150", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P06756", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06756*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013517", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013517", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013519", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013519", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013649", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013649", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018184", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018184", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028994", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028994", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032695", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032695", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048285", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048285", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048286", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048286", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3685", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3685", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "193210", "url": "http://www.omim.org/entry/193210", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P06756", "url": "https://www.nextprot.org/entry/NX_P06756", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P06756", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06756", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YILHYEV", "url": "https://omabrowser.org/oma/group/YILHYEV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3816176at2759", "url": "http://www.orthodb.org/?query=3816176at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23220", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23220", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23220:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23220:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1JV2", "url": "https://www.rcsb.org/structure/1JV2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1L5G", "url": "https://www.rcsb.org/structure/1L5G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1M1X", "url": "https://www.rcsb.org/structure/1M1X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U8C", "url": "https://www.rcsb.org/structure/1U8C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IJE", "url": "https://www.rcsb.org/structure/3IJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G1E", "url": "https://www.rcsb.org/structure/4G1E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G1M", "url": "https://www.rcsb.org/structure/4G1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MMX", "url": "https://www.rcsb.org/structure/4MMX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MMY", "url": "https://www.rcsb.org/structure/4MMY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MMZ", "url": "https://www.rcsb.org/structure/4MMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O02", "url": "https://www.rcsb.org/structure/4O02", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UM8", "url": "https://www.rcsb.org/structure/4UM8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UM9", "url": "https://www.rcsb.org/structure/4UM9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FFG", "url": "https://www.rcsb.org/structure/5FFG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FFO", "url": "https://www.rcsb.org/structure/5FFO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NEM", "url": "https://www.rcsb.org/structure/5NEM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NER", "url": "https://www.rcsb.org/structure/5NER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NET", "url": "https://www.rcsb.org/structure/5NET", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NEU", "url": "https://www.rcsb.org/structure/5NEU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVQ", "url": "https://www.rcsb.org/structure/6AVQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVR", "url": "https://www.rcsb.org/structure/6AVR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVU", "url": "https://www.rcsb.org/structure/6AVU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DJP", "url": "https://www.rcsb.org/structure/6DJP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MK0", "url": "https://www.rcsb.org/structure/6MK0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSL", "url": "https://www.rcsb.org/structure/6MSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSU", "url": "https://www.rcsb.org/structure/6MSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NAJ", "url": "https://www.rcsb.org/structure/6NAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OM1", "url": "https://www.rcsb.org/structure/6OM1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OM2", "url": "https://www.rcsb.org/structure/6OM2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJA", "url": "https://www.rcsb.org/structure/6UJA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJB", "url": "https://www.rcsb.org/structure/6UJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJC", "url": "https://www.rcsb.org/structure/6UJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y1T", "url": "https://www.rcsb.org/structure/7Y1T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8TCF", "url": "https://www.rcsb.org/structure/8TCF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8TCG", "url": "https://www.rcsb.org/structure/8TCG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00357", "url": "http://pfam.xfam.org/family/PF00357", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01839", "url": "http://pfam.xfam.org/family/PF01839", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08441", "url": "http://pfam.xfam.org/family/PF08441", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF20805", "url": "http://pfam.xfam.org/family/PF20805", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF20806", "url": "http://pfam.xfam.org/family/PF20806", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P06756", "url": "https://pharos.nih.gov/targets/P06756", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053594", "url": "https://proconsortium.org/app/entry/PR:000053594", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053595", "url": "https://proconsortium.org/app/entry/PR:000053595", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P06756", "url": "http://purl.obolibrary.org/obo/PR_P06756", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P06756", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A8V8TKF7", "url": "https://www.uniprot.org/uniprot/A0A8V8TKF7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKF7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TKF7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKG0", "url": "https://www.uniprot.org/uniprot/A0A8V8TKG0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKG0-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TKG0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKH9", "url": "https://www.uniprot.org/uniprot/A0A8V8TKH9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKH9-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TKH9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKI2", "url": "https://www.uniprot.org/uniprot/A0A8V8TKI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKI2-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TKI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKT8", "url": "https://www.uniprot.org/uniprot/A0A8V8TKT8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKT8-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TKT8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKU8", "url": "https://www.uniprot.org/uniprot/A0A8V8TKU8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TKU8-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TKU8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLN8", "url": "https://www.uniprot.org/uniprot/A0A8V8TLN8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLN8-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLN8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLP3", "url": "https://www.uniprot.org/uniprot/A0A8V8TLP3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLP3-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLP3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLW4", "url": "https://www.uniprot.org/uniprot/A0A8V8TLW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLW4-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLW4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLW9", "url": "https://www.uniprot.org/uniprot/A0A8V8TLW9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLW9-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLW9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BZG1", "url": "https://www.uniprot.org/uniprot/H7BZG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BZG1-1", "url": "https://www.uniprot.org/uniprot/H7BZG1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06756-1", "url": "https://www.uniprot.org/uniprot/P06756-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06756-2", "url": "https://www.uniprot.org/uniprot/P06756-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06756-3", "url": "https://www.uniprot.org/uniprot/P06756-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1048, "header": "sp|P06756-1|ITAV_HUMAN Isoform 1 of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2 CANONICAL=P06756-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TKF7-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYSFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 953, "header": "tr|A0A8V8TKF7-1|A0A8V8TKF7_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696907.1", "url": "https://www.ensembl.org/id/ENST00000696907.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512968.1", "url": "https://www.ensembl.org/id/ENSP00000512968.1" } ] } }, { "isoform_ac": "A0A8V8TKG0-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYSFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1012, "header": "tr|A0A8V8TKG0-1|A0A8V8TKG0_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696912.1", "url": "https://www.ensembl.org/id/ENST00000696912.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512973.1", "url": "https://www.ensembl.org/id/ENSP00000512973.1" } ] } }, { "isoform_ac": "A0A8V8TKH9-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSR", "length": 175, "header": "tr|A0A8V8TKH9-1|A0A8V8TKH9_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186633330, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696908.1", "url": "https://www.ensembl.org/id/ENST00000696908.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512969.1", "url": "https://www.ensembl.org/id/ENSP00000512969.1" } ] } }, { "isoform_ac": "A0A8V8TKI2-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQRVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1021, "header": "tr|A0A8V8TKI2-1|A0A8V8TKI2_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696913.1", "url": "https://www.ensembl.org/id/ENST00000696913.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512974.1", "url": "https://www.ensembl.org/id/ENSP00000512974.1" } ] } }, { "isoform_ac": "A0A8V8TKT8-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 974, "header": "tr|A0A8V8TKT8-1|ITAV_HUMAN Computationally mapped isoform of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696910.1", "url": "https://www.ensembl.org/id/ENST00000696910.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512971.1", "url": "https://www.ensembl.org/id/ENSP00000512971.1" } ] } }, { "isoform_ac": "A0A8V8TKU8-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYEVCSC", "length": 815, "header": "tr|A0A8V8TKU8-1|A0A8V8TKU8_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186667788, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696937.1", "url": "https://www.ensembl.org/id/ENST00000696937.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512982.1", "url": "https://www.ensembl.org/id/ENSP00000512982.1" } ] } }, { "isoform_ac": "A0A8V8TLN8-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 989, "header": "tr|A0A8V8TLN8-1|A0A8V8TLN8_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696909.1", "url": "https://www.ensembl.org/id/ENST00000696909.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512970.1", "url": "https://www.ensembl.org/id/ENSP00000512970.1" } ] } }, { "isoform_ac": "A0A8V8TLP3-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVERY", "length": 170, "header": "tr|A0A8V8TLP3-1|A0A8V8TLP3_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186630803, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696914.1", "url": "https://www.ensembl.org/id/ENST00000696914.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512975.1", "url": "https://www.ensembl.org/id/ENSP00000512975.1" } ] } }, { "isoform_ac": "A0A8V8TLW4-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGWK", "length": 1044, "header": "tr|A0A8V8TLW4-1|ITAV_HUMAN Computationally mapped isoform of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186680634, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696906.1", "url": "https://www.ensembl.org/id/ENST00000696906.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512967.1", "url": "https://www.ensembl.org/id/ENSP00000512967.1" } ] } }, { "isoform_ac": "A0A8V8TLW9-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1010, "header": "tr|A0A8V8TLW9-1|ITAV_HUMAN Computationally mapped isoform of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696911.1", "url": "https://www.ensembl.org/id/ENST00000696911.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512972.1", "url": "https://www.ensembl.org/id/ENSP00000512972.1" } ] } }, { "isoform_ac": "H7BZG1-1", "url": "", "sequence": { "sequence": "XNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVSHWFRQIE", "length": 136, "header": "tr|H7BZG1-1|H7BZG1_HUMAN Computationally mapped isoform of Integrin subunit alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=1 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186675955, "end_pos": 186668877, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430709.1", "url": "https://www.ensembl.org/id/ENST00000430709.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000389442.1", "url": "https://www.ensembl.org/id/ENSP00000389442.1" } ] } }, { "isoform_ac": "P06756-1", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1048, "header": "sp|P06756-1|ITAV_HUMAN Isoform 1 of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000261023.8", "url": "https://www.ensembl.org/id/ENST00000261023.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000261023.3", "url": "https://www.ensembl.org/id/ENSP00000261023.3" } ] } }, { "isoform_ac": "P06756-2", "url": "", "sequence": { "sequence": "MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSRQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1012, "header": "sp|P06756-2|ITAV_HUMAN Isoform 2 of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186590339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374907.7", "url": "https://www.ensembl.org/id/ENST00000374907.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000364042.3", "url": "https://www.ensembl.org/id/ENSP00000364042.3" } ] } }, { "isoform_ac": "P06756-3", "url": "", "sequence": { "sequence": "MLLGTLLLILYILMLCRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1002, "header": "sp|P06756-3|ITAV_HUMAN Isoform 3 of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2 CANONICAL=P06756-1" }, "locus": { "chromosome": "2", "start_pos": 186677289, "end_pos": 186600335, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000433736.6", "url": "https://www.ensembl.org/id/ENST00000433736.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000404291.2", "url": "https://www.ensembl.org/id/ENSP00000404291.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 290, "start_aa": "Asn", "end_pos": 290, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn290", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "28117447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28117447" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4UM8", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM8" }, { "id": "4UM9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM9" }, { "id": "6DJP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6DJP" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "28117447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28117447" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4UM8", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM8" }, { "id": "4UM9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM9" }, { "id": "6DJP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6DJP" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 488, "start_aa": "Asn", "end_pos": 488, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn488", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 488, "start_aa": "Asn", "end_pos": 488, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn488", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "28117447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28117447" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4UM8", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM8" }, { "id": "4UM9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM9" }, { "id": "5NEM", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5NEM" }, { "id": "5NER", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5NER" }, { "id": "5NET", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5NET" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 554, "start_aa": "Asn", "end_pos": 554, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn554", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "28117447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28117447" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4UM8", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM8" }, { "id": "4UM9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM9" }, { "id": "6DJP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6DJP" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "P06756", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "P06756@N615", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P06756@N615" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "P06756", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "28117447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28117447" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4UM8", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM8" }, { "id": "4UM9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM9" }, { "id": "6DJP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6DJP" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 704, "start_aa": "Asn", "end_pos": 704, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn704", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "P06756", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "P06756", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "28117447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28117447" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4UM8", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM8" }, { "id": "4UM9", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4UM9" }, { "id": "6DJP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6DJP" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 835, "start_aa": "Asn", "end_pos": 835, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn835", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 851, "start_aa": "Asn", "end_pos": 851, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn851", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 874, "start_aa": "Asn", "end_pos": 874, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn874", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 876, "start_aa": "Thr", "end_pos": 876, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr876", "evidence": [ { "id": "P06756", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06756" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "1412", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1412" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 945, "start_aa": "Asn", "end_pos": 945, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn945", "evidence": [ { "id": "P06756", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 973, "start_aa": "Asn", "end_pos": 973, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn973", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 980, "start_aa": "Asn", "end_pos": 980, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn980", "evidence": [ { "id": "P06756", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "1U8C", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1U8C" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" } ] } ], "phosphorylation": [ { "start_pos": 1046, "end_pos": 1046, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1046" }, { "start_pos": 1048, "end_pos": 1048, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr1048" }, { "start_pos": 225, "end_pos": 225, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr225" }, { "start_pos": 279, "end_pos": 279, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P06756", "url": "http://phospho.elm.eu.org/byAccession/P06756.html" } ], "site_lbl": "Thr279" }, { "start_pos": 284, "end_pos": 284, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P06756", "url": "http://phospho.elm.eu.org/byAccession/P06756.html" } ], "site_lbl": "Tyr284" }, { "start_pos": 586, "end_pos": 586, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P06756", "url": "http://phospho.elm.eu.org/byAccession/P06756.html" } ], "site_lbl": "Thr586" }, { "start_pos": 591, "end_pos": 591, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06756", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P06756", "url": "http://phospho.elm.eu.org/byAccession/P06756.html" } ], "site_lbl": "Tyr591" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "The integrin alpha v beta 6 binds and activates latent TGF beta 1: a mechanism for regulating pulmonary inflammation and fibrosis.", "journal": "Cell", "date": "1999", "authors": "Munger JS, Huang X, Kawakatsu H, Griffiths MJ, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C, Matthay MA, Rifkin DB, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10025398", "url": "https://glygen.org/publication/PubMed/10025398" } ] }, { "title": "Vascular endothelial growth factor receptor KDR tyrosine kinase activity is increased by autophosphorylation of two activation loop tyrosine residues.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kendall RL, Rutledge RZ, Mao X, Tebben AJ, Hungate RW, Thomas KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10037737", "url": "https://glygen.org/publication/PubMed/10037737" } ] }, { "title": "Multisite autophosphorylation of p21-activated protein kinase gamma-PAK as a function of activation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gatti A, Huang Z, Tuazon PT, Traugh JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10075701", "url": "https://glygen.org/publication/PubMed/10075701" } ] }, { "title": "Carboxy-terminal conversion of profibrillin to fibrillin at a basic site by PACE/furin-like activity required for incorporation in the matrix.", "journal": "Journal of cell science", "date": "1999", "authors": "Raghunath M, Putnam EA, Ritty T, Hamstra D, Park ES, Tschodrich-Rotter M, Peters R, Rehemtulla A, Milewicz DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "10198291", "url": "https://glygen.org/publication/PubMed/10198291" } ] }, { "title": "Regulation of actin dynamics by stress-activated protein kinase 2 (SAPK2)-dependent phosphorylation of heat-shock protein of 27 kDa (Hsp27).", "journal": "Biochemical Society symposium", "date": "1999", "authors": "Landry J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10207622", "url": "https://glygen.org/publication/PubMed/10207622" } ] }, { "title": "The integrin alpha9beta1 mediates adhesion to activated endothelial cells and transendothelial neutrophil migration through interaction with vascular cell adhesion molecule-1.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Taooka Y, Chen J, Yednock T, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10209034", "url": "https://glygen.org/publication/PubMed/10209034" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Differential association of cytoplasmic signalling molecules SHP-1, SHP-2, SHIP and phospholipase C-gamma1 with PECAM-1/CD31.", "journal": "FEBS letters", "date": "1999", "authors": "Pumphrey NJ, Taylor V, Freeman S, Douglas MR, Bradfield PF, Young SP, Lord JM, Wakelam MJ, Bird IN, Salmon M, Buckley CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "10350061", "url": "https://glygen.org/publication/PubMed/10350061" } ] }, { "title": "Mechanisms of phagocytosis in macrophages.", "journal": "Annual review of immunology", "date": "1999", "authors": "Aderem A, Underhill DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "10358769", "url": "https://glygen.org/publication/PubMed/10358769" } ] }, { "title": "Alpha 2 beta 1 integrin mediates dermal fibroblast attachment to type VII collagen via a 158-amino-acid segment of the NC1 domain.", "journal": "Experimental cell research", "date": "1999", "authors": "Chen M, O'Toole EA, Li YY, Woodley DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10366422", "url": "https://glygen.org/publication/PubMed/10366422" } ] }, { "title": "Tyrosine phosphorylation of Vav stimulates IL-6 production in mast cells by a Rac/c-Jun N-terminal kinase-dependent pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Song JS, Haleem-Smith H, Arudchandran R, Gomez J, Scott PM, Mill JF, Tan TH, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10395673", "url": "https://glygen.org/publication/PubMed/10395673" } ] }, { "title": "The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor.", "journal": "Blood", "date": "1999-07-15", "authors": "Barillari G, Sgadari C, Fiorelli V, Samaniego F, Colombini S, Manzari V, Modesti A, Nair B C, Cafaro A, St\u00fcrzl M, Ensoli B", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "10397733", "url": "https://glygen.org/publication/PubMed/10397733" } ] }, { "title": "Ultrastructural distribution of 36-kD microfibril-associated glycoprotein (MAGP-36) in human and bovine tissues.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1999", "authors": "Toyoshima T, Yamashita K, Furuichi H, Shishibori T, Itano T, Kobayashi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10424889", "url": "https://glygen.org/publication/PubMed/10424889" } ] }, { "title": "CD31 (PECAM-1) exists as a dimer and is heavily N-glycosylated.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Newton JP, Hunter AP, Simmons DL, Buckley CD, Harvey DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "10425179", "url": "https://glygen.org/publication/PubMed/10425179" } ] }, { "title": "The leukocyte integrin alpha D beta 2 binds VCAM-1: evidence for a binding interface between I domain and VCAM-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Van der Vieren M, Crowe DT, Hoekstra D, Vazeux R, Hoffman PA, Grayson MH, Bochner BS, Gallatin WM, Staunton DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10438935", "url": "https://glygen.org/publication/PubMed/10438935" } ] }, { "title": "Characteristics of fibrinogen binding to the domain of CD11c, an alpha subunit of p150,95.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10543983", "url": "https://glygen.org/publication/PubMed/10543983" } ] }, { "title": "Tropoelastin binding to fibulins, nidogen-2 and other extracellular matrix proteins.", "journal": "FEBS letters", "date": "1999", "authors": "Sasaki T, Gohring W, Miosge N, Abrams WR, Rosenbloom J, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10544250", "url": "https://glygen.org/publication/PubMed/10544250" } ] }, { "title": "The integrin alpha(9)beta(1) binds to a novel recognition sequence (SVVYGLR) in the thrombin-cleaved amino-terminal fragment of osteopontin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yokosaki Y, Matsuura N, Sasaki T, Murakami I, Schneider H, Higashiyama S, Saitoh Y, Yamakido M, Taooka Y, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10593924", "url": "https://glygen.org/publication/PubMed/10593924" } ] }, { "title": "Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.", "journal": "Thrombosis and haemostasis", "date": "1999", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10605720", "url": "https://glygen.org/publication/PubMed/10605720" } ] }, { "title": "Homophilic NCAM interactions interfere with L1 stimulated neurite outgrowth.", "journal": "FEBS letters", "date": "1999", "authors": "Kristiansen LV, Marques FA, Soroka V, Ronn LC, Kiselyov V, Pedersen N, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10611478", "url": "https://glygen.org/publication/PubMed/10611478" } ] }, { "title": "Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.", "journal": "Experimental cell research", "date": "2000", "authors": "Byzova TV, Kim W, Midura RJ, Plow EF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10640428", "url": "https://glygen.org/publication/PubMed/10640428" } ] }, { "title": "Role of the latent transforming growth factor beta binding protein 1 in fibrillin-containing microfibrils in bone cells in vitro and in vivo.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2000", "authors": "Dallas SL, Keene DR, Bruder SP, Saharinen J, Sakai LY, Mundy GR, Bonewald LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10646116", "url": "https://glygen.org/publication/PubMed/10646116" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "A regulated interaction between alpha5beta1 integrin and osteopontin.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Barry ST, Ludbrook SB, Murrison E, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10673366", "url": "https://glygen.org/publication/PubMed/10673366" } ] }, { "title": "Phosphatidylinositol 3-kinase signaling mediates angiogenesis and expression of vascular endothelial growth factor in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Jiang BH, Zheng JZ, Aoki M, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10677529", "url": "https://glygen.org/publication/PubMed/10677529" } ] }, { "title": "VRAP is an adaptor protein that binds KDR, a receptor for vascular endothelial cell growth factor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Wu LW, Mayo LD, Dunbar JD, Kessler KM, Ozes ON, Warren RS, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10692392", "url": "https://glygen.org/publication/PubMed/10692392" } ] }, { "title": "Distinct recognition of collagen subtypes by alpha(1)beta(1) and alpha(2)beta(1) integrins. Alpha(1)beta(1) mediates cell adhesion to type XIII collagen.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nykvist P, Tu H, Ivaska J, Kapyla J, Pihlajaniemi T, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10713152", "url": "https://glygen.org/publication/PubMed/10713152" } ] }, { "title": "Vascular endothelial growth factor (VEGF)-driven actin-based motility is mediated by VEGFR2 and requires concerted activation of stress-activated protein kinase 2 (SAPK2/p38) and geldanamycin-sensitive phosphorylation of focal adhesion kinase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Rousseau S, Houle F, Kotanides H, Witte L, Waltenberger J, Landry J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10744763", "url": "https://glygen.org/publication/PubMed/10744763" } ] }, { "title": "The Shc-related adaptor protein, Sck, forms a complex with the vascular-endothelial-growth-factor receptor KDR in transfected cells.", "journal": "The Biochemical journal", "date": "2000", "authors": "Warner AJ, Lopez-Dee J, Knight EL, Feramisco JR, Prigent SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10749680", "url": "https://glygen.org/publication/PubMed/10749680" } ] }, { "title": "A MAP kinase-signaling pathway mediates neurite outgrowth on L1 and requires Src-dependent endocytosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2000", "authors": "Schmid RS, Pruitt WM, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10818153", "url": "https://glygen.org/publication/PubMed/10818153" } ] }, { "title": "Collagen, convulxin, and thrombin stimulate aggregation-independent tyrosine phosphorylation of CD31 in platelets. Evidence for the involvement of Src family kinases.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cicmil M, Thomas JM, Sage T, Barry FA, Leduc M, Bon C, Gibbins JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "10858437", "url": "https://glygen.org/publication/PubMed/10858437" } ] }, { "title": "Specific sequence motif of 8-Cys repeats of TGF-beta binding proteins, LTBPs, creates a hydrophobic interaction surface for binding of small latent TGF-beta.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Saharinen J, Keski-Oja J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10930463", "url": "https://glygen.org/publication/PubMed/10930463" } ] }, { "title": "Fibrillin-rich microfibrils of the extracellular matrix: ultrastructure and assembly.", "journal": "Micron (Oxford, England : 1993)", "date": "2001", "authors": "Sherratt MJ, Wess TJ, Baldock C, Ashworth J, Purslow PP, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "10936461", "url": "https://glygen.org/publication/PubMed/10936461" } ] }, { "title": "Cloning and characterisation of ITGAV, the genomic sequence for human cell adhesion protein (vitronectin) receptor alpha subunit, CD51.", "journal": "Cytogenet. Cell Genet.", "date": "2000", "authors": "Sims M A, Field S D, Barnes M R, Shaikh N, Ellington K, Murphy K E, Spurr N, Campbell D A", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "10965141", "url": "https://glygen.org/publication/PubMed/10965141" } ] }, { "title": "Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Chandrasekaran L, He CZ, Al-Barazi H, Krutzsch HC, Iruela-Arispe ML, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10982388", "url": "https://glygen.org/publication/PubMed/10982388" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Integrins as receptors for laminins.", "journal": "Microscopy research and technique", "date": "2000", "authors": "Belkin AM, Stepp MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11054877", "url": "https://glygen.org/publication/PubMed/11054877" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2001", "authors": "Souchelnytskyi S, Ronnstrand L, Heldin CH, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11100470", "url": "https://glygen.org/publication/PubMed/11100470" } ] }, { "title": "Evidence that furin is an authentic transforming growth factor-beta1-converting enzyme.", "journal": "The American journal of pathology", "date": "2001", "authors": "Dubois CM, Blanchette F, Laprise MH, Leduc R, Grondin F, Seidah NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11141505", "url": "https://glygen.org/publication/PubMed/11141505" } ] }, { "title": "Interaction of endostatin with integrins implicated in angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rehn M, Veikkola T, Kukk-Valdre E, Nakamura H, Ilmonen M, Lombardo C, Pihlajaniemi T, Alitalo K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11158588", "url": "https://glygen.org/publication/PubMed/11158588" } ] }, { "title": "Entry of human parechovirus 1.", "journal": "Journal of virology", "date": "2001-02", "authors": "Joki-Korpela P, Marjom\u00e4ki V, Krogerus C, Heino J, Hyypi\u00e4 T", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "11160695", "url": "https://glygen.org/publication/PubMed/11160695" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Processing of immunosuppressive pro-TGF-beta 1,2 by human glioblastoma cells involves cytoplasmic and secreted furin-like proteases.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Leitlein J, Aulwurm S, Waltereit R, Naumann U, Wagenknecht B, Garten W, Weller M, Platten M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11390472", "url": "https://glygen.org/publication/PubMed/11390472" } ] }, { "title": "Protein interaction studies of MAGP-1 with tropoelastin and fibrillin-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Jensen SA, Reinhardt DP, Gibson MA, Weiss AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "11481325", "url": "https://glygen.org/publication/PubMed/11481325" } ] }, { "title": "alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.", "journal": "Developmental biology", "date": "2001", "authors": "Tiger CF, Fougerousse F, Grundstrom G, Velling T, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11518510", "url": "https://glygen.org/publication/PubMed/11518510" } ] }, { "title": "Crystal structure of the extracellular segment of integrin alpha Vbeta3.", "journal": "Science", "date": "2001", "authors": "Xiong JP, Stehle T, Diefenbach B, Zhang R, Dunker R, Scott DL, Joachimiak A, Goodman SL, Arnaout MA", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "11546839", "url": "https://glygen.org/publication/PubMed/11546839" } ] }, { "title": "Selective binding of collagen subtypes by integrin alpha 1I, alpha 2I, and alpha 10I domains.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tulla M, Pentikainen OT, Viitasalo T, Kapyla J, Impola U, Nykvist P, Nissinen L, Johnson MS, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11572855", "url": "https://glygen.org/publication/PubMed/11572855" } ] }, { "title": "Multiple stimuli induce tyrosine phosphorylation of the Crk-binding sites of paxillin.", "journal": "The Biochemical journal", "date": "2001", "authors": "Schaller MD, Schaefer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11695992", "url": "https://glygen.org/publication/PubMed/11695992" } ] }, { "title": "Src mediates stimulation by vascular endothelial growth factor of the phosphorylation of focal adhesion kinase at tyrosine 861, and migration and anti-apoptosis in endothelial cells.", "journal": "The Biochemical journal", "date": "2001", "authors": "Abu-Ghazaleh R, Kabir J, Jia H, Lobo M, Zachary I", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11696015", "url": "https://glygen.org/publication/PubMed/11696015" } ] }, { "title": "Distinct glycoprotein Ib/V/IX and integrin alpha IIbbeta 3-dependent calcium signals cooperatively regulate platelet adhesion under flow.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nesbitt WS, Kulkarni S, Giuliano S, Goncalves I, Dopheide SM, Yap CL, Harper IS, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11713259", "url": "https://glygen.org/publication/PubMed/11713259" } ] }, { "title": "Regulation of melanoma cell migration and invasion by laminin-5 and alpha3beta1 integrin (VLA-3).", "journal": "Clinical & experimental metastasis", "date": "2002", "authors": "Tsuji T, Kawada Y, Kai-Murozono M, Komatsu S, Han SA, Takeuchi K, Mizushima H, Miyazaki K, Irimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11964076", "url": "https://glygen.org/publication/PubMed/11964076" } ] }, { "title": "The integrin alpha(v)beta8 mediates epithelial homeostasis through MT1-MMP-dependent activation of TGF-beta1.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mu D, Cambier S, Fjellbirkeland L, Baron JL, Munger JS, Kawakatsu H, Sheppard D, Broaddus VC, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "11970960", "url": "https://glygen.org/publication/PubMed/11970960" } ] }, { "title": "Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Li Z, Calzada MJ, Sipes JM, Cashel JA, Krutzsch HC, Annis DS, Mosher DF, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11980922", "url": "https://glygen.org/publication/PubMed/11980922" } ] }, { "title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.", "journal": "Nature cell biology", "date": "2002", "authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12134158", "url": "https://glygen.org/publication/PubMed/12134158" } ] }, { "title": "Sck is expressed in endothelial cells and participates in vascular endothelial growth factor-induced signaling.", "journal": "Oncogene", "date": "2002", "authors": "Ratcliffe KE, Tao Q, Yavuz B, Stoletov KV, Spring SC, Terman BI", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12214271", "url": "https://glygen.org/publication/PubMed/12214271" } ] }, { "title": "Cdc42/Rac1-mediated activation primes PAK2 for superactivation by tyrosine phosphorylation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Renkema GH, Pulkkinen K, Saksela K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12215529", "url": "https://glygen.org/publication/PubMed/12215529" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Laminin modulates morphogenic properties of the collagen XVIII endostatin domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Javaherian K, Park SY, Pickl WF, LaMontagne KR, Sjin RT, Gillies S, Lo KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "12237301", "url": "https://glygen.org/publication/PubMed/12237301" } ] }, { "title": "The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.", "journal": "The Biochemical journal", "date": "2003", "authors": "Ludbrook SB, Barry ST, Delves CJ, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12358597", "url": "https://glygen.org/publication/PubMed/12358597" } ] }, { "title": "Alternative splicing controls the mechanisms of FAK autophosphorylation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Toutant M, Costa A, Studler JM, Kadare G, Carnaud M, Girault JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12391143", "url": "https://glygen.org/publication/PubMed/12391143" } ] }, { "title": "Integrin alpha8beta1 mediates adhesion to LAP-TGFbeta1.", "journal": "Journal of cell science", "date": "2002", "authors": "Lu M, Munger JS, Steadele M, Busald C, Tellier M, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12415008", "url": "https://glygen.org/publication/PubMed/12415008" } ] }, { "title": "Latent transforming growth factor beta-binding protein 1 interacts with fibrillin and is a microfibril-associated protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Isogai Z, Ono RN, Ushiro S, Keene DR, Chen Y, Mazzieri R, Charbonneau NL, Reinhardt DP, Rifkin DB, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12429738", "url": "https://glygen.org/publication/PubMed/12429738" } ] }, { "title": "Cis and trans interactions of L1 with neuropilin-1 control axonal responses to semaphorin 3A.", "journal": "The EMBO journal", "date": "2002", "authors": "Castellani V, De Angelis E, Kenwrick S, Rougon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "12456642", "url": "https://glygen.org/publication/PubMed/12456642" } ] }, { "title": "The Shb adaptor protein causes Src-dependent cell spreading and activation of focal adhesion kinase in murine brain endothelial cells.", "journal": "Cellular signalling", "date": "2003", "authors": "Holmqvist K, Cross M, Riley D, Welsh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12464388", "url": "https://glygen.org/publication/PubMed/12464388" } ] }, { "title": "Novel role of gp91(phox)-containing NAD(P)H oxidase in vascular endothelial growth factor-induced signaling and angiogenesis.", "journal": "Circulation research", "date": "2002", "authors": "Ushio-Fukai M, Tang Y, Fukai T, Dikalov SI, Ma Y, Fujimoto M, Quinn MT, Pagano PJ, Johnson C, Alexander RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12480817", "url": "https://glygen.org/publication/PubMed/12480817" } ] }, { "title": "Making sense of latent TGFbeta activation.", "journal": "Journal of cell science", "date": "2003", "authors": "Annes JP, Munger JS, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "12482908", "url": "https://glygen.org/publication/PubMed/12482908" } ] }, { "title": "alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang WM, Kapyla J, Puranen JS, Knight CG, Tiger CF, Pentikainen OT, Johnson MS, Farndale RW, Heino J, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12496264", "url": "https://glygen.org/publication/PubMed/12496264" } ] }, { "title": "Bidirectional integrin alphaIIbbeta3 signalling regulating platelet adhesion under flow: contribution of protein kinase C.", "journal": "The Biochemical journal", "date": "2003", "authors": "Giuliano S, Nesbitt WS, Rooney M, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12585966", "url": "https://glygen.org/publication/PubMed/12585966" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Sudhakar A, Sugimoto H, Yang C, Lively J, Zeisberg M, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12682293", "url": "https://glygen.org/publication/PubMed/12682293" } ] }, { "title": "CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Lin Cristiane G, Leu Shr-Jeng, Chen Ningyu, Tebeau Christopher M, Lin Shao-Xia, Yeung Cho-Yau, Lau Lester F", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "12695522", "url": "https://glygen.org/publication/PubMed/12695522" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" }, { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" } ] }, { "title": "VEGF guides angiogenic sprouting utilizing endothelial tip cell filopodia.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Gerhardt H, Golding M, Fruttiger M, Ruhrberg C, Lundkvist A, Abramsson A, Jeltsch M, Mitchell C, Alitalo K, Shima D, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12810700", "url": "https://glygen.org/publication/PubMed/12810700" } ] }, { "title": "Integrin alphavbeta3, requirement for VEGFR2-mediated activation of SAPK2/p38 and for Hsp90-dependent phosphorylation of focal adhesion kinase in endothelial cells activated by VEGF.", "journal": "Cell stress & chaperones", "date": "2003", "authors": "Masson-Gadais B, Houle F, Laferriere J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12820653", "url": "https://glygen.org/publication/PubMed/12820653" } ] }, { "title": "Syndecan-4 as a molecule involved in defense mechanisms.", "journal": "Glycoconjugate journal", "date": "2002", "authors": "Ishiguro K, Kojima T, Muramatsu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "12975610", "url": "https://glygen.org/publication/PubMed/12975610" } ] }, { "title": "TGF beta signals through a heteromeric protein kinase receptor complex.", "journal": "Cell", "date": "1992", "authors": "Wrana JL, Attisano L, Carcamo J, Zentella A, Doody J, Laiho M, Wang XF, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "1333888", "url": "https://glygen.org/publication/PubMed/1333888" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Balbona K, Tran H, Godyna S, Ingham KC, Strickland DK, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1400330", "url": "https://glygen.org/publication/PubMed/1400330" } ] }, { "title": "Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains.", "journal": "Biochemistry", "date": "2003", "authors": "Krokhin OV, Cheng K, Sousa SL, Ens W, Standing KG, Wilkins JA", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "14596610", "url": "https://glygen.org/publication/PubMed/14596610" } ] }, { "title": "Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover.", "journal": "Cell communication & adhesion", "date": "2003", "authors": "Wilkins-Port CE, Sanderson RD, Tominna-Sebald E, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14681059", "url": "https://glygen.org/publication/PubMed/14681059" } ] }, { "title": "EMILIN-1 deficiency induces elastogenesis and vascular cell defects.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zanetti M, Braghetta P, Sabatelli P, Mura I, Doliana R, Colombatti A, Volpin D, Bonaldo P, Bressan GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "14701737", "url": "https://glygen.org/publication/PubMed/14701737" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Activation of EGF receptor kinase by L1-mediated homophilic cell interactions.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Islam R, Kristiansen LV, Romani S, Garcia-Alonso L, Hortsch M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "14718570", "url": "https://glygen.org/publication/PubMed/14718570" } ] }, { "title": "Phosphorylation of tyrosine 1214 on VEGFR2 is required for VEGF-induced activation of Cdc42 upstream of SAPK2/p38.", "journal": "Oncogene", "date": "2004", "authors": "Lamalice L, Houle F, Jourdan G, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "14724572", "url": "https://glygen.org/publication/PubMed/14724572" } ] }, { "title": "Syndecan-2 regulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen L, Klass C, Woods A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14976204", "url": "https://glygen.org/publication/PubMed/14976204" } ] }, { "title": "The adaptor protein shb binds to tyrosine 1175 in vascular endothelial growth factor (VEGF) receptor-2 and regulates VEGF-dependent cellular migration.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Holmqvist K, Cross MJ, Rolny C, Hagerkvist R, Rahimi N, Matsumoto T, Claesson-Welsh L, Welsh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15026417", "url": "https://glygen.org/publication/PubMed/15026417" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Integrin alphaVbeta6-mediated activation of latent TGF-beta requires the latent TGF-beta binding protein-1.", "journal": "The Journal of cell biology", "date": "2004-06-07", "authors": "Annes Justin P, Chen Yan, Munger John S, Rifkin Daniel B", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "15184403", "url": "https://glygen.org/publication/PubMed/15184403" } ] }, { "title": "Integrin alpha v beta 6 is an RGD-dependent receptor for coxsackievirus A9.", "journal": "Journal of virology", "date": "2004-07", "authors": "Williams Ci\u011fdem H, Kajander Tommi, Hyypi\u00e4 Timo, Jackson Terry, Sheppard Dean, Stanway Glyn", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "15194773", "url": "https://glygen.org/publication/PubMed/15194773" } ] }, { "title": "Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bix G, Fu J, Gonzalez EM, Macro L, Barker A, Campbell S, Zutter MM, Santoro SA, Kim JK, Hook M, Reed CC, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15240572", "url": "https://glygen.org/publication/PubMed/15240572" } ] }, { "title": "Regulation of vascular endothelial growth factor receptor 2-mediated phosphorylation of focal adhesion kinase by heat shock protein 90 and Src kinase activities.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Le Boeuf F, Houle F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15247219", "url": "https://glygen.org/publication/PubMed/15247219" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "Activation of Rac1 by paxillin-Crk-DOCK180 signaling complex is antagonized by Rap1 in migrating NBT-II cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Valles AM, Beuvin M, Boyer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15308668", "url": "https://glygen.org/publication/PubMed/15308668" } ] }, { "title": "Functional assessment of alphaEbeta7/E-cadherin interactions in the steady state postnatal thymus.", "journal": "Clinical & developmental immunology", "date": "2004", "authors": "Prockop SE, Petrie HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15330449", "url": "https://glygen.org/publication/PubMed/15330449" } ] }, { "title": "Galectin-3 is induced in rheumatoid arthritis synovial fibroblasts after adhesion to cartilage oligomeric matrix protein.", "journal": "Annals of the rheumatic diseases", "date": "2005", "authors": "Neidhart M, Zaucke F, von Knoch R, Jungel A, Michel BA, Gay RE, Gay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15345499", "url": "https://glygen.org/publication/PubMed/15345499" } ] }, { "title": "Structural basis of heteromeric smad protein assembly in TGF-beta signaling.", "journal": "Molecular cell", "date": "2004", "authors": "Chacko BM, Qin BY, Tiwari A, Shi G, Lam S, Hayward LJ, De Caestecker M, Lin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "15350224", "url": "https://glygen.org/publication/PubMed/15350224" } ] }, { "title": "The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kapyla J, Jaalinoja J, Tulla M, Ylostalo J, Nissinen L, Viitasalo T, Vehvilainen P, Marjomaki V, Nykvist P, Saamanen AM, Farndale RW, Birk DE, Ala-Kokko L, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15383545", "url": "https://glygen.org/publication/PubMed/15383545" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "The syndecan-1 ectodomain regulates alphavbeta3 integrin activity in human mammary carcinoma cells.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Beauvais DM, Burbach BJ, Rapraeger AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "15479743", "url": "https://glygen.org/publication/PubMed/15479743" } ] }, { "title": "TGF-beta activation by traction?", "journal": "Trends in cell biology", "date": "2004", "authors": "Keski-Oja J, Koli K, von Melchner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "15564041", "url": "https://glygen.org/publication/PubMed/15564041" } ] }, { "title": "Adhesion molecule L1 stimulates neuronal migration through Vav2-Pak1 signaling.", "journal": "Neuroreport", "date": "2004", "authors": "Schmid RS, Midkiff BR, Kedar VP, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "15597056", "url": "https://glygen.org/publication/PubMed/15597056" } ] }, { "title": "Focal adhesion kinase: in command and control of cell motility.", "journal": "Nature reviews. Molecular cell biology", "date": "2005", "authors": "Mitra SK, Hanson DA, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15688067", "url": "https://glygen.org/publication/PubMed/15688067" } ] }, { "title": "Tyrosine phosphorylation of beta3 integrin provides a binding site for Pyk2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Butler B, Blystone SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15695828", "url": "https://glygen.org/publication/PubMed/15695828" } ] }, { "title": "Loss of alpha10beta1 integrin expression leads to moderate dysfunction of growth plate chondrocytes.", "journal": "Journal of cell science", "date": "2005", "authors": "Bengtsson T, Aszodi A, Nicolae C, Hunziker EB, Lundgren-Akerlund E, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15713743", "url": "https://glygen.org/publication/PubMed/15713743" } ] }, { "title": "VLA-4-fibronectin interaction is required for the terminal differentiation of human bone marrow cells capable of spontaneous and high rate immunoglobulin secretion.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Roldan E, Garcia-Pardo A, Brieva JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "1588291", "url": "https://glygen.org/publication/PubMed/1588291" } ] }, { "title": "Canstatin acts on endothelial and tumor cells via mitochondrial damage initiated through interaction with alphavbeta3 and alphavbeta5 integrins.", "journal": "Cancer research", "date": "2005", "authors": "Magnon C, Galaup A, Mullan B, Rouffiac V, Bouquet C, Bidart JM, Griscelli F, Opolon P, Perricaudet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15899827", "url": "https://glygen.org/publication/PubMed/15899827" } ] }, { "title": "VEGF receptor-2 Y951 signaling and a role for the adapter molecule TSAd in tumor angiogenesis.", "journal": "The EMBO journal", "date": "2005", "authors": "Matsumoto T, Bohman S, Dixelius J, Berge T, Dimberg A, Magnusson P, Wang L, Wikner C, Qi JH, Wernstedt C, Wu J, Bruheim S, Mugishima H, Mukhopadhyay D, Spurkland A, Claesson-Welsh L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15962004", "url": "https://glygen.org/publication/PubMed/15962004" } ] }, { "title": "Critical role of the fifth domain of E-cadherin for heterophilic adhesion with alpha E beta 7, but not for homophilic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Shiraishi K, Tsuzaka K, Yoshimoto K, Kumazawa C, Nozaki K, Abe T, Tsubota K, Takeuchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16002701", "url": "https://glygen.org/publication/PubMed/16002701" } ] }, { "title": "Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16051604", "url": "https://glygen.org/publication/PubMed/16051604" } ] }, { "title": "Human alpha1 type IV collagen NC1 domain exhibits distinct antiangiogenic activity mediated by alpha1beta1 integrin.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Sudhakar A, Nyberg P, Keshamouni VG, Mannam AP, Li J, Sugimoto H, Cosgrove D, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16151532", "url": "https://glygen.org/publication/PubMed/16151532" } ] }, { "title": "Integrin alphaDbeta2, an adhesion receptor up-regulated on macrophage foam cells, exhibits multiligand-binding properties.", "journal": "Blood", "date": "2006", "authors": "Yakubenko VP, Yadav SP, Ugarova TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16239428", "url": "https://glygen.org/publication/PubMed/16239428" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Signal transduction by VEGF receptors in regulation of angiogenesis and lymphangiogenesis.", "journal": "Experimental cell research", "date": "2006", "authors": "Shibuya M, Claesson-Welsh L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "16336962", "url": "https://glygen.org/publication/PubMed/16336962" } ] }, { "title": "Ligand-binding specificities of laminin-binding integrins: a comprehensive survey of laminin-integrin interactions using recombinant alpha3beta1, alpha6beta1, alpha7beta1 and alpha6beta4 integrins.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2006", "authors": "Nishiuchi R, Takagi J, Hayashi M, Ido H, Yagi Y, Sanzen N, Tsuji T, Yamada M, Sekiguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16413178", "url": "https://glygen.org/publication/PubMed/16413178" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Wilhelmsen K, Litjens SH, Sonnenberg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16581764", "url": "https://glygen.org/publication/PubMed/16581764" } ] }, { "title": "Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Borza CM, Pozzi A, Borza DB, Pedchenko V, Hellmark T, Hudson BG, Zent R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16731529", "url": "https://glygen.org/publication/PubMed/16731529" } ] }, { "title": "Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eble JA, Kassner A, Niland S, Morgelin M, Grifka J, Grassel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16754661", "url": "https://glygen.org/publication/PubMed/16754661" } ] }, { "title": "Phosphorylation of focal adhesion kinase (FAK) on Ser732 is induced by rho-dependent kinase and is essential for proline-rich tyrosine kinase-2-mediated phosphorylation of FAK on Tyr407 in response to vascular endothelial growth factor.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Le Boeuf F, Houle F, Sussman M, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "16760434", "url": "https://glygen.org/publication/PubMed/16760434" } ] }, { "title": "Tropoelastin massively associates during coacervation to form quantized protein spheres.", "journal": "Biochemistry", "date": "2006", "authors": "Clarke AW, Arnspang EC, Mithieux SM, Korkmaz E, Braet F, Weiss AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "16906757", "url": "https://glygen.org/publication/PubMed/16906757" } ] }, { "title": "The synergy site of fibronectin is required for strong interaction with the platelet integrin alphaIIbbeta3.", "journal": "Annals of biomedical engineering", "date": "2006", "authors": "Chada D, Mather T, Nollert MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16933105", "url": "https://glygen.org/publication/PubMed/16933105" } ] }, { "title": "Laminin alpha1 chain LG4 module promotes cell attachment through syndecans and cell spreading through integrin alpha2beta1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hozumi K, Suzuki N, Nielsen PK, Nomizu M, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "16945929", "url": "https://glygen.org/publication/PubMed/16945929" } ] }, { "title": "Phosphorylation of Tyr1214 within VEGFR-2 triggers the recruitment of Nck and activation of Fyn leading to SAPK2/p38 activation and endothelial cell migration in response to VEGF.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lamalice L, Houle F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "16966330", "url": "https://glygen.org/publication/PubMed/16966330" } ] }, { "title": "Proteolytically processed soluble tumor endothelial marker (TEM) 5 mediates endothelial cell survival during angiogenesis by linking integrin alpha(v)beta3 to glycosaminoglycans.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Vallon M, Essler M", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "16982628", "url": "https://glygen.org/publication/PubMed/16982628" } ] }, { "title": "Integrin signaling is critical for pathological angiogenesis.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Mahabeleshwar GH, Feng W, Phillips DR, Byzova TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17030947", "url": "https://glygen.org/publication/PubMed/17030947" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" }, { "database": "iPTMnet", "id": "P06756-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Tissue vitronectin in normal adult human dermis is non-covalently bound to elastic tissue.", "journal": "The Journal of investigative dermatology", "date": "1991", "authors": "Hintner H, Dahlback K, Dahlback B, Pepys MB, Breathnach SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1708799", "url": "https://glygen.org/publication/PubMed/1708799" } ] }, { "title": "alphaVbeta6 is a novel receptor for human fibrillin-1. Comparative studies of molecular determinants underlying integrin-rgd affinity and specificity.", "journal": "The Journal of biological chemistry", "date": "2007-03-02", "authors": "Jovanovic Jelena, Takagi Junichi, Choulier Laurence, Abrescia Nicola G A, Stuart David I, van der Merwe P Anton, Mardon Helen J, Handford Penny A", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "17158881", "url": "https://glygen.org/publication/PubMed/17158881" } ] }, { "title": "Leading-edge research: PtdIns(3,4,5)P3 and directed migration.", "journal": "Nature cell biology", "date": "2007", "authors": "Franca-Koh J, Kamimura Y, Devreotes PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17199126", "url": "https://glygen.org/publication/PubMed/17199126" } ] }, { "title": "The NOX family of ROS-generating NADPH oxidases: physiology and pathophysiology.", "journal": "Physiological reviews", "date": "2007", "authors": "Bedard K, Krause KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17237347", "url": "https://glygen.org/publication/PubMed/17237347" } ] }, { "title": "Serine phosphorylation by casein kinase II controls endocytic L1 trafficking and axon growth.", "journal": "Journal of neuroscience research", "date": "2007", "authors": "Nakata A, Kamiguchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "17253643", "url": "https://glygen.org/publication/PubMed/17253643" } ] }, { "title": "Structure of a VEGF-VEGF receptor complex determined by electron microscopy.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Ruch C, Skiniotis G, Steinmetz MO, Walz T, Ballmer-Hofer K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17293873", "url": "https://glygen.org/publication/PubMed/17293873" } ] }, { "title": "The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Ogawa T, Tsubota Y, Hashimoto J, Kariya Y, Miyazaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "17314405", "url": "https://glygen.org/publication/PubMed/17314405" } ] }, { "title": "A comparative analysis of the fibulin protein family. Biochemical characterization, binding interactions, and tissue localization.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kobayashi N, Kostka G, Garbe JH, Keene DR, Bachinger HP, Hanisch FG, Markova D, Tsuda T, Timpl R, Chu ML, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "17324935", "url": "https://glygen.org/publication/PubMed/17324935" } ] }, { "title": "Critical residues of alphaX I-domain recognizing fibrinogen central domain.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Lee JH, Choi J, Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17339034", "url": "https://glygen.org/publication/PubMed/17339034" } ] }, { "title": "Rab27a regulates phagosomal pH and NADPH oxidase recruitment to dendritic cell phagosomes.", "journal": "Nature cell biology", "date": "2007", "authors": "Jancic C, Savina A, Wasmeier C, Tolmachova T, El-Benna J, Dang PM, Pascolo S, Gougerot-Pocidalo MA, Raposo G, Seabra MC, Amigorena S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "17351642", "url": "https://glygen.org/publication/PubMed/17351642" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "VEGF-induced Rac1 activation in endothelial cells is regulated by the guanine nucleotide exchange factor Vav2.", "journal": "Experimental cell research", "date": "2007", "authors": "Garrett TA, Van Buul JD, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17686471", "url": "https://glygen.org/publication/PubMed/17686471" } ] }, { "title": "Rab25 associates with alpha5beta1 integrin to promote invasive migration in 3D microenvironments.", "journal": "Dev. Cell", "date": "2007", "authors": "Caswell Patrick T, Spence Heather J, Parsons Maddy, White Dominic P, Clark Katherine, Cheng Kwai Wa, Mills Gordon B, Humphries Martin J, Messent Anthea J, Anderson Kurt I, McCaffrey Mary W, Ozanne Bradford W, Norman Jim C", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "17925226", "url": "https://glygen.org/publication/PubMed/17925226" } ] }, { "title": "Involvement of alpha(v)beta3 integrins in osteoclast function.", "journal": "Journal of bone and mineral metabolism", "date": "2007", "authors": "Nakamura I, Duong LT, Rodan SB, Rodan GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17968485", "url": "https://glygen.org/publication/PubMed/17968485" } ] }, { "title": "Integrin alphaVbeta3 Binds to the RGD motif of glycoprotein B of Kaposi's sarcoma-associated herpesvirus and functions as an RGD-dependent entry receptor.", "journal": "Journal of virology", "date": "2008-02", "authors": "Garrigues H Jacques, Rubinchikova Yelena E, Dipersio C Michael, Rose Timothy M", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "18045938", "url": "https://glygen.org/publication/PubMed/18045938" } ] }, { "title": "Fibronectin type III (FN3) modules of the neuronal cell adhesion molecule L1 interact directly with the fibroblast growth factor (FGF) receptor.", "journal": "Molecular and cellular neurosciences", "date": "2008", "authors": "Kulahin N, Li S, Hinsby A, Kiselyov V, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18222703", "url": "https://glygen.org/publication/PubMed/18222703" } ] }, { "title": "The cell biology of cross-presentation and the role of dendritic cell subsets.", "journal": "Immunology and cell biology", "date": "2008", "authors": "Lin ML, Zhan Y, Villadangos JA, Lew AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "18268517", "url": "https://glygen.org/publication/PubMed/18268517" } ] }, { "title": "Contributions of proteomics to understanding phagosome maturation.", "journal": "Cellular microbiology", "date": "2008", "authors": "Rogers LD, Foster LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "18331591", "url": "https://glygen.org/publication/PubMed/18331591" } ] }, { "title": "Targeting of bone morphogenetic protein growth factor complexes to fibrillin.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sengle G, Charbonneau NL, Ono RN, Sasaki T, Alvarez J, Keene DR, Bachinger HP, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "18339631", "url": "https://glygen.org/publication/PubMed/18339631" } ] }, { "title": "Direct binding of integrin alphavbeta3 to FGF1 plays a role in FGF1 signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mori S, Wu CY, Yamaji S, Saegusa J, Shi B, Ma Z, Kuwabara Y, Lam KS, Isseroff RR, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "18441324", "url": "https://glygen.org/publication/PubMed/18441324" } ] }, { "title": "The type I TGF-beta receptor is covalently modified and regulated by sumoylation.", "journal": "Nature cell biology", "date": "2008", "authors": "Kang JS, Saunier EF, Akhurst RJ, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "18469808", "url": "https://glygen.org/publication/PubMed/18469808" } ] }, { "title": "The RGD integrin binding site in human L1-CAM is important for nuclear signaling.", "journal": "Experimental cell research", "date": "2008", "authors": "Gast D, Riedle S, Kiefel H, Muerkoster SS, Schafer H, Schafer MK, Altevogt P", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18555990", "url": "https://glygen.org/publication/PubMed/18555990" } ] }, { "title": "Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Saegusa J, Akakura N, Wu CY, Hoogland C, Ma Z, Lam KS, Liu FT, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "18635536", "url": "https://glygen.org/publication/PubMed/18635536" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P06756-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "NADPH oxidase controls phagosomal pH and antigen cross-presentation in human dendritic cells.", "journal": "Blood", "date": "2008", "authors": "Mantegazza AR, Savina A, Vermeulen M, Perez L, Geffner J, Hermine O, Rosenzweig SD, Faure F, Amigorena S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "18682599", "url": "https://glygen.org/publication/PubMed/18682599" } ] }, { "title": "Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta.", "journal": "FASEB J.", "date": "2009", "authors": "Mikelis C, Sfaelou E, Koutsioumpa M, Kieffer N, Papadimitriou E", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "19141530", "url": "https://glygen.org/publication/PubMed/19141530" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "MHC molecules and microbial antigen processing in phagosomes.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Ramachandra L, Simmons D, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "19217269", "url": "https://glygen.org/publication/PubMed/19217269" } ] }, { "title": "VEGFs and receptors involved in angiogenesis versus lymphangiogenesis.", "journal": "Current opinion in cell biology", "date": "2009", "authors": "Lohela M, Bry M, Tammela T, Alitalo K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "19230644", "url": "https://glygen.org/publication/PubMed/19230644" } ] }, { "title": "Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.", "journal": "Angiogenesis", "date": "2009", "authors": "Somanath PR, Malinin NL, Byzova TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "19267251", "url": "https://glygen.org/publication/PubMed/19267251" } ] }, { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "Molecular interplay between endostatin, integrins, and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Moreau C, Chautard E, Jetne R, Fukai N, Ruggiero F, Humphries MJ, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "19502598", "url": "https://glygen.org/publication/PubMed/19502598" } ] }, { "title": "The direct binding of insulin-like growth factor-1 (IGF-1) to integrin alphavbeta3 is involved in IGF-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Saegusa J, Yamaji S, Ieguchi K, Wu CY, Lam KS, Liu FT, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "19578119", "url": "https://glygen.org/publication/PubMed/19578119" } ] }, { "title": "Crystal structure of the complete integrin alphaVbeta3 ectodomain plus an alpha/beta transmembrane fragment.", "journal": "The Journal of cell biology", "date": "2009-08-24", "authors": "Xiong Jian-Ping, Mahalingham Bhuvaneshwari, Alonso Jose Luis, Borrelli Laura Ann, Rui Xianliang, Anand Saurabh, Hyman Bradley T, Rysiok Thomas, M\u00fcller-Pompalla Dirk, Goodman Simon L, Arnaout M Amin", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "19704023", "url": "https://glygen.org/publication/PubMed/19704023" } ] }, { "title": "Single-molecule imaging reveals transforming growth factor-beta-induced type II receptor dimerization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Zhang W, Jiang Y, Wang Q, Ma X, Xiao Z, Zuo W, Fang X, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "19720988", "url": "https://glygen.org/publication/PubMed/19720988" } ] }, { "title": "Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Rock MJ, Holden P, Horton WA, Cohn DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20033473", "url": "https://glygen.org/publication/PubMed/20033473" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P06756-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06756-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Thrombospondin-induced adhesion of human platelets.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Tuszynski GP, Kowalska MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "2010551", "url": "https://glygen.org/publication/PubMed/2010551" } ] }, { "title": "Intracellular mechanisms of antigen cross presentation in dendritic cells.", "journal": "Current opinion in immunology", "date": "2010", "authors": "Amigorena S, Savina A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "20171863", "url": "https://glygen.org/publication/PubMed/20171863" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Integrin alphavbeta5 is a primary receptor for adenovirus in CAR-negative cells.", "journal": "Virology journal", "date": "2010-07-08", "authors": "Lyle Cynthia, McCormick Frank", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "20615244", "url": "https://glygen.org/publication/PubMed/20615244" } ] }, { "title": "Monomeric type I and type III transforming growth factor-beta receptors and their dimerization revealed by single-molecule imaging.", "journal": "Cell research", "date": "2010", "authors": "Zhang W, Yuan J, Yang Y, Xu L, Wang Q, Zuo W, Fang X, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "20625381", "url": "https://glygen.org/publication/PubMed/20625381" } ] }, { "title": "Phosphorylation of Ser 21 in Fyn regulates its kinase activity, focal adhesion targeting, and is required for cell migration.", "journal": "Journal of cellular physiology", "date": "2011", "authors": "Yeo MG, Oh HJ, Cho HS, Chun JS, Marcantonio EE, Song WK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "20658524", "url": "https://glygen.org/publication/PubMed/20658524" } ] }, { "title": "Direct binding of the EGF-like domain of neuregulin-1 to integrins ({alpha}v{beta}3 and {alpha}6{beta}4) is involved in neuregulin-1/ErbB signaling.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ieguchi K, Fujita M, Ma Z, Davari P, Taniguchi Y, Sekiguchi K, Wang B, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "20682778", "url": "https://glygen.org/publication/PubMed/20682778" } ] }, { "title": "Lumican inhibits cell migration through alpha2beta1 integrin.", "journal": "Experimental cell research", "date": "2010", "authors": "Zeltz C, Brezillon S, Kapyla J, Eble JA, Bobichon H, Terryn C, Perreau C, Franz CM, Heino J, Maquart FX, Wegrowski Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20705068", "url": "https://glygen.org/publication/PubMed/20705068" } ] }, { "title": "Crystal structure of a coiled-coil domain from human ROCK I.", "journal": "PloS one", "date": "2011", "authors": "Tu D, Li Y, Song HK, Toms AV, Gould CJ, Ficarro SB, Marto JA, Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "21445309", "url": "https://glygen.org/publication/PubMed/21445309" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Mouse and human lung fibroblasts regulate dendritic cell trafficking, airway inflammation, and fibrosis through integrin alphavbeta8-mediated activation of TGF-beta.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Kitamura H, Cambier S, Somanath S, Barker T, Minagawa S, Markovics J, Goodsell A, Publicover J, Reichardt L, Jablons D, Wolters P, Hill A, Marks JD, Lou J, Pittet JF, Gauldie J, Baron JL, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "21646718", "url": "https://glygen.org/publication/PubMed/21646718" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "MEK1/2 dual-specificity protein kinases: structure and regulation.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "22177953", "url": "https://glygen.org/publication/PubMed/22177953" } ] }, { "title": "GARP regulates the bioavailability and activation of TGFbeta.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Wang R, Zhu J, Dong X, Shi M, Lu C, Springer TA", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "22278742", "url": "https://glygen.org/publication/PubMed/22278742" } ] }, { "title": "Axl is essential for VEGF-A-dependent activation of PI3K/Akt.", "journal": "The EMBO journal", "date": "2012", "authors": "Ruan GX, Kazlauskas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "22327215", "url": "https://glygen.org/publication/PubMed/22327215" } ] }, { "title": "The epidermal basement membrane is a composite of separate laminin- or collagen IV-containing networks connected by aggregated perlecan, but not by nidogens.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Behrens DT, Villone D, Koch M, Brunner G, Sorokin L, Robenek H, Bruckner-Tuderman L, Bruckner P, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "22493504", "url": "https://glygen.org/publication/PubMed/22493504" } ] }, { "title": "Tetrastatin, the NC1 domain of the alpha4(IV) collagen chain: a novel potent anti-tumor matrikine.", "journal": "PloS one", "date": "2012", "authors": "Brassart-Pasco S, Senechal K, Thevenard J, Ramont L, Devy J, Di Stefano L, Dupont-Deshorgue A, Brezillon S, Feru J, Jazeron JF, Diebold MD, Ricard-Blum S, Maquart FX, Monboisse JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22539938", "url": "https://glygen.org/publication/PubMed/22539938" } ] }, { "title": "VEGFR2 induces c-Src signaling and vascular permeability in vivo via the adaptor protein TSAd.", "journal": "The Journal of experimental medicine", "date": "2012", "authors": "Sun Z, Li X, Massena S, Kutschera S, Padhan N, Gualandi L, Sundvold-Gjerstad V, Gustafsson K, Choy WW, Zang G, Quach M, Jansson L, Phillipson M, Abid MR, Spurkland A, Claesson-Welsh L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "22689825", "url": "https://glygen.org/publication/PubMed/22689825" } ] }, { "title": "Target-derived matricryptins organize cerebellar synapse formation through alpha3beta1 integrins.", "journal": "Cell reports", "date": "2012", "authors": "Su J, Stenbjorn RS, Gorse K, Su K, Hauser KF, Ricard-Blum S, Pihlajaniemi T, Fox MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22884367", "url": "https://glygen.org/publication/PubMed/22884367" } ] }, { "title": "The neural cell adhesion molecule N-CAM enhances L1-dependent cell-cell interactions.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Kadmon G, Kowitz A, Altevogt P, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "2295682", "url": "https://glygen.org/publication/PubMed/2295682" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Integrins alphavbeta3 and alpha4beta1 act as coreceptors for fractalkine, and the integrin-binding defective mutant of fractalkine is an antagonist of CX3CR1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012", "authors": "Fujita M, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "23125415", "url": "https://glygen.org/publication/PubMed/23125415" } ] }, { "title": "VEGFA and tumour angiogenesis.", "journal": "Journal of internal medicine", "date": "2013", "authors": "Claesson-Welsh L, Welsh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "23216836", "url": "https://glygen.org/publication/PubMed/23216836" } ] }, { "title": "c-Cbl-mediated neddylation antagonizes ubiquitination and degradation of the TGF-beta type II receptor.", "journal": "Molecular cell", "date": "2013", "authors": "Zuo W, Huang F, Chiang YJ, Li M, Du J, Ding Y, Zhang T, Lee HW, Jeong LS, Chen Y, Deng H, Feng XH, Luo S, Gao C, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "23290524", "url": "https://glygen.org/publication/PubMed/23290524" } ] }, { "title": "Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Willis CD, Poluzzi C, Mongiat M, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "23374253", "url": "https://glygen.org/publication/PubMed/23374253" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Integrins modulate the infection efficiency of West Nile virus into cells.", "journal": "The Journal of general virology", "date": "2013-08", "authors": "Schmidt Katja, Keller Markus, Bader Bernhard L, Koryt\u00e1\u0159 Tom\u00e1\u0161, Finke Stefan, Ziegler Ute, Groschup Martin H", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "23658209", "url": "https://glygen.org/publication/PubMed/23658209" } ] }, { "title": "Mitogen-activated protein kinases in innate immunity.", "journal": "Nature reviews. Immunology", "date": "2013", "authors": "Arthur JS, Ley SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "23954936", "url": "https://glygen.org/publication/PubMed/23954936" } ] }, { "title": "Identification of novel integrin binding partners for calcium and integrin binding protein 1 (CIB1): structural and thermodynamic basis of CIB1 promiscuity.", "journal": "Biochemistry", "date": "2013", "authors": "Freeman TC Jr, Black JL, Bray HG, Dagliyan O, Wu YI, Tripathy A, Dokholyan NV, Leisner TM, Parise LV", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "24011356", "url": "https://glygen.org/publication/PubMed/24011356" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "cDNA and amino acid sequences of the cell adhesion protein receptor recognizing vitronectin reveal a transmembrane domain and homologies with other adhesion protein receptors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Suzuki S, Argraves W S, Pytela R, Arai H, Krusius T, Pierschbacher M D, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "2430295", "url": "https://glygen.org/publication/PubMed/2430295" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "\u03b1v\u03b26- and \u03b1v\u03b28-integrins serve as interchangeable receptors for HSV gH/gL to promote endocytosis and activation of membrane fusion.", "journal": "PLoS pathogens", "date": "2013", "authors": "Gianni Tatiana, Salvioli Stefano, Chesnokova Liudmila S, Hutt-Fletcher Lindsey M, Campadelli-Fiume Gabriella", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "24367260", "url": "https://glygen.org/publication/PubMed/24367260" } ] }, { "title": "Amino acid sequence of the vitronectin receptor alpha subunit and comparative expression of adhesion receptor mRNAs.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Suzuki S, Argraves W S, Arai H, Languino L R, Pierschbacher M D, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "2443500", "url": "https://glygen.org/publication/PubMed/2443500" } ] }, { "title": "A novel vitronectin receptor integrin (alpha v beta x) is responsible for distinct adhesive properties of carcinoma cells.", "journal": "Cell", "date": "1989", "authors": "Cheresh D A, Smith J W, Cooper H M, Quaranta V", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "2467745", "url": "https://glygen.org/publication/PubMed/2467745" } ] }, { "title": "Herpes simplex virus type 2 glycoprotein H interacts with integrin alphavbeta3 to facilitate viral entry and calcium signaling in human genital tract epithelial cells.", "journal": "J. Virol.", "date": "2014", "authors": "Cheshenko Natalia, Trepanier Janie B, Gonz\u00e1lez Pablo A, Eugenin Eliseo A, Jacobs William R, Herold Betsy C", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "24942591", "url": "https://glygen.org/publication/PubMed/24942591" } ] }, { "title": "Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins alphavbeta3, alpha4beta1, and alpha5beta1.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Fujita M, Zhu K, Fujita CK, Zhao M, Lam KS, Kurth MJ, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "25398877", "url": "https://glygen.org/publication/PubMed/25398877" } ] }, { "title": "The CD9, CD81, and CD151 EC2 domains bind to the classical RGD-binding site of integrin alphavbeta3.", "journal": "Biochem. J.", "date": "2017", "authors": "Yu J, Lee CY, Changou CA, Cedano-Prieto DM, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "27993971", "url": "https://glygen.org/publication/PubMed/27993971" } ] }, { "title": "Force interacts with macromolecular structure in activation of TGF-beta.", "journal": "Nature", "date": "2017", "authors": "Dong X, Zhao B, Iacob RE, Zhu J, Koksal AC, Lu C, Engen JR, Springer TA", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756#ptm_processing" }, { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "28117447", "url": "https://glygen.org/publication/PubMed/28117447" } ] }, { "title": "The integrin-binding defective FGF2 mutants potently suppress FGF2 signalling and angiogenesis.", "journal": "Bioscience reports", "date": "2017", "authors": "Mori S, Hatori N, Kawaguchi N, Hamada Y, Shih TC, Wu CY, Lam KS, Matsuura N, Yamamoto H, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "28302677", "url": "https://glygen.org/publication/PubMed/28302677" } ] }, { "title": "Direct integrin binding to insulin-like growth factor-2 through the C-domain is required for insulin-like growth factor receptor type 1 (IGF1R) signaling.", "journal": "PloS one", "date": "2017", "authors": "Cedano Prieto DM, Cheng Y, Chang CC, Yu J, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "28873464", "url": "https://glygen.org/publication/PubMed/28873464" } ] }, { "title": "Direct binding to integrins and loss of disulfide linkage in interleukin-1beta (IL-1beta) are involved in the agonistic action of IL-1beta.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Takada YK, Yu J, Fujita M, Saegusa J, Wu CY, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "29030430", "url": "https://glygen.org/publication/PubMed/29030430" } ] }, { "title": "Cell surface proteoglycan binds mouse mammary epithelial cells to fibronectin and behaves as a receptor for interstitial matrix.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Saunders S, Bernfield M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "2963012", "url": "https://glygen.org/publication/PubMed/2963012" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P06756", "url": "" }, { "database": "GlyConnect", "id": "1412", "url": "https://glyconnect.expasy.org/browser/proteins/1412" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Integrin Binding to the Trimeric Interface of CD40L Plays a Critical Role in CD40/CD40L Signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2019", "authors": "Takada YK, Yu J, Shimoda M, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "31331973", "url": "https://glygen.org/publication/PubMed/31331973" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06756", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06756" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06756", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06756" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06756", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06756" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06756", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06756" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Combined inhibition of surface CD51 and \u03b3-secretase-mediated CD51 cleavage improves therapeutic efficacy in experimental metastatic hepatocellular carcinoma.", "journal": "Journal of hepatology", "date": "2023-12", "authors": "Cai Jianye, Wang Jiancheng, Jiang Chenhao, Ye Linsen, He Xinyi, Huang Jianyang, Sun Xiang, Ren Zhijun, Lai Xiaofan, Qiu Yuan, Wang Hongmiao, Lv Guo, Zheng Jun, Lu Tongyu, Chen Haitian, Liu Yasong, Chen Huaxin, Guan Yuanjun, Wang Yi, Wang Tao, Yao Jia, Sui Xin, Kang Yinqian, Zhang Yingcai, Li Hua, Wang Jinkai, Li Weiqiang, Chen Guihua, Yang Yang, Xiang Andy Peng", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" } ], "reference": [ { "type": "PubMed", "id": "37604269", "url": "https://glygen.org/publication/PubMed/37604269" } ] }, { "title": "Integrin \u03b1v\u03b21 facilitates ACE2-mediated entry of SARS-CoV-2.", "journal": "Virus research", "date": "2024-01-02", "authors": "Cai Zeqiong, Bai Han, Ren Doudou, Xue Biyun, Liu Yijia, Gong Tian, Zhang Xuan, Zhang Peng, Zhu Junsheng, Shi Binyin, Zhang Chengsheng", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" } ], "reference": [ { "type": "PubMed", "id": "37884208", "url": "https://glygen.org/publication/PubMed/37884208" } ] }, { "title": "Regulation of the integrin \u03b1V\u03b23- actin filaments axis in early osteogenic differentiation of human mesenchymal stem cells under cyclic tensile stress.", "journal": "Cell communication and signaling : CCS", "date": "2023-10-30", "authors": "Peng Yan, Qu Rongmei, Yang Yuchao, Fan Tingyu, Sun Bing, Khan Asmat Ullah, Wu Shutong, Liu Wenqing, Zhu Jinhui, Chen Junxin, Li Xiaoqing, Dai Jingxing, Ouyang Jun", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" } ], "reference": [ { "type": "PubMed", "id": "37904190", "url": "https://glygen.org/publication/PubMed/37904190" } ] }, { "title": "Interaction of Integrin \u03b1v\u03b28 With Type I Collagen Promotes Squamous Cell Carcinoma Cell Motility via RAC1 Activation.", "journal": "Anticancer research", "date": "2023-11", "authors": "Ishida Yasutaka, Shintani Tomoaki, Nobumoto Tadayoshi, Sakurai Shigeru, Hamana Tomoaki, Yanamoto Souichi, Hayashido Yasutaka", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" } ], "reference": [ { "type": "PubMed", "id": "37909974", "url": "https://glygen.org/publication/PubMed/37909974" } ] }, { "title": "Integrin-\u03b1v\u03b23 is a Therapeutically Targetable Fundamental Factor in Medulloblastoma Tumorigenicity and Radioresistance.", "journal": "Cancer research communications", "date": "2023-12-07", "authors": "Echavidre William, Durivault J\u00e9r\u00f4me, Gotorbe C\u00e9lia, Blanchard Thays, Pagnuzzi Marina, Vial Val\u00e9rie, Raes Florian, Broisat Alexis, Villeneuve R\u00e9my, Amblard R\u00e9gis, Garnier Nicolas, Ortholan C\u00e9cile, Faraggi Marc, Serrano Benjamin, Picco Vincent, Montemagno Christopher", "evidence": [ { "database": "RefSeq", "id": "NP_001138471", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138471" } ], "reference": [ { "type": "PubMed", "id": "38009896", "url": "https://glygen.org/publication/PubMed/38009896" } ] }, { "title": "Binding of laminin to type IV collagen: a morphological study.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Charonis AS, Tsilibary EC, Yurchenco PD, Furthmayr H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "3997977", "url": "https://glygen.org/publication/PubMed/3997977" } ] }, { "title": "Lysyl oxidase: preparation and role in elastin biosynthesis.", "journal": "Methods in enzymology", "date": "1982", "authors": "Kagan HM, Sullivan KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "6123066", "url": "https://glygen.org/publication/PubMed/6123066" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Binding of mouse and human fibulin-2 to extracellular matrix ligands.", "journal": "Journal of molecular biology", "date": "1995", "authors": "Sasaki T, Gohring W, Pan TC, Chu ML, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7500359", "url": "https://glygen.org/publication/PubMed/7500359" } ] }, { "title": "Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.", "journal": "Blood", "date": "1993", "authors": "Denis C, Williams JA, Lu X, Meyer D, Baruch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7505120", "url": "https://glygen.org/publication/PubMed/7505120" } ] }, { "title": "Autophosphorylation of the focal adhesion kinase, pp125FAK, directs SH2-dependent binding of pp60src.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Schaller MD, Hildebrand JD, Shannon JD, Fox JW, Vines RR, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "7509446", "url": "https://glygen.org/publication/PubMed/7509446" } ] }, { "title": "Entry of coxsackievirus A9 into host cells: specific interactions with alpha v beta 3 integrin, the vitronectin receptor.", "journal": "Virology", "date": "1994-09", "authors": "Roivainen M, Piirainen L, Hovi T, Virtanen I, Riikonen T, Heino J, Hyypi\u00e4 T", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "7519807", "url": "https://glygen.org/publication/PubMed/7519807" } ] }, { "title": "The integrin alpha v gene: identification and characterization of the promoter region.", "journal": "Biochim. Biophys. Acta", "date": "1994", "authors": "Donahue J P, Sugg N, Hawiger J", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "7522056", "url": "https://glygen.org/publication/PubMed/7522056" } ] }, { "title": "Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Nishimura SL, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7525578", "url": "https://glygen.org/publication/PubMed/7525578" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "The association of human fibulin-1 with elastic fibers: an immunohistological, ultrastructural, and RNA study.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1995", "authors": "Roark EF, Keene DR, Haudenschild CC, Godyna S, Little CD, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7534784", "url": "https://glygen.org/publication/PubMed/7534784" } ] }, { "title": "The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.", "journal": "Neuron", "date": "1995", "authors": "Varnum-Finney B, Venstrom K, Muller U, Kypta R, Backus C, Chiquet M, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7541634", "url": "https://glygen.org/publication/PubMed/7541634" } ] }, { "title": "CD31/PECAM-1 is a ligand for alpha v beta 3 integrin involved in adhesion of leukocytes to endothelium.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Piali L, Hammel P, Uherek C, Bachmann F, Gisler RH, Dunon D, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7542249", "url": "https://glygen.org/publication/PubMed/7542249" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Phagocytic processing of bacterial antigens for class I MHC presentation to T cells.", "journal": "Nature", "date": "1993", "authors": "Pfeifer JD, Wick MJ, Roberts RL, Findlay K, Normark SJ, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "7678924", "url": "https://glygen.org/publication/PubMed/7678924" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "The transforming growth factor beta receptors types I, II, and III form hetero-oligomeric complexes in the presence of ligand.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Moustakas A, Lin HY, Henis YI, Plamondon J, O'Connor-McCourt MD, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "7693660", "url": "https://glygen.org/publication/PubMed/7693660" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Processing of transforming growth factor beta 1 precursor by human furin convertase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Dubois CM, Laprise MH, Blanchette F, Gentry LE, Leduc R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "7737999", "url": "https://glygen.org/publication/PubMed/7737999" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Mechanism of activation of the TGF-beta receptor.", "journal": "Nature", "date": "1994", "authors": "Wrana JL, Attisano L, Wieser R, Ventura F, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8047140", "url": "https://glygen.org/publication/PubMed/8047140" } ] }, { "title": "The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "el Benna J, Faust LP, Babior BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "8089108", "url": "https://glygen.org/publication/PubMed/8089108" } ] }, { "title": "Platelet adhesion to collagen types I through VIII under conditions of stasis and flow is mediated by GPIa/IIa (alpha 2 beta 1-integrin).", "journal": "Blood", "date": "1994", "authors": "Saelman EU, Nieuwenhuis HK, Hese KM, de Groot PG, Heijnen HF, Sage EH, Williams S, McKeown L, Gralnick HR, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8118028", "url": "https://glygen.org/publication/PubMed/8118028" } ] }, { "title": "Cloning of a TGF beta type I receptor that forms a heteromeric complex with the TGF beta type II receptor.", "journal": "Cell", "date": "1993", "authors": "Franzen P, ten Dijke P, Ichijo H, Yamashita H, Schulz P, Heldin CH, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8242743", "url": "https://glygen.org/publication/PubMed/8242743" } ] }, { "title": "Interaction of type IV collagen with the isolated integrins alpha 1 beta 1 and alpha 2 beta 1.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Kern A, Eble J, Golbik R, Kuhn K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8344274", "url": "https://glygen.org/publication/PubMed/8344274" } ] }, { "title": "Cloning and characterization of two distinct human extracellular signal-regulated kinase activator kinases, MEK1 and MEK2.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Zheng CF, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8388392", "url": "https://glygen.org/publication/PubMed/8388392" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "The fourth immunoglobulin-like domain of NCAM contains a carbohydrate recognition domain for oligomannosidic glycans implicated in association with L1 and neurite outgrowth.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Horstkorte R, Schachner M, Magyar JP, Vorherr T, Schmitz B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8509458", "url": "https://glygen.org/publication/PubMed/8509458" } ] }, { "title": "Receptor-ligand interaction between CD44 and osteopontin (Eta-1).", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber GF, Ashkar S, Glimcher MJ, Cantor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8560266", "url": "https://glygen.org/publication/PubMed/8560266" } ] }, { "title": "Casein kinase II phosphorylates the neural cell adhesion molecule L1.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Wong EV, Schaefer AW, Landreth G, Lemmon V", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8592152", "url": "https://glygen.org/publication/PubMed/8592152" } ] }, { "title": "Stimulation of fibroblast growth factor receptor-1 occupancy and signaling by cell surface-associated syndecans and glypican.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Steinfeld R, Van Den Berghe H, David G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "8609172", "url": "https://glygen.org/publication/PubMed/8609172" } ] }, { "title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "8617235", "url": "https://glygen.org/publication/PubMed/8617235" } ] }, { "title": "Cell adhesion and integrin binding to recombinant human fibrillin-1.", "journal": "FEBS letters", "date": "1996", "authors": "Pfaff M, Reinhardt DP, Sakai LY, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "8617364", "url": "https://glygen.org/publication/PubMed/8617364" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Identification of alpha v beta 3 as a heterotypic ligand for CD31/PECAM-1.", "journal": "Journal of cell science", "date": "1996", "authors": "Buckley CD, Doyonnas R, Newton JP, Blystone SD, Brown EJ, Watt SM, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8838667", "url": "https://glygen.org/publication/PubMed/8838667" } ] }, { "title": "Osteopontin N-terminal domain contains a cryptic adhesive sequence recognized by alpha9beta1 integrin.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Smith LL, Cheung HK, Ling LE, Chen J, Sheppard D, Pytela R, Giachelli CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8910476", "url": "https://glygen.org/publication/PubMed/8910476" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Phosphorylation of Ser165 in TGF-beta type I receptor modulates TGF-beta1-induced cellular responses.", "journal": "The EMBO journal", "date": "1996", "authors": "Souchelnytskyi S, ten Dijke P, Miyazono K, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8947046", "url": "https://glygen.org/publication/PubMed/8947046" } ] }, { "title": "MADR2 is a substrate of the TGFbeta receptor and its phosphorylation is required for nuclear accumulation and signaling.", "journal": "Cell", "date": "1996", "authors": "Macias-Silva M, Abdollah S, Hoodless PA, Pirone R, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8980228", "url": "https://glygen.org/publication/PubMed/8980228" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "The protein-tyrosine phosphatase SHP-2 binds platelet/endothelial cell adhesion molecule-1 (PECAM-1) and forms a distinct signaling complex during platelet aggregation. Evidence for a mechanistic link between PECAM-1- and integrin-mediated cellular signaling.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Jackson DE, Ward CM, Wang R, Newman PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "9054388", "url": "https://glygen.org/publication/PubMed/9054388" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Multimerization of the cytoplasmic domain of syndecan-4 is required for its ability to activate protein kinase C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Oh ES, Woods A, Couchman JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "9115237", "url": "https://glygen.org/publication/PubMed/9115237" } ] }, { "title": "Vascular endothelial growth factor stimulates tyrosine phosphorylation and recruitment to new focal adhesions of focal adhesion kinase and paxillin in endothelial cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Abedi H, Zachary I", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9182576", "url": "https://glygen.org/publication/PubMed/9182576" } ] }, { "title": "Mechanism of TGFbeta receptor inhibition by FKBP12.", "journal": "The EMBO journal", "date": "1997", "authors": "Chen YG, Liu F, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9233797", "url": "https://glygen.org/publication/PubMed/9233797" } ] }, { "title": "Laminin 5 binds the NC-1 domain of type VII collagen.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Rousselle P, Keene DR, Ruggiero F, Champliaud MF, Rest M, Burgeson RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9245798", "url": "https://glygen.org/publication/PubMed/9245798" } ] }, { "title": "The alpha v beta 3 integrin `vitronectin receptor`.", "journal": "The international journal of biochemistry & cell biology", "date": "1997", "authors": "Horton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9251239", "url": "https://glygen.org/publication/PubMed/9251239" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "Residues on both faces of the first immunoglobulin fold contribute to homophilic binding sites of PECAM-1/CD31.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Newton JP, Buckley CD, Jones EY, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "9252369", "url": "https://glygen.org/publication/PubMed/9252369" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.", "journal": "The EMBO journal", "date": "1997", "authors": "Nakao A, Imamura T, Souchelnytskyi S, Kawabata M, Ishisaki A, Oeda E, Tamaki K, Hanai J, Heldin CH, Miyazono K, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9311995", "url": "https://glygen.org/publication/PubMed/9311995" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "Phosphorylation of Ser465 and Ser467 in the C terminus of Smad2 mediates interaction with Smad4 and is required for transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Souchelnytskyi S, Tamaki K, Engstrom U, Wernstedt C, ten Dijke P, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9346966", "url": "https://glygen.org/publication/PubMed/9346966" } ] }, { "title": "p38 MAP kinase activation by vascular endothelial growth factor mediates actin reorganization and cell migration in human endothelial cells.", "journal": "Oncogene", "date": "1997", "authors": "Rousseau S, Houle F, Landry J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9393975", "url": "https://glygen.org/publication/PubMed/9393975" } ] }, { "title": "A single immunoglobulin-like domain of the human neural cell adhesion molecule L1 supports adhesion by multiple vascular and platelet integrins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Felding-Habermann B, Silletti S, Mei F, Siu CH, Yip PM, Brooks PC, Cheresh DA, O'Toole TE, Ginsberg MH, Montgomery AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "9396761", "url": "https://glygen.org/publication/PubMed/9396761" } ] }, { "title": "Interactions of FLT-1 and KDR with phospholipase C gamma: identification of the phosphotyrosine binding sites.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Cunningham SA, Arrate MP, Brock TA, Waxham MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9398617", "url": "https://glygen.org/publication/PubMed/9398617" } ] }, { "title": "Integrin alpha v beta 6 enhances coxsackievirus B1 lytic infection of human colon cancer cells.", "journal": "Virology", "date": "1997-12-08", "authors": "Agrez M V, Shafren D R, Gu X, Cox K, Sheppard D, Barry R D", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "reference": [ { "type": "PubMed", "id": "9426447", "url": "https://glygen.org/publication/PubMed/9426447" } ] }, { "title": "The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.", "journal": "Journal of cell science", "date": "1998", "authors": "Memmo LM, McKeown-Longo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9443892", "url": "https://glygen.org/publication/PubMed/9443892" } ] }, { "title": "CAS/Crk coupling serves as a `molecular switch` for induction of cell migration.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Klemke RL, Leng J, Molander R, Brooks PC, Vuori K, Cheresh DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9472046", "url": "https://glygen.org/publication/PubMed/9472046" } ] }, { "title": "Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Yokosaki Y, Matsuura N, Higashiyama S, Murakami I, Obara M, Yamakido M, Shigeto N, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9565552", "url": "https://glygen.org/publication/PubMed/9565552" } ] }, { "title": "Human colonic cancer cells synthesize and adhere to laminin-5. Their adhesion to laminin-5 involves multiple receptors among which is integrin alpha2beta1.", "journal": "Journal of cell science", "date": "1998", "authors": "Orian-Rousseau V, Aberdam D, Rousselle P, Messent A, Gavrilovic J, Meneguzzi G, Kedinger M, Simon-Assmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9645947", "url": "https://glygen.org/publication/PubMed/9645947" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Interactions between growth factors and integrins: latent forms of transforming growth factor-beta are ligands for the integrin alphavbeta1.", "journal": "Molecular biology of the cell", "date": "1998", "authors": "Munger JS, Harpel JG, Giancotti FG, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "9725916", "url": "https://glygen.org/publication/PubMed/9725916" } ] }, { "title": "Immature dendritic cells phagocytose apoptotic cells via alphavbeta5 and CD36, and cross-present antigens to cytotoxic T lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Albert ML, Pearce SF, Francisco LM, Sauter B, Roy P, Silverstein RL, Bhardwaj N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "9763615", "url": "https://glygen.org/publication/PubMed/9763615" } ] }, { "title": "Recruitment and activation of SHP-1 protein-tyrosine phosphatase by human platelet endothelial cell adhesion molecule-1 (PECAM-1). Identification of immunoreceptor tyrosine-based inhibitory motif-like binding motifs and substrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Hua CT, Gamble JR, Vadas MA, Jackson DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "9774457", "url": "https://glygen.org/publication/PubMed/9774457" } ] }, { "title": "p40(phox) is phosphorylated on threonine 154 and serine 315 during activation of the phagocyte NADPH oxidase. Implication of a protein kinase c-type kinase in the phosphorylation process.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Bouin AP, Grandvaux N, Vignais PV, Fuchs A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973" } ], "reference": [ { "type": "PubMed", "id": "9804763", "url": "https://glygen.org/publication/PubMed/9804763" } ] }, { "title": "Effect of the interaction between fibronectin and VLA-4 on the proliferation of human B cells, especially a novel human B-cell line, OPM-3.", "journal": "British journal of haematology", "date": "1998", "authors": "Yoshida H, Nishiura T, Karasuno T, Matsumura I, Ishikawa J, Yoshimura M, Yokota T, Okajima Y, Ogawa M, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9858236", "url": "https://glygen.org/publication/PubMed/9858236" } ] }, { "title": "SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.", "journal": "Cell", "date": "1998", "authors": "Tsukazaki T, Chiang TA, Davison AF, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9865696", "url": "https://glygen.org/publication/PubMed/9865696" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:3685", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3685", "resource": "KEGG Pathway" }, { "id": "R-HSA-1236973", "name": "Cross-presentation of particulate exogenous antigens (phagosomes)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236973", "resource": "Reactome", "description": "Cross-presentation of particulate exogenous antigens (phagosomes)" }, { "id": "R-HSA-1566948", "name": "Elastic fibre formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948", "resource": "Reactome", "description": "Elastic fibre formation" }, { "id": "R-HSA-210990", "name": "PECAM1 interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990", "resource": "Reactome", "description": "PECAM1 interactions" }, { "id": "R-HSA-2129379", "name": "Molecules associated with elastic fibres", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "resource": "Reactome", "description": "Molecules associated with elastic fibres" }, { "id": "R-HSA-216083", "name": "Integrin cell surface interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "resource": "Reactome", "description": "Integrin cell surface interactions" }, { "id": "R-HSA-2173789", "name": "TGF-beta receptor signaling activates SMADs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789", "resource": "Reactome", "description": "TGF-beta receptor signaling activates SMADs" }, { "id": "R-HSA-3000157", "name": "Laminin interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "resource": "Reactome", "description": "Laminin interactions" }, { "id": "R-HSA-3000170", "name": "Syndecan interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "resource": "Reactome", "description": "Syndecan interactions" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-4420097", "name": "VEGFA-VEGFR2 Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097", "resource": "Reactome", "description": "VEGFA-VEGFR2 Pathway" }, { "id": "R-HSA-445144", "name": "Signal transduction by L1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "resource": "Reactome", "description": "Signal transduction by L1" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "F1LZX9-1", "protein_name": "Integrin subunit alpha V", "gene_name": "Itgav", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MADPGRLLLRPRPGGLLLLLLGLLLPFAGSFNLDVESPAEYAGPEGSYFGFAVDFFVPSTSSMFLLVGAPKANTTQPGIIEGGQVLKCDCSSSRRCQPIEFDSTGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQILQGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVYPSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLNFQVELLLDKLKQKGAIRRALFLHNRSPGHSKDMTVFRGGQTQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAADATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLTVKAQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSPDHIFLPIPNWEYKETPETEEDVGPVVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLYILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAEQGGRNHLITKRDLSLSEGDVHTLGCGTAQCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYKNLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1042 }, "evidence": [ { "id": "P06756", "url": "https://omabrowser.org/oma/group/P06756/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P43406-1", "protein_name": "Integrin alpha-V", "gene_name": "Itgav", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAPGRLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPSTSSRMFLLVGAPKANTTQPGIVEGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQILEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVYPSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLHFQVELLLDKLKQKGAIRRALFLHNRSPVHSKTMTVFRGGQMQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAADATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVNSDQKKIYIGDDNPLTLTVKAQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSPDHIFLPIPNWEYKENPETEEDVGPIVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLYILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAAGQGERNHLITKRDLTLREGDVHTLGCGIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYKNLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET", "length": 1044 }, "evidence": [ { "id": "45921795", "url": "http://www.informatics.jax.org/homology/45921795", "database": "MGI" }, { "id": "P06756", "url": "https://omabrowser.org/oma/group/P06756/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 37, "go_terms": [ { "name": "positive regulation of small GTPase mediated signal transduction", "id": "GO:0051057", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051057", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of lipid storage", "id": "GO:0010888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010888", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "vasculogenesis", "id": "GO:0001570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001570", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin-mediated signaling pathway", "id": "GO:0007229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "positive regulation of cell adhesion", "id": "GO:0045785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045785", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell-matrix adhesion", "id": "GO:0007160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007160", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell adhesion mediated by integrin", "id": "GO:0033627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033627", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell-cell adhesion", "id": "GO:0098609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of macrophage derived foam cell differentiation", "id": "GO:0010745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010745", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "positive regulation of osteoblast proliferation", "id": "GO:0033690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033690", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "substrate adhesion-dependent cell spreading", "id": "GO:0034446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034446", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "viral entry into host cell", "id": "GO:0046718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046718", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "apolipoprotein A-I-mediated signaling pathway", "id": "GO:0038027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038027", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "apoptotic cell clearance", "id": "GO:0043277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043277", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "calcium ion transmembrane transport", "id": "GO:0070588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070588", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative chemotaxis", "id": "GO:0050919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050919", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell-substrate adhesion", "id": "GO:0031589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031589", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:0097192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097192", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "positive regulation of intracellular signal transduction", "id": "GO:1902533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902533", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "heterotypic cell-cell adhesion", "id": "GO:0034113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034113", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "endodermal cell differentiation", "id": "GO:0035987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035987", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of low-density lipoprotein receptor activity", "id": "GO:1905598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905598", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of lipid transport", "id": "GO:0032369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032369", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of lipoprotein metabolic process", "id": "GO:0050748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050748", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "negative regulation of entry of bacterium into host cell", "id": "GO:2000536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000536", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "regulation of phagocytosis", "id": "GO:0050764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050764", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "regulation of transforming growth factor beta activation", "id": "GO:1901388", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901388", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "entry into host cell by a symbiont-containing vacuole", "id": "GO:0085017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0085017", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "transforming growth factor beta production", "id": "GO:0071604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071604", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "extracellular matrix protein binding", "id": "GO:1990430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990430", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "coreceptor activity", "id": "GO:0015026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015026", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "protein kinase C binding", "id": "GO:0005080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005080", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "transforming growth factor beta binding", "id": "GO:0050431", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050431", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "extracellular matrix binding", "id": "GO:0050840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050840", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "fibronectin binding", "id": "GO:0001968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001968", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "voltage-gated calcium channel activity", "id": "GO:0005245", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005245", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "opsonin binding", "id": "GO:0001846", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001846", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 21, "go_terms": [ { "name": "alphav-beta3 integrin-IGF-1-IGF1R complex", "id": "GO:0035867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035867", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "specific granule membrane", "id": "GO:0035579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035579", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "ruffle membrane", "id": "GO:0032587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032587", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "lamellipodium membrane", "id": "GO:0031258", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031258", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "filopodium membrane", "id": "GO:0031527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031527", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "microvillus membrane", "id": "GO:0031528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031528", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin complex", "id": "GO:0008305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008305", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin alphav-beta3 complex", "id": "GO:0034683", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034683", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin alphav-beta5 complex", "id": "GO:0034684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034684", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin alphav-beta6 complex", "id": "GO:0034685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034685", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "integrin alphav-beta8 complex", "id": "GO:0034686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034686", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-HMGB1 complex", "id": "GO:0035868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035868", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-PKCalpha complex", "id": "GO:0035866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035866", "evidence": [ { "database": "UniProtKB", "id": "P06756", "url": "https://www.uniprot.org/uniprot/P06756" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "integrin alpha-V N-glycosylated 1 (human)", "definition": "An integrin alpha-V (human) that has been N-glycosylated at the residue equivalent to Asn-615 of the amino acid sequence represented by UniProtKB:P06756-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P06756-1, Asn-615, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053594", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053594" } ] }, { "name": "integrin alpha-V N-glycosylated 2 (human)", "definition": "An integrin alpha-V (human) that has been N-glycosylated at the residue equivalent to Asn-74 of the amino acid sequence represented by UniProtKB:P06756-1, in which the glycan composition is represented by GlyTouCan:G03574QJ. Example: UniProtKB:P06756-1, Asn-74, MOD:00160~GNO:G03574QJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053595", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053595" } ] } ], "site_annotation": [ { "start_pos": 290, "end_pos": 292, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 488, "end_pos": 490, "annotation": "n_glycosylation_sequon" }, { "start_pos": 554, "end_pos": 556, "annotation": "n_glycosylation_sequon" }, { "start_pos": 615, "end_pos": 617, "annotation": "n_glycosylation_sequon" }, { "start_pos": 704, "end_pos": 706, "annotation": "n_glycosylation_sequon" }, { "start_pos": 74, "end_pos": 76, "annotation": "n_glycosylation_sequon" }, { "start_pos": 835, "end_pos": 837, "annotation": "n_glycosylation_sequon" }, { "start_pos": 851, "end_pos": 853, "annotation": "n_glycosylation_sequon" }, { "start_pos": 874, "end_pos": 876, "annotation": "n_glycosylation_sequon" }, { "start_pos": 945, "end_pos": 947, "annotation": "n_glycosylation_sequon" }, { "start_pos": 973, "end_pos": 975, "annotation": "n_glycosylation_sequon" }, { "start_pos": 980, "end_pos": 982, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 74, 290, 296, 488, 554, 615, 704, 835, 851, 874, 945, 973, 980 ], "o_linked_sites": [ 876 ], "snv_sites": [ 76, 290, 292, 296, 388, 476, 488, 550, 554, 574, 617, 632, 704, 835, 876, 945, 947, 959, 972, 973, 980 ], "glycation_sites": [], "phosphorylation_sites": [ 225, 279, 284, 586, 591, 1046, 1048 ], "sequon_annotation_sites": [ { "start_pos": 290, "end_pos": 292 }, { "start_pos": 296, "end_pos": 298 }, { "start_pos": 488, "end_pos": 490 }, { "start_pos": 554, "end_pos": 556 }, { "start_pos": 615, "end_pos": 617 }, { "start_pos": 704, "end_pos": 706 }, { "start_pos": 74, "end_pos": 76 }, { "start_pos": 835, "end_pos": 837 }, { "start_pos": 851, "end_pos": 853 }, { "start_pos": 874, "end_pos": 876 }, { "start_pos": 945, "end_pos": 947 }, { "start_pos": 973, "end_pos": 975 }, { "start_pos": 980, "end_pos": 982 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 51 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_glycans", "count": 29 }, { "field": "n_linked_glycan_sites", "count": 17 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 13 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 38 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 29 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 30 }, { "field": "total_sites", "count": 21 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 24 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 300 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }