{ "uniprot_canonical_ac": "P05412-1", "uniprot_ac": "P05412", "uniprot_id": "JUN_HUMAN", "mass": { "chemical_mass": 35676.0, "monoisotopic_mass": 35676.0 }, "refseq": { "ac": "NP_002219", "name": "transcription factor Jun", "summary": "This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" }, "gene_names": [ { "name": "JUN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05412", "id": "P05412" }, { "name": "AP-1; AP1; c-Jun; cJUN; p39", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219", "id": "NP_002219" }, { "name": "JUN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219", "id": "NP_002219" } ], "protein_names": [ { "name": "Transcription factor Jun", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05412" }, { "name": "AP1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05412" }, { "name": "Activator protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05412" }, { "name": "Jun activation domain binding protein; jun oncogene; v-jun avian sarcoma virus 17 oncogene homolog; transcription factor AP-1; activator protein 1; enhancer-binding protein AP1; proto-oncogene c-Jun; v-jun sarcoma virus 17 oncogene homolog; proto-oncogene cJun; transcription factor AP-1 subunit Jun", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219", "id": "NP_002219" }, { "name": "Proto-oncogene c-Jun", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05412" }, { "name": "Transcription factor AP-1 subunit Jun", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05412" }, { "name": "V-jun avian sarcoma virus 17 oncogene homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05412" }, { "name": "p39", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05412" }, { "name": "transcription factor Jun", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219", "id": "NP_002219" } ], "function": [ { "annotation": "(Microbial infection) Upon Epstein-Barr virus (EBV) infection, binds to viral BZLF1 Z promoter and activates viral BZLF1 expression.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412#function" }, { "database": "PubMed", "id": "31341047", "url": "https://glygen.org/publication/PubMed/31341047" } ] }, { "annotation": "C-JUN is a barrier in hESC to cardiomyocyte transition. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" }, { "database": "PubMed", "id": "37604584", "url": "https://glygen.org/publication/PubMed/37604584" } ] }, { "annotation": "Cooperation of MLL1 and Jun in controlling H3K4me3 on enhancers in colorectal cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" }, { "database": "PubMed", "id": "38012744", "url": "https://glygen.org/publication/PubMed/38012744" } ] }, { "annotation": "Homeobox Protein PROX1 Expression is Negatively Regulated by Histone Deacetylase 1 and c-JUN Complex in MDA-MB-231 Human Breast Cancer Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" }, { "database": "PubMed", "id": "38206773", "url": "https://glygen.org/publication/PubMed/38206773" } ] }, { "annotation": "LncRNA THRIL, transcriptionally activated by AP-1 and stabilized by METTL14-mediated m6A modification, accelerates LPS-evoked acute injury in alveolar epithelial cells.", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" }, { "database": "PubMed", "id": "37543013", "url": "https://glygen.org/publication/PubMed/37543013" } ] }, { "annotation": "This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" } ] }, { "annotation": "Thrombin-Induced COX-2 Expression and PGE2 Synthesis in Human Tracheal Smooth Muscle Cells: Role of PKCdelta/Pyk2-Dependent AP-1 Pathway Modulation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" }, { "database": "PubMed", "id": "37894811", "url": "https://glygen.org/publication/PubMed/37894811" } ] }, { "annotation": "Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed:10995748, PubMed:22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to the AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing its transcriptional activity (By similarity). Together with FOSB, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway (PubMed:12618758). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed:17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412#function" }, { "database": "UniProtKB", "id": "P05627", "url": "https://www.uniprot.org/uniprot/P05627#function" }, { "database": "PubMed", "id": "12618758", "url": "https://glygen.org/publication/PubMed/12618758" }, { "database": "PubMed", "id": "10995748", "url": "https://glygen.org/publication/PubMed/10995748" }, { "database": "PubMed", "id": "17210646", "url": "https://glygen.org/publication/PubMed/17210646" }, { "database": "PubMed", "id": "24623306", "url": "https://glygen.org/publication/PubMed/24623306" }, { "database": "PubMed", "id": "22083952", "url": "https://glygen.org/publication/PubMed/22083952" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs779728211", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779728211" }, { "id": "rs779728211", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779728211" }, { "id": "rs779728211", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs779728211#frequency_tab" }, { "id": "rs779728211", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779728211" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 129, "end_pos": 129, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).", "chr_id": "1", "chr_pos": "58782685", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S129", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1303207525", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1303207525" }, { "id": "rs1303207525", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1303207525#frequency_tab" }, { "id": "rs1303207525", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1303207525" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 131, "end_pos": 131, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "1", "chr_pos": "58782679", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T131", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1303207525", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1303207525" }, { "id": "rs1303207525", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1303207525#frequency_tab" }, { "id": "rs1303207525", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1303207525" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 131, "end_pos": 131, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "1", "chr_pos": "58782679", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T131", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1247923524", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1247923524" }, { "id": "rs1247923524", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1247923524" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 132, "end_pos": 132, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "1", "chr_pos": "58782677", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S132", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs536167705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536167705" }, { "id": "rs536167705", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs536167705" }, { "id": "rs536167705", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536167705" }, { "id": "rs536167705", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs536167705#frequency_tab" }, { "id": "rs536167705", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs536167705" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 140, "end_pos": 140, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGA->NGS).", "chr_id": "1", "chr_pos": "58782653", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "A140", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs536167705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536167705" }, { "id": "rs536167705", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs536167705" }, { "id": "rs536167705", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536167705" }, { "id": "rs536167705", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs536167705#frequency_tab" }, { "id": "rs536167705", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs536167705" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 140, "end_pos": 140, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGA->NGT).", "chr_id": "1", "chr_pos": "58782653", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "A140", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1408442613", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1408442613" }, { "id": "rs1408442613", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1408442613" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 160, "end_pos": 160, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAS->NAS).", "chr_id": "1", "chr_pos": "58782592", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S160", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1569897293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569897293" }, { "id": "rs1569897293", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1569897293" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 177, "end_pos": 177, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFN->NFT).", "chr_id": "1", "chr_pos": "58782541", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N177", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1452725173", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1452725173" }, { "id": "rs1452725173", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1452725173#frequency_tab" }, { "id": "rs1452725173", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1452725173" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 37, "end_pos": 37, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SMT->NMT).", "chr_id": "1", "chr_pos": "58782961", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S37", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05412", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05412" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "1", "chr_pos": "58782853", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S73", "disease": [ { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1353787605", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1353787605" }, { "id": "rs1353787605", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1353787605#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 91, "end_pos": 91, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "1", "chr_pos": "58782799", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T91", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 243, "end_pos": 243, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation by DYRK2. Abolishes phosphorylation by GSK3B at Thr-239.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "R", "sequence_mut": "V", "comment": "Abolishes the synergistic activity with SMAD3 to activate TGF-beta-mediated transcription.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "10995748", "url": "https://glygen.org/publication/PubMed/10995748" } ] }, { "start_pos": 286, "end_pos": 286, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of PAK2-mediated phosphorylation; when associated with A-2; A-8; A-89; and A-93.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ] }, { "start_pos": 2, "end_pos": 2, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of PAK2-mediated phosphorylation; when associated with A-8; A-89; A-93; and A-286.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduced ATF7-mediated transcriptional activity; when associated with A-73. Abolishes interaction with FBXW7; when associated with A-73; A-91 and A-93.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" }, { "database": "PubMed", "id": "10376527", "url": "https://glygen.org/publication/PubMed/10376527" } ] }, { "start_pos": 6, "end_pos": 194, "sequence_org": "ETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAG", "sequence_mut": "", "comment": "Abolishes activation of FASLG/CD95L transcription.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "12618758", "url": "https://glygen.org/publication/PubMed/12618758" } ] }, { "start_pos": 73, "end_pos": 73, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduced ATF7-mediated transcriptional activity; when associated with A-63. Abolishes interaction with FBXW7; when associated with A-63; A-91 and A-93.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" }, { "database": "PubMed", "id": "10376527", "url": "https://glygen.org/publication/PubMed/10376527" } ] }, { "start_pos": 89, "end_pos": 89, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of PAK2-mediated phosphorylation; when associated with A-2; A-8; A-93; and A-286.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ] }, { "start_pos": 8, "end_pos": 8, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of PAK2-mediated phosphorylation; when associated with A-2; A-89; A-93; and A-286.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ] }, { "start_pos": 91, "end_pos": 91, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes interaction with FBXW7; when associated with A-63; A-73 and A-93.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" } ] }, { "start_pos": 93, "end_pos": 93, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes interaction with FBXW7; when associated with A-63; A-73 and A-91.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" } ] }, { "start_pos": 93, "end_pos": 93, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of PAK2-mediated phosphorylation; when associated with A-2; A-8; A-89; and A-286.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "94.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "93.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "98.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "95.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "94.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05412" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "common_name": "Human" } ], "gene": [ { "name": "JUN", "url": "https://www.uniprot.org/uniprot/P05412", "locus": { "chromosome": "1", "start_pos": 58776845, "end_pos": 58784048, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000177606", "url": "https://www.ensembl.org/id/ENSG00000177606" } ] } } ], "crossref": [ { "id": "ENSG00000177606", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000177606", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P05412", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05412", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd14696", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14696", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4977", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4977", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "JUN", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=JUN", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3725", "url": "https://www.ncbi.nlm.nih.gov/gene/3725", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6204", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6204", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P05412", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05412*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002112", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002112", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005643", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005643", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008917", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008917", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3725", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3725", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "165160", "url": "http://www.omim.org/entry/165160", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P05412", "url": "https://www.nextprot.org/entry/NX_P05412", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P05412", "url": "https://oglcnac.org/atlas/detail/P05412", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HHQHMPA", "url": "https://omabrowser.org/oma/group/HHQHMPA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4493275at2759", "url": "http://www.orthodb.org/?query=4493275at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11462", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11462", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11462:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11462:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A02", "url": "https://www.rcsb.org/structure/1A02", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FOS", "url": "https://www.rcsb.org/structure/1FOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JNM", "url": "https://www.rcsb.org/structure/1JNM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JUN", "url": "https://www.rcsb.org/structure/1JUN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1S9K", "url": "https://www.rcsb.org/structure/1S9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1T2K", "url": "https://www.rcsb.org/structure/1T2K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FV8", "url": "https://www.rcsb.org/structure/5FV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T01", "url": "https://www.rcsb.org/structure/5T01", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Y3V", "url": "https://www.rcsb.org/structure/6Y3V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00170", "url": "http://pfam.xfam.org/family/PF00170", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03957", "url": "http://pfam.xfam.org/family/PF03957", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P05412", "url": "https://pharos.nih.gov/targets/P05412", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P05412", "url": "http://purl.obolibrary.org/obo/PR_P05412", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0AA34QVR9", "url": "https://www.uniprot.org/uniprot/A0AA34QVR9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AA34QVR9-1", "url": "https://www.uniprot.org/uniprot/A0AA34QVR9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05412-1", "url": "https://www.uniprot.org/uniprot/P05412-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF", "length": 331, "header": "sp|P05412-1|JUN_HUMAN Isoform 1 of Transcription factor Jun OS=Homo sapiens OX=9606 GN=JUN PE=1 SV=2 CANONICAL=P05412-1" }, "isoforms": [ { "isoform_ac": "A0AA34QVR9-1", "url": "", "sequence": { "sequence": "MLRPRNLCAQPKLTSREVTDCSMTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF", "length": 353, "header": "tr|A0AA34QVR9-1|A0AA34QVR9_HUMAN Computationally mapped isoform of Jun proto-oncogene, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=JUN PE=4 SV=1 CANONICAL=P05412-1" }, "locus": {} }, { "isoform_ac": "P05412-1", "url": "", "sequence": { "sequence": "MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF", "length": 331, "header": "sp|P05412-1|JUN_HUMAN Isoform 1 of Transcription factor Jun OS=Homo sapiens OX=9606 GN=JUN PE=1 SV=2 CANONICAL=P05412-1" }, "locus": { "chromosome": "1", "start_pos": 58783070, "end_pos": 58782078, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371222.4", "url": "https://www.ensembl.org/id/ENST00000371222.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000360266.2", "url": "https://www.ensembl.org/id/ENSP00000360266.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 131, "start_aa": "Thr", "end_pos": 131, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr131", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" }, { "id": "30012597", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30012597" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 132, "start_aa": "Ser", "end_pos": 132, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser132", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" }, { "id": "30012597", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30012597" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 73, "start_aa": "Ser", "end_pos": 73, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser73", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "31394193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31394193" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "26825459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26825459" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 83, "start_aa": "Ser", "end_pos": 83, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser83", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "31394193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31394193" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "26825459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26825459" }, { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 84, "start_aa": "Ser", "end_pos": 84, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser84", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "31394193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31394193" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "26825459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26825459" }, { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" }, { "id": "30012597", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30012597" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Ser", "end_pos": 84, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser84", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 90, "start_aa": "Thr", "end_pos": 90, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr90", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "31394193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31394193" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "26825459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26825459" }, { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 91, "start_aa": "Thr", "end_pos": 91, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr91", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "31394193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31394193" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "26825459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26825459" }, { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 95, "start_aa": "Thr", "end_pos": 95, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr95", "evidence": [ { "id": "P05412", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "31394193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31394193" }, { "id": "15327282", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15327282" }, { "id": "26825459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26825459" }, { "id": "P05412", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05412" } ] } ], "phosphorylation": [ { "start_pos": 131, "end_pos": 131, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "11823425", "url": "https://glygen.org/publication/PubMed/11823425" } ], "site_lbl": "Thr131" }, { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "P00519-1", "kinase_gene_name": "ABL1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "10637231", "url": "https://glygen.org/publication/PubMed/10637231" } ], "site_lbl": "Tyr170" }, { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "P41240-1", "kinase_gene_name": "CSK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "16740711", "url": "https://glygen.org/publication/PubMed/16740711" }, { "database": "PubMed", "id": "19818398", "url": "https://glygen.org/publication/PubMed/19818398" } ], "site_lbl": "Tyr170" }, { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "10637231", "url": "https://glygen.org/publication/PubMed/10637231" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "14757045", "url": "https://glygen.org/publication/PubMed/14757045" } ], "site_lbl": "Tyr170" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" } ], "site_lbl": "Thr231" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "11075956", "url": "https://glygen.org/publication/PubMed/11075956" }, { "database": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" } ], "site_lbl": "Thr231" }, { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "P49840-1", "kinase_gene_name": "GSK3A", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" } ], "site_lbl": "Thr239" }, { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "16023596", "url": "https://glygen.org/publication/PubMed/16023596" } ], "site_lbl": "Thr239" }, { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by GSK3-beta", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" }, { "database": "PubMed", "id": "1956339", "url": "https://glygen.org/publication/PubMed/1956339" }, { "database": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" }, { "database": "PubMed", "id": "21647439", "url": "https://glygen.org/publication/PubMed/21647439" }, { "database": "PubMed", "id": "32054096", "url": "https://glygen.org/publication/PubMed/32054096" } ], "site_lbl": "Thr239" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1328860", "url": "https://glygen.org/publication/PubMed/1328860" } ], "site_lbl": "Ser243" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "P49840-1", "kinase_gene_name": "GSK3A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" } ], "site_lbl": "Ser243" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "16023596", "url": "https://glygen.org/publication/PubMed/16023596" } ], "site_lbl": "Ser243" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "Q92630-1", "kinase_gene_name": "DYRK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "20831597", "url": "https://glygen.org/publication/PubMed/20831597" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" } ], "site_lbl": "Ser243" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DYRK2 and GSK3-beta", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" }, { "database": "PubMed", "id": "1651323", "url": "https://glygen.org/publication/PubMed/1651323" }, { "database": "PubMed", "id": "1421569", "url": "https://glygen.org/publication/PubMed/1421569" }, { "database": "PubMed", "id": "16023596", "url": "https://glygen.org/publication/PubMed/16023596" }, { "database": "PubMed", "id": "17952113", "url": "https://glygen.org/publication/PubMed/17952113" }, { "database": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" }, { "database": "PubMed", "id": "21278055", "url": "https://glygen.org/publication/PubMed/21278055" }, { "database": "PubMed", "id": "26243309", "url": "https://glygen.org/publication/PubMed/26243309" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser243" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "P49840-1", "kinase_gene_name": "GSK3A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" } ], "site_lbl": "Ser249" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser249" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "P78527-1", "kinase_gene_name": "PRKDC", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "8464713", "url": "https://glygen.org/publication/PubMed/8464713" } ], "site_lbl": "Ser249" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by GSK3-beta", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" }, { "database": "PubMed", "id": "8464713", "url": "https://glygen.org/publication/PubMed/8464713" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" } ], "site_lbl": "Ser249" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "P41240-1", "kinase_gene_name": "CSK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "16740711", "url": "https://glygen.org/publication/PubMed/16740711" } ], "site_lbl": "Tyr26" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr286" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PAK2", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr286" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr2" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PAK2", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr2" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" } ], "site_lbl": "Ser58" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Thr62" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1328860", "url": "https://glygen.org/publication/PubMed/1328860" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "8137421", "url": "https://glygen.org/publication/PubMed/8137421" }, { "database": "PubMed", "id": "8224842", "url": "https://glygen.org/publication/PubMed/8224842" }, { "database": "PubMed", "id": "8654373", "url": "https://glygen.org/publication/PubMed/8654373" }, { "database": "PubMed", "id": "7737130", "url": "https://glygen.org/publication/PubMed/7737130" }, { "database": "PubMed", "id": "9687508", "url": "https://glygen.org/publication/PubMed/9687508" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "11948398", "url": "https://glygen.org/publication/PubMed/11948398" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "7737130", "url": "https://glygen.org/publication/PubMed/7737130" }, { "database": "PubMed", "id": "9687508", "url": "https://glygen.org/publication/PubMed/9687508" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "11948398", "url": "https://glygen.org/publication/PubMed/11948398" }, { "database": "PubMed", "id": "12040039", "url": "https://glygen.org/publication/PubMed/12040039" }, { "database": "PubMed", "id": "19118012", "url": "https://glygen.org/publication/PubMed/19118012" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "17670986", "url": "https://glygen.org/publication/PubMed/17670986" }, { "database": "PubMed", "id": "20395206", "url": "https://glygen.org/publication/PubMed/20395206" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "Q00526-1", "kinase_gene_name": "CDK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "19118012", "url": "https://glygen.org/publication/PubMed/19118012" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "Q15139-1", "kinase_gene_name": "PRKD1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "11948398", "url": "https://glygen.org/publication/PubMed/11948398" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "Q8TD08-1", "kinase_gene_name": "MAPK15", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "Q99986-1", "kinase_gene_name": "VRK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "15378002", "url": "https://glygen.org/publication/PubMed/15378002" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "Q9H4B4-1", "kinase_gene_name": "PLK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "17804415", "url": "https://glygen.org/publication/PubMed/17804415" }, { "database": "PubMed", "id": "18650425", "url": "https://glygen.org/publication/PubMed/18650425" }, { "database": "PubMed", "id": "21296815", "url": "https://glygen.org/publication/PubMed/21296815" } ], "site_lbl": "Ser63" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK8 and PLK3", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12881422", "url": "https://glygen.org/publication/PubMed/12881422" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "11896587", "url": "https://glygen.org/publication/PubMed/11896587" }, { "database": "PRO", "id": "P05412", "url": "http://purl.obolibrary.org/obo/P05412" }, { "database": "PubMed", "id": "10064599", "url": "https://glygen.org/publication/PubMed/10064599" }, { "database": "PubMed", "id": "10393085", "url": "https://glygen.org/publication/PubMed/10393085" }, { "database": "PubMed", "id": "10509564", "url": "https://glygen.org/publication/PubMed/10509564" }, { "database": "PubMed", "id": "10556784", "url": "https://glygen.org/publication/PubMed/10556784" }, { "database": "PubMed", "id": "10581177", "url": "https://glygen.org/publication/PubMed/10581177" }, { "database": "PubMed", "id": "10617104", "url": "https://glygen.org/publication/PubMed/10617104" }, { "database": "PubMed", "id": "10667594", "url": "https://glygen.org/publication/PubMed/10667594" }, { "database": "PubMed", "id": "10754497", "url": "https://glygen.org/publication/PubMed/10754497" }, { "database": "PubMed", "id": "10788439", "url": "https://glygen.org/publication/PubMed/10788439" }, { "database": "PubMed", "id": "10974006", "url": "https://glygen.org/publication/PubMed/10974006" }, { "database": "PubMed", "id": "11046144", "url": "https://glygen.org/publication/PubMed/11046144" }, { "database": "PubMed", "id": "11076965", "url": "https://glygen.org/publication/PubMed/11076965" }, { "database": "PubMed", "id": "11278277", "url": "https://glygen.org/publication/PubMed/11278277" }, { "database": "PubMed", "id": "11352915", "url": "https://glygen.org/publication/PubMed/11352915" }, { "database": "PubMed", "id": "11401472", "url": "https://glygen.org/publication/PubMed/11401472" }, { "database": "PubMed", "id": "11432833", "url": "https://glygen.org/publication/PubMed/11432833" }, { "database": "PubMed", "id": "11737865", "url": "https://glygen.org/publication/PubMed/11737865" }, { "database": "PubMed", "id": "11739718", "url": "https://glygen.org/publication/PubMed/11739718" }, { "database": "PubMed", "id": "11948398", "url": "https://glygen.org/publication/PubMed/11948398" }, { "database": "PubMed", "id": "11961130", "url": "https://glygen.org/publication/PubMed/11961130" }, { "database": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" }, { "database": "PubMed", "id": "12221076", "url": "https://glygen.org/publication/PubMed/12221076" }, { "database": "PubMed", "id": "12441106", "url": "https://glygen.org/publication/PubMed/12441106" }, { "database": "PubMed", "id": "12646240", "url": "https://glygen.org/publication/PubMed/12646240" }, { "database": "PubMed", "id": "12853483", "url": "https://glygen.org/publication/PubMed/12853483" }, { "database": "PubMed", "id": "12947046", "url": "https://glygen.org/publication/PubMed/12947046" }, { "database": "PubMed", "id": "1324919", "url": "https://glygen.org/publication/PubMed/1324919" }, { "database": "PubMed", "id": "14508071", "url": "https://glygen.org/publication/PubMed/14508071" }, { "database": "PubMed", "id": "14617628", "url": "https://glygen.org/publication/PubMed/14617628" }, { "database": "PubMed", "id": "14657232", "url": "https://glygen.org/publication/PubMed/14657232" }, { "database": "PubMed", "id": "15135887", "url": "https://glygen.org/publication/PubMed/15135887" }, { "database": "PubMed", "id": "15138488", "url": "https://glygen.org/publication/PubMed/15138488" }, { "database": "PubMed", "id": "15226308", "url": "https://glygen.org/publication/PubMed/15226308" }, { "database": "PubMed", "id": "15240010", "url": "https://glygen.org/publication/PubMed/15240010" }, { "database": "PubMed", "id": "15378002", "url": "https://glygen.org/publication/PubMed/15378002" }, { "database": "PubMed", "id": "15389828", "url": "https://glygen.org/publication/PubMed/15389828" }, { "database": "PubMed", "id": "15844359", "url": "https://glygen.org/publication/PubMed/15844359" }, { "database": "PubMed", "id": "15845392", "url": "https://glygen.org/publication/PubMed/15845392" }, { "database": "PubMed", "id": "15860507", "url": "https://glygen.org/publication/PubMed/15860507" }, { "database": "PubMed", "id": "15896775", "url": "https://glygen.org/publication/PubMed/15896775" }, { "database": "PubMed", "id": "1630458", "url": "https://glygen.org/publication/PubMed/1630458" }, { "database": "PubMed", "id": "16481106", "url": "https://glygen.org/publication/PubMed/16481106" }, { "database": "PubMed", "id": "16698017", "url": "https://glygen.org/publication/PubMed/16698017" }, { "database": "PubMed", "id": "16733206", "url": "https://glygen.org/publication/PubMed/16733206" }, { "database": "PubMed", "id": "16819515", "url": "https://glygen.org/publication/PubMed/16819515" }, { "database": "PubMed", "id": "16834785", "url": "https://glygen.org/publication/PubMed/16834785" }, { "database": "PubMed", "id": "16934508", "url": "https://glygen.org/publication/PubMed/16934508" }, { "database": "PubMed", "id": "16964287", "url": "https://glygen.org/publication/PubMed/16964287" }, { "database": "PubMed", "id": "17455299", "url": "https://glygen.org/publication/PubMed/17455299" }, { "database": "PubMed", "id": "17510314", "url": "https://glygen.org/publication/PubMed/17510314" }, { "database": "PubMed", "id": "17908424", "url": "https://glygen.org/publication/PubMed/17908424" }, { "database": "PubMed", "id": "18252863", "url": "https://glygen.org/publication/PubMed/18252863" }, { "database": "PubMed", "id": "18419764", "url": "https://glygen.org/publication/PubMed/18419764" }, { "database": "PubMed", "id": "18650425", "url": "https://glygen.org/publication/PubMed/18650425" }, { "database": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" }, { "database": "PubMed", "id": "18844221", "url": "https://glygen.org/publication/PubMed/18844221" }, { "database": "PubMed", "id": "19604147", "url": "https://glygen.org/publication/PubMed/19604147" }, { "database": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" }, { "database": "PubMed", "id": "19860880", "url": "https://glygen.org/publication/PubMed/19860880" }, { "database": "PubMed", "id": "20082306", "url": "https://glygen.org/publication/PubMed/20082306" }, { "database": "PubMed", "id": "20482821", "url": "https://glygen.org/publication/PubMed/20482821" }, { "database": "PubMed", "id": "20490773", "url": "https://glygen.org/publication/PubMed/20490773" }, { "database": "PubMed", "id": "21296766", "url": "https://glygen.org/publication/PubMed/21296766" }, { "database": "PubMed", "id": "21296815", "url": "https://glygen.org/publication/PubMed/21296815" }, { "database": "PubMed", "id": "21364631", "url": "https://glygen.org/publication/PubMed/21364631" }, { "database": "PubMed", "id": "22067274", "url": "https://glygen.org/publication/PubMed/22067274" }, { "database": "PubMed", "id": "22266871", "url": "https://glygen.org/publication/PubMed/22266871" }, { "database": "PubMed", "id": "22360706", "url": "https://glygen.org/publication/PubMed/22360706" }, { "database": "PubMed", "id": "22406864", "url": "https://glygen.org/publication/PubMed/22406864" }, { "database": "PubMed", "id": "22561846", "url": "https://glygen.org/publication/PubMed/22561846" }, { "database": "PubMed", "id": "22860098", "url": "https://glygen.org/publication/PubMed/22860098" }, { "database": "PubMed", "id": "23645983", "url": "https://glygen.org/publication/PubMed/23645983" }, { "database": "PubMed", "id": "23665993", "url": "https://glygen.org/publication/PubMed/23665993" }, { "database": "PubMed", "id": "23752190", "url": "https://glygen.org/publication/PubMed/23752190" }, { "database": "PubMed", "id": "23792175", "url": "https://glygen.org/publication/PubMed/23792175" }, { "database": "PubMed", "id": "23942796", "url": "https://glygen.org/publication/PubMed/23942796" }, { "database": "PubMed", "id": "24038215", "url": "https://glygen.org/publication/PubMed/24038215" }, { "database": "PubMed", "id": "24113186", "url": "https://glygen.org/publication/PubMed/24113186" }, { "database": "PubMed", "id": "24118792", "url": "https://glygen.org/publication/PubMed/24118792" }, { "database": "PubMed", "id": "24291398", "url": "https://glygen.org/publication/PubMed/24291398" }, { "database": "PubMed", "id": "24512202", "url": "https://glygen.org/publication/PubMed/24512202" }, { "database": "PubMed", "id": "24606718", "url": "https://glygen.org/publication/PubMed/24606718" }, { "database": "PubMed", "id": "24618420", "url": "https://glygen.org/publication/PubMed/24618420" }, { "database": "PubMed", "id": "24631457", "url": "https://glygen.org/publication/PubMed/24631457" }, { "database": "PubMed", "id": "24797581", "url": "https://glygen.org/publication/PubMed/24797581" }, { "database": "PubMed", "id": "24838122", "url": "https://glygen.org/publication/PubMed/24838122" }, { "database": "PubMed", "id": "25121353", "url": "https://glygen.org/publication/PubMed/25121353" }, { "database": "PubMed", "id": "25121739", "url": "https://glygen.org/publication/PubMed/25121739" }, { "database": "PubMed", "id": "25402510", "url": "https://glygen.org/publication/PubMed/25402510" }, { "database": "PubMed", "id": "25422452", "url": "https://glygen.org/publication/PubMed/25422452" }, { "database": "PubMed", "id": "25483191", "url": "https://glygen.org/publication/PubMed/25483191" }, { "database": "PubMed", "id": "25814555", "url": "https://glygen.org/publication/PubMed/25814555" }, { "database": "PubMed", "id": "25823818", "url": "https://glygen.org/publication/PubMed/25823818" }, { "database": "PubMed", "id": "26018080", "url": "https://glygen.org/publication/PubMed/26018080" }, { "database": "PubMed", "id": "26035356", "url": "https://glygen.org/publication/PubMed/26035356" }, { "database": "PubMed", "id": "26098773", "url": "https://glygen.org/publication/PubMed/26098773" }, { "database": "PubMed", "id": "26289944", "url": "https://glygen.org/publication/PubMed/26289944" }, { "database": "PubMed", "id": "26745678", "url": "https://glygen.org/publication/PubMed/26745678" }, { "database": "PubMed", "id": "26755651", "url": "https://glygen.org/publication/PubMed/26755651" }, { "database": "PubMed", "id": "27324700", "url": "https://glygen.org/publication/PubMed/27324700" }, { "database": "PubMed", "id": "27486656", "url": "https://glygen.org/publication/PubMed/27486656" }, { "database": "PubMed", "id": "27556506", "url": "https://glygen.org/publication/PubMed/27556506" }, { "database": "PubMed", "id": "27869123", "url": "https://glygen.org/publication/PubMed/27869123" }, { "database": "PubMed", "id": "28057023", "url": "https://glygen.org/publication/PubMed/28057023" }, { "database": "PubMed", "id": "28470144", "url": "https://glygen.org/publication/PubMed/28470144" }, { "database": "PubMed", "id": "28539628", "url": "https://glygen.org/publication/PubMed/28539628" }, { "database": "PubMed", "id": "28542209", "url": "https://glygen.org/publication/PubMed/28542209" }, { "database": "PubMed", "id": "28811522", "url": "https://glygen.org/publication/PubMed/28811522" }, { "database": "PubMed", "id": "29029460", "url": "https://glygen.org/publication/PubMed/29029460" }, { "database": "PubMed", "id": "29078276", "url": "https://glygen.org/publication/PubMed/29078276" }, { "database": "PubMed", "id": "29285221", "url": "https://glygen.org/publication/PubMed/29285221" }, { "database": "PubMed", "id": "30531837", "url": "https://glygen.org/publication/PubMed/30531837" }, { "database": "PubMed", "id": "30887599", "url": "https://glygen.org/publication/PubMed/30887599" }, { "database": "PubMed", "id": "30922965", "url": "https://glygen.org/publication/PubMed/30922965" }, { "database": "PubMed", "id": "31766464", "url": "https://glygen.org/publication/PubMed/31766464" }, { "database": "PubMed", "id": "31942184", "url": "https://glygen.org/publication/PubMed/31942184" }, { "database": "PubMed", "id": "31956895", "url": "https://glygen.org/publication/PubMed/31956895" }, { "database": "PubMed", "id": "31964911", "url": "https://glygen.org/publication/PubMed/31964911" }, { "database": "PubMed", "id": "32266931", "url": "https://glygen.org/publication/PubMed/32266931" }, { "database": "PubMed", "id": "32369499", "url": "https://glygen.org/publication/PubMed/32369499" }, { "database": "PubMed", "id": "32690100", "url": "https://glygen.org/publication/PubMed/32690100" }, { "database": "PubMed", "id": "32982289", "url": "https://glygen.org/publication/PubMed/32982289" }, { "database": "PubMed", "id": "33117682", "url": "https://glygen.org/publication/PubMed/33117682" }, { "database": "PubMed", "id": "33928088", "url": "https://glygen.org/publication/PubMed/33928088" }, { "database": "PubMed", "id": "34408980", "url": "" }, { "database": "PubMed", "id": "36253406", "url": "" }, { "database": "PubMed", "id": "7898927", "url": "https://glygen.org/publication/PubMed/7898927" }, { "database": "PubMed", "id": "7935387", "url": "https://glygen.org/publication/PubMed/7935387" }, { "database": "PubMed", "id": "8016110", "url": "https://glygen.org/publication/PubMed/8016110" }, { "database": "PubMed", "id": "8036019", "url": "https://glygen.org/publication/PubMed/8036019" }, { "database": "PubMed", "id": "8072547", "url": "https://glygen.org/publication/PubMed/8072547" }, { "database": "PubMed", "id": "8224842", "url": "https://glygen.org/publication/PubMed/8224842" }, { "database": "PubMed", "id": "8355696", "url": "https://glygen.org/publication/PubMed/8355696" }, { "database": "PubMed", "id": "8426747", "url": "https://glygen.org/publication/PubMed/8426747" }, { "database": "PubMed", "id": "9162025", "url": "https://glygen.org/publication/PubMed/9162025" }, { "database": "PubMed", "id": "9293774", "url": "https://glygen.org/publication/PubMed/9293774" }, { "database": "PubMed", "id": "9348296", "url": "https://glygen.org/publication/PubMed/9348296" }, { "database": "PubMed", "id": "9365242", "url": "https://glygen.org/publication/PubMed/9365242" }, { "database": "PubMed", "id": "9407028", "url": "https://glygen.org/publication/PubMed/9407028" }, { "database": "PubMed", "id": "9407138", "url": "https://glygen.org/publication/PubMed/9407138" }, { "database": "PubMed", "id": "9425017", "url": "https://glygen.org/publication/PubMed/9425017" }, { "database": "PubMed", "id": "9464996", "url": "https://glygen.org/publication/PubMed/9464996" }, { "database": "PubMed", "id": "9682022", "url": "https://glygen.org/publication/PubMed/9682022" }, { "database": "PubMed", "id": "9742208", "url": "https://glygen.org/publication/PubMed/9742208" }, { "database": "PubMed", "id": "9784400", "url": "https://glygen.org/publication/PubMed/9784400" }, { "database": "PubMed", "id": "9820149", "url": "https://glygen.org/publication/PubMed/9820149" }, { "database": "PubMed", "id": "9878062", "url": "https://glygen.org/publication/PubMed/9878062" }, { "database": "PubMed", "id": "9988737", "url": "https://glygen.org/publication/PubMed/9988737" }, { "database": "PubMed", "id": "17804415", "url": "https://glygen.org/publication/PubMed/17804415" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" } ], "site_lbl": "Ser63" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "1328860", "url": "https://glygen.org/publication/PubMed/1328860" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12740383", "url": "https://glygen.org/publication/PubMed/12740383" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "7737130", "url": "https://glygen.org/publication/PubMed/7737130" }, { "database": "PubMed", "id": "9687508", "url": "https://glygen.org/publication/PubMed/9687508" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "8137421", "url": "https://glygen.org/publication/PubMed/8137421" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "7737130", "url": "https://glygen.org/publication/PubMed/7737130" }, { "database": "PubMed", "id": "9687508", "url": "https://glygen.org/publication/PubMed/9687508" }, { "database": "PubMed", "id": "12040039", "url": "https://glygen.org/publication/PubMed/12040039" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "20395206", "url": "https://glygen.org/publication/PubMed/20395206" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q00526-1", "kinase_gene_name": "CDK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "19118012", "url": "https://glygen.org/publication/PubMed/19118012" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q8TD08-1", "kinase_gene_name": "MAPK15", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q99986-1", "kinase_gene_name": "VRK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "15378002", "url": "https://glygen.org/publication/PubMed/15378002" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q9H4B4-1", "kinase_gene_name": "PLK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "17804415", "url": "https://glygen.org/publication/PubMed/17804415" }, { "database": "PubMed", "id": "18650425", "url": "https://glygen.org/publication/PubMed/18650425" }, { "database": "PubMed", "id": "21296815", "url": "https://glygen.org/publication/PubMed/21296815" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK8 and PLK3", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "12740383", "url": "https://glygen.org/publication/PubMed/12740383" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "12881422", "url": "https://glygen.org/publication/PubMed/12881422" }, { "database": "PubMed", "id": "21559334", "url": "https://glygen.org/publication/PubMed/21559334" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "11971971", "url": "https://glygen.org/publication/PubMed/11971971" }, { "database": "PubMed", "id": "12531896", "url": "https://glygen.org/publication/PubMed/12531896" }, { "database": "PRO", "id": "P05412", "url": "http://purl.obolibrary.org/obo/P05412" }, { "database": "PubMed", "id": "10064599", "url": "https://glygen.org/publication/PubMed/10064599" }, { "database": "PubMed", "id": "10393085", "url": "https://glygen.org/publication/PubMed/10393085" }, { "database": "PubMed", "id": "10523630", "url": "https://glygen.org/publication/PubMed/10523630" }, { "database": "PubMed", "id": "10581177", "url": "https://glygen.org/publication/PubMed/10581177" }, { "database": "PubMed", "id": "10617104", "url": "https://glygen.org/publication/PubMed/10617104" }, { "database": "PubMed", "id": "10667594", "url": "https://glygen.org/publication/PubMed/10667594" }, { "database": "PubMed", "id": "10788439", "url": "https://glygen.org/publication/PubMed/10788439" }, { "database": "PubMed", "id": "11046144", "url": "https://glygen.org/publication/PubMed/11046144" }, { "database": "PubMed", "id": "11076965", "url": "https://glygen.org/publication/PubMed/11076965" }, { "database": "PubMed", "id": "11180173", "url": "https://glygen.org/publication/PubMed/11180173" }, { "database": "PubMed", "id": "11278277", "url": "https://glygen.org/publication/PubMed/11278277" }, { "database": "PubMed", "id": "11352915", "url": "https://glygen.org/publication/PubMed/11352915" }, { "database": "PubMed", "id": "11401472", "url": "https://glygen.org/publication/PubMed/11401472" }, { "database": "PubMed", "id": "11432833", "url": "https://glygen.org/publication/PubMed/11432833" }, { "database": "PubMed", "id": "11961130", "url": "https://glygen.org/publication/PubMed/11961130" }, { "database": "PubMed", "id": "12021409", "url": "https://glygen.org/publication/PubMed/12021409" }, { "database": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" }, { "database": "PubMed", "id": "12441106", "url": "https://glygen.org/publication/PubMed/12441106" }, { "database": "PubMed", "id": "12853483", "url": "https://glygen.org/publication/PubMed/12853483" }, { "database": "PubMed", "id": "1324919", "url": "https://glygen.org/publication/PubMed/1324919" }, { "database": "PubMed", "id": "14617628", "url": "https://glygen.org/publication/PubMed/14617628" }, { "database": "PubMed", "id": "14657232", "url": "https://glygen.org/publication/PubMed/14657232" }, { "database": "PubMed", "id": "14690535", "url": "https://glygen.org/publication/PubMed/14690535" }, { "database": "PubMed", "id": "15135887", "url": "https://glygen.org/publication/PubMed/15135887" }, { "database": "PubMed", "id": "15240010", "url": "https://glygen.org/publication/PubMed/15240010" }, { "database": "PubMed", "id": "15378002", "url": "https://glygen.org/publication/PubMed/15378002" }, { "database": "PubMed", "id": "15844359", "url": "https://glygen.org/publication/PubMed/15844359" }, { "database": "PubMed", "id": "15860507", "url": "https://glygen.org/publication/PubMed/15860507" }, { "database": "PubMed", "id": "15896775", "url": "https://glygen.org/publication/PubMed/15896775" }, { "database": "PubMed", "id": "1630458", "url": "https://glygen.org/publication/PubMed/1630458" }, { "database": "PubMed", "id": "16733206", "url": "https://glygen.org/publication/PubMed/16733206" }, { "database": "PubMed", "id": "16819515", "url": "https://glygen.org/publication/PubMed/16819515" }, { "database": "PubMed", "id": "16834785", "url": "https://glygen.org/publication/PubMed/16834785" }, { "database": "PubMed", "id": "17325487", "url": "https://glygen.org/publication/PubMed/17325487" }, { "database": "PubMed", "id": "17455299", "url": "https://glygen.org/publication/PubMed/17455299" }, { "database": "PubMed", "id": "17510314", "url": "https://glygen.org/publication/PubMed/17510314" }, { "database": "PubMed", "id": "17908424", "url": "https://glygen.org/publication/PubMed/17908424" }, { "database": "PubMed", "id": "18252863", "url": "https://glygen.org/publication/PubMed/18252863" }, { "database": "PubMed", "id": "18650425", "url": "https://glygen.org/publication/PubMed/18650425" }, { "database": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" }, { "database": "PubMed", "id": "18805449", "url": "https://glygen.org/publication/PubMed/18805449" }, { "database": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" }, { "database": "PubMed", "id": "19860880", "url": "https://glygen.org/publication/PubMed/19860880" }, { "database": "PubMed", "id": "19937805", "url": "https://glygen.org/publication/PubMed/19937805" }, { "database": "PubMed", "id": "21296766", "url": "https://glygen.org/publication/PubMed/21296766" }, { "database": "PubMed", "id": "21296815", "url": "https://glygen.org/publication/PubMed/21296815" }, { "database": "PubMed", "id": "21364631", "url": "https://glygen.org/publication/PubMed/21364631" }, { "database": "PubMed", "id": "21808000", "url": "https://glygen.org/publication/PubMed/21808000" }, { "database": "PubMed", "id": "21860415", "url": "https://glygen.org/publication/PubMed/21860415" }, { "database": "PubMed", "id": "22266871", "url": "https://glygen.org/publication/PubMed/22266871" }, { "database": "PubMed", "id": "22406864", "url": "https://glygen.org/publication/PubMed/22406864" }, { "database": "PubMed", "id": "22860098", "url": "https://glygen.org/publication/PubMed/22860098" }, { "database": "PubMed", "id": "23562655", "url": "https://glygen.org/publication/PubMed/23562655" }, { "database": "PubMed", "id": "24118792", "url": "https://glygen.org/publication/PubMed/24118792" }, { "database": "PubMed", "id": "24291398", "url": "https://glygen.org/publication/PubMed/24291398" }, { "database": "PubMed", "id": "24512202", "url": "https://glygen.org/publication/PubMed/24512202" }, { "database": "PubMed", "id": "24797581", "url": "https://glygen.org/publication/PubMed/24797581" }, { "database": "PubMed", "id": "24838122", "url": "https://glygen.org/publication/PubMed/24838122" }, { "database": "PubMed", "id": "24938188", "url": "https://glygen.org/publication/PubMed/24938188" }, { "database": "PubMed", "id": "25121353", "url": "https://glygen.org/publication/PubMed/25121353" }, { "database": "PubMed", "id": "25260534", "url": "https://glygen.org/publication/PubMed/25260534" }, { "database": "PubMed", "id": "25402510", "url": "https://glygen.org/publication/PubMed/25402510" }, { "database": "PubMed", "id": "25422452", "url": "https://glygen.org/publication/PubMed/25422452" }, { "database": "PubMed", "id": "25714020", "url": "https://glygen.org/publication/PubMed/25714020" }, { "database": "PubMed", "id": "25797258", "url": "https://glygen.org/publication/PubMed/25797258" }, { "database": "PubMed", "id": "25814555", "url": "https://glygen.org/publication/PubMed/25814555" }, { "database": "PubMed", "id": "26035356", "url": "https://glygen.org/publication/PubMed/26035356" }, { "database": "PubMed", "id": "26078032", "url": "https://glygen.org/publication/PubMed/26078032" }, { "database": "PubMed", "id": "26289944", "url": "https://glygen.org/publication/PubMed/26289944" }, { "database": "PubMed", "id": "26745678", "url": "https://glygen.org/publication/PubMed/26745678" }, { "database": "PubMed", "id": "26755651", "url": "https://glygen.org/publication/PubMed/26755651" }, { "database": "PubMed", "id": "27089238", "url": "https://glygen.org/publication/PubMed/27089238" }, { "database": "PubMed", "id": "27324700", "url": "https://glygen.org/publication/PubMed/27324700" }, { "database": "PubMed", "id": "27590675", "url": "https://glygen.org/publication/PubMed/27590675" }, { "database": "PubMed", "id": "27708396", "url": "https://glygen.org/publication/PubMed/27708396" }, { "database": "PubMed", "id": "27869123", "url": "https://glygen.org/publication/PubMed/27869123" }, { "database": "PubMed", "id": "28057023", "url": "https://glygen.org/publication/PubMed/28057023" }, { "database": "PubMed", "id": "28169350", "url": "https://glygen.org/publication/PubMed/28169350" }, { "database": "PubMed", "id": "28184937", "url": "https://glygen.org/publication/PubMed/28184937" }, { "database": "PubMed", "id": "28539628", "url": "https://glygen.org/publication/PubMed/28539628" }, { "database": "PubMed", "id": "28542209", "url": "https://glygen.org/publication/PubMed/28542209" }, { "database": "PubMed", "id": "29029460", "url": "https://glygen.org/publication/PubMed/29029460" }, { "database": "PubMed", "id": "29078276", "url": "https://glygen.org/publication/PubMed/29078276" }, { "database": "PubMed", "id": "29888211", "url": "https://glygen.org/publication/PubMed/29888211" }, { "database": "PubMed", "id": "30195772", "url": "https://glygen.org/publication/PubMed/30195772" }, { "database": "PubMed", "id": "30887599", "url": "https://glygen.org/publication/PubMed/30887599" }, { "database": "PubMed", "id": "31766464", "url": "https://glygen.org/publication/PubMed/31766464" }, { "database": "PubMed", "id": "31772330", "url": "https://glygen.org/publication/PubMed/31772330" }, { "database": "PubMed", "id": "31878941", "url": "https://glygen.org/publication/PubMed/31878941" }, { "database": "PubMed", "id": "31918717", "url": "https://glygen.org/publication/PubMed/31918717" }, { "database": "PubMed", "id": "31942184", "url": "https://glygen.org/publication/PubMed/31942184" }, { "database": "PubMed", "id": "31956895", "url": "https://glygen.org/publication/PubMed/31956895" }, { "database": "PubMed", "id": "32054096", "url": "https://glygen.org/publication/PubMed/32054096" }, { "database": "PubMed", "id": "32982289", "url": "https://glygen.org/publication/PubMed/32982289" }, { "database": "PubMed", "id": "33117682", "url": "https://glygen.org/publication/PubMed/33117682" }, { "database": "PubMed", "id": "33926470", "url": "https://glygen.org/publication/PubMed/33926470" }, { "database": "PubMed", "id": "33928088", "url": "https://glygen.org/publication/PubMed/33928088" }, { "database": "PubMed", "id": "36253406", "url": "" }, { "database": "PubMed", "id": "7813438", "url": "https://glygen.org/publication/PubMed/7813438" }, { "database": "PubMed", "id": "7898927", "url": "https://glygen.org/publication/PubMed/7898927" }, { "database": "PubMed", "id": "7935387", "url": "https://glygen.org/publication/PubMed/7935387" }, { "database": "PubMed", "id": "8016110", "url": "https://glygen.org/publication/PubMed/8016110" }, { "database": "PubMed", "id": "8036019", "url": "https://glygen.org/publication/PubMed/8036019" }, { "database": "PubMed", "id": "8072547", "url": "https://glygen.org/publication/PubMed/8072547" }, { "database": "PubMed", "id": "8224842", "url": "https://glygen.org/publication/PubMed/8224842" }, { "database": "PubMed", "id": "8355696", "url": "https://glygen.org/publication/PubMed/8355696" }, { "database": "PubMed", "id": "8426747", "url": "https://glygen.org/publication/PubMed/8426747" }, { "database": "PubMed", "id": "8875991", "url": "https://glygen.org/publication/PubMed/8875991" }, { "database": "PubMed", "id": "9162025", "url": "https://glygen.org/publication/PubMed/9162025" }, { "database": "PubMed", "id": "9174618", "url": "https://glygen.org/publication/PubMed/9174618" }, { "database": "PubMed", "id": "9293774", "url": "https://glygen.org/publication/PubMed/9293774" }, { "database": "PubMed", "id": "9365242", "url": "https://glygen.org/publication/PubMed/9365242" }, { "database": "PubMed", "id": "9407028", "url": "https://glygen.org/publication/PubMed/9407028" }, { "database": "PubMed", "id": "9407138", "url": "https://glygen.org/publication/PubMed/9407138" }, { "database": "PubMed", "id": "9425017", "url": "https://glygen.org/publication/PubMed/9425017" }, { "database": "PubMed", "id": "9464996", "url": "https://glygen.org/publication/PubMed/9464996" }, { "database": "PubMed", "id": "9488446", "url": "https://glygen.org/publication/PubMed/9488446" }, { "database": "PubMed", "id": "9651196", "url": "https://glygen.org/publication/PubMed/9651196" }, { "database": "PubMed", "id": "9742208", "url": "https://glygen.org/publication/PubMed/9742208" }, { "database": "PubMed", "id": "9784400", "url": "https://glygen.org/publication/PubMed/9784400" }, { "database": "PubMed", "id": "9878062", "url": "https://glygen.org/publication/PubMed/9878062" }, { "database": "PubMed", "id": "9988737", "url": "https://glygen.org/publication/PubMed/9988737" }, { "database": "PubMed", "id": "17804415", "url": "https://glygen.org/publication/PubMed/17804415" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" } ], "site_lbl": "Ser73" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr89" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PAK2", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr89" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr8" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PAK2", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr8" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "12853483", "url": "https://glygen.org/publication/PubMed/12853483" }, { "database": "PubMed", "id": "17920329", "url": "https://glygen.org/publication/PubMed/17920329" }, { "database": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" }, { "database": "PubMed", "id": "22266871", "url": "https://glygen.org/publication/PubMed/22266871" }, { "database": "PubMed", "id": "24113186", "url": "https://glygen.org/publication/PubMed/24113186" }, { "database": "PubMed", "id": "36253406", "url": "" } ], "site_lbl": "Thr91" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ], "site_lbl": "Thr93" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PAK2", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "phospho.ELM", "id": "P05412", "url": "http://phospho.elm.eu.org/byAccession/P05412.html" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "12853483", "url": "https://glygen.org/publication/PubMed/12853483" }, { "database": "PubMed", "id": "17920329", "url": "https://glygen.org/publication/PubMed/17920329" }, { "database": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" }, { "database": "PubMed", "id": "22266871", "url": "https://glygen.org/publication/PubMed/22266871" }, { "database": "PubMed", "id": "24113186", "url": "https://glygen.org/publication/PubMed/24113186" }, { "database": "PubMed", "id": "36253406", "url": "" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" } ], "site_lbl": "Thr93" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" }, { "database": "PubMed", "id": "17920329", "url": "https://glygen.org/publication/PubMed/17920329" }, { "database": "PubMed", "id": "24113186", "url": "https://glygen.org/publication/PubMed/24113186" } ], "site_lbl": "Thr95" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gross BS, Lee JR, Clements JL, Turner M, Tybulewicz VL, Findell PR, Koretzky GA, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10026222", "url": "https://glygen.org/publication/PubMed/10026222" } ] }, { "title": "c-Jun functions as a calcium-regulated transcriptional activator in the absence of JNK/SAPK1 activation.", "journal": "The EMBO journal", "date": "1999", "authors": "Cruzalegui FH, Hardingham GE, Bading H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10064599", "url": "https://glygen.org/publication/PubMed/10064599" } ] }, { "title": "SPI-B activates transcription via a unique proline, serine, and threonine domain and exhibits DNA binding affinity differences from PU.1.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Rao S, Matsumura A, Yoon J, Simon MC", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "10196196", "url": "https://glygen.org/publication/PubMed/10196196" } ] }, { "title": "A new fusion gene TPM3-ALK in anaplastic large cell lymphoma created by a (1;2)(q25;p23) translocation.", "journal": "Blood", "date": "1999", "authors": "Lamant L, Dastugue N, Pulford K, Delsol G, Mariame B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10216106", "url": "https://glygen.org/publication/PubMed/10216106" } ] }, { "title": "Oligomerization is required for p53 to be efficiently ubiquitinated by MDM2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10347217", "url": "https://glygen.org/publication/PubMed/10347217" } ] }, { "title": "Role of the ATFa/JNK2 complex in Jun activation.", "journal": "Oncogene", "date": "1999", "authors": "De Graeve F, Bahr A, Sabapathy KT, Hauss C, Wagner EF, Kedinger C, Chatton B", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "10376527", "url": "https://glygen.org/publication/PubMed/10376527" } ] }, { "title": "Expression of I2PP2A, an inhibitor of protein phosphatase 2A, induces c-Jun and AP-1 activity.", "journal": "The Biochemical journal", "date": "1999", "authors": "Al-Murrani SW, Woodgett JR, Damuni Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10393085", "url": "https://glygen.org/publication/PubMed/10393085" } ] }, { "title": "Tyrosine phosphorylation of Vav stimulates IL-6 production in mast cells by a Rac/c-Jun N-terminal kinase-dependent pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Song JS, Haleem-Smith H, Arudchandran R, Gomez J, Scott PM, Mill JF, Tan TH, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10395673", "url": "https://glygen.org/publication/PubMed/10395673" } ] }, { "title": "Serotonin-inducible transcription of interleukin-1alpha in uterine smooth muscle cells requires an AP-1 site: cloning and partial characterization of the rat IL-1alpha promoter.", "journal": "Molecular and cellular endocrinology", "date": "1999", "authors": "Huang TT, Vinci JM, Lan L, Jeffrey JJ, Wilcox BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10432220", "url": "https://glygen.org/publication/PubMed/10432220" } ] }, { "title": "p21-activated protein kinase: a crucial component of morphological signaling?", "journal": "Trends in biochemical sciences", "date": "1999", "authors": "Daniels RH, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10470034", "url": "https://glygen.org/publication/PubMed/10470034" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Extracellular HIV-1 Tat protein differentially activates the JNK and ERK/MAPK pathways in CD4 T cells.", "journal": "AIDS (London, England)", "date": "1999", "authors": "Mischiati C, Pironi F, Milani D, Giacca M, Mirandola P, Capitani S, Zauli G", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10509564", "url": "https://glygen.org/publication/PubMed/10509564" } ] }, { "title": "Cell-extracellular matrix interactions stimulate the AP-1 transcription factor in an integrin-linked kinase- and glycogen synthase kinase 3-dependent manner.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Troussard AA, Tan C, Yoganathan TN, Dedhar S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10523630", "url": "https://glygen.org/publication/PubMed/10523630" } ] }, { "title": "Phosphorylation of Shc by Src family kinases is necessary for stem cell factor receptor/c-kit mediated activation of the Ras/MAP kinase pathway and c-fos induction.", "journal": "Oncogene", "date": "1999", "authors": "Lennartsson J, Blume-Jensen P, Hermanson M, Ponten E, Carlberg M, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10523831", "url": "https://glygen.org/publication/PubMed/10523831" } ] }, { "title": "Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.", "journal": "Nature", "date": "1999", "authors": "Lukas C, Sorensen CS, Kramer E, Santoni-Rugiu E, Lindeneg C, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10548110", "url": "https://glygen.org/publication/PubMed/10548110" } ] }, { "title": "TRK-fused gene (TFG) is a new partner of ALK in anaplastic large cell lymphoma producing two structurally different TFG-ALK translocations.", "journal": "Blood", "date": "1999", "authors": "Hernandez L, Pinyol M, Hernandez S, Bea S, Pulford K, Rosenwald A, Lamant L, Falini B, Ott G, Mason DY, Delsol G, Campo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10556217", "url": "https://glygen.org/publication/PubMed/10556217" } ] }, { "title": "C-Jun phosphorylation (Ser-63) in the testis of the lizard, Podarcis s. sicula.", "journal": "The Journal of endocrinology", "date": "1999", "authors": "Chieffi P, Picascia A, Stanzione R, Tramontano D", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10556784", "url": "https://glygen.org/publication/PubMed/10556784" } ] }, { "title": "Cyclic AMP inhibits the activity of c-Jun N-terminal kinase (JNKp46) but not JNKp55 and ERK2 in human helper T lymphocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Harada Y, Miyatake S, Arai K, Watanabe S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10581177", "url": "https://glygen.org/publication/PubMed/10581177" } ] }, { "title": "Conversion of p35 to p25 deregulates Cdk5 activity and promotes neurodegeneration.", "journal": "Nature", "date": "1999", "authors": "Patrick GN, Zukerberg L, Nikolic M, de la Monte S, Dikkes P, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10604467", "url": "https://glygen.org/publication/PubMed/10604467" } ] }, { "title": "Changes of the trans-activating potential of AP-1 transcription factor during cyclosporin A-induced apoptosis of glioma cells are mediated by phosphorylation and alterations of AP-1 composition.", "journal": "Journal of neurochemistry", "date": "2000", "authors": "Pyrzynska B, Mosieniak G, Kaminska B", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10617104", "url": "https://glygen.org/publication/PubMed/10617104" } ] }, { "title": "A nuclear tyrosine phosphorylation circuit: c-Jun as an activator and substrate of c-Abl and JNK.", "journal": "The EMBO journal", "date": "2000", "authors": "Barila D, Mangano R, Gonfloni S, Kretzschmar J, Moro M, Bohmann D, Superti-Furga G", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10637231", "url": "https://glygen.org/publication/PubMed/10637231" } ] }, { "title": "The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Strobl S, Fernandez-Catalan C, Braun M, Huber R, Masumoto H, Nakagawa K, Irie A, Sorimachi H, Bourenkow G, Bartunik H, Suzuki K, Bode W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10639123", "url": "https://glygen.org/publication/PubMed/10639123" } ] }, { "title": "A dominant role for the c-Jun NH2-terminal kinase in oncogenic ras-induced morphologic transformation of human lung carcinoma cells.", "journal": "Cancer research", "date": "2000", "authors": "Xiao L, Lang W", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10667594", "url": "https://glygen.org/publication/PubMed/10667594" } ] }, { "title": "Dishevelled phosphorylation, subcellular localization and multimerization regulate its role in early embryogenesis.", "journal": "The EMBO journal", "date": "2000", "authors": "Rothbacher U, Laurent MN, Deardorff MA, Klein PS, Cho KW, Fraser SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "10698942", "url": "https://glygen.org/publication/PubMed/10698942" } ] }, { "title": "ATIC-ALK: A novel variant ALK gene fusion in anaplastic large cell lymphoma resulting from the recurrent cryptic chromosomal inversion, inv(2)(p23q35).", "journal": "The American journal of pathology", "date": "2000", "authors": "Colleoni GW, Bridge JA, Garicochea B, Liu J, Filippa DA, Ladanyi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10702393", "url": "https://glygen.org/publication/PubMed/10702393" } ] }, { "title": "A new variant anaplastic lymphoma kinase (ALK)-fusion protein (ATIC-ALK) in a case of ALK-positive anaplastic large cell lymphoma.", "journal": "Cancer research", "date": "2000", "authors": "Trinei M, Lanfrancone L, Campo E, Pulford K, Mason DY, Pelicci PG, Falini B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10706082", "url": "https://glygen.org/publication/PubMed/10706082" } ] }, { "title": "Inv(2)(p23q35) in anaplastic large-cell lymphoma induces constitutive anaplastic lymphoma kinase (ALK) tyrosine kinase activation by fusion to ATIC, an enzyme involved in purine nucleotide biosynthesis.", "journal": "Blood", "date": "2000", "authors": "Ma Z, Cools J, Marynen P, Cui X, Siebert R, Gesk S, Schlegelberger B, Peeters B, De Wolf-Peeters C, Wlodarska I, Morris SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10706887", "url": "https://glygen.org/publication/PubMed/10706887" } ] }, { "title": "Mdm2 is a RING finger-dependent ubiquitin protein ligase for itself and p53.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Fang S, Jensen JP, Ludwig RL, Vousden KH, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10722742", "url": "https://glygen.org/publication/PubMed/10722742" } ] }, { "title": "Biological and clinical associations of c-jun activation in human breast cancer.", "journal": "International journal of cancer", "date": "2000", "authors": "Gee JM, Barroso AF, Ellis IO, Robertson JF, Nicholson RI", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10754497", "url": "https://glygen.org/publication/PubMed/10754497" } ] }, { "title": "Immunolocalization of human p14(ARF) to the granular component of the interphase nucleolus.", "journal": "Experimental cell research", "date": "2000", "authors": "Lindstrom MS, Klangby U, Inoue R, Pisa P, Wiman KG, Asker CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10772813", "url": "https://glygen.org/publication/PubMed/10772813" } ] }, { "title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "10777502", "url": "https://glygen.org/publication/PubMed/10777502" } ] }, { "title": "c-Jun and p53 activity is modulated by SUMO-1 modification.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Muller S, Berger M, Lehembre F, Seeler JS, Haupt Y, Dejean A", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10788439", "url": "https://glygen.org/publication/PubMed/10788439" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Neurotoxicity induces cleavage of p35 to p25 by calpain.", "journal": "Nature", "date": "2000", "authors": "Lee MS, Kwon YT, Li M, Peng J, Friedlander RM, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10830966", "url": "https://glygen.org/publication/PubMed/10830966" } ] }, { "title": "c-Jun inhibits transforming growth factor beta-mediated transcription by repressing Smad3 transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Dennler S, Prunier C, Ferrand N, Gauthier JM, Atfi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10871633", "url": "https://glygen.org/publication/PubMed/10871633" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "p38 MAPK signalling cascades: ancient roles and new functions.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2000", "authors": "Martin-Blanco E", "evidence": [ { "database": "Reactome", "id": "R-HSA-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341" } ], "reference": [ { "type": "PubMed", "id": "10878576", "url": "https://glygen.org/publication/PubMed/10878576" } ] }, { "title": "TPM3-ALK and TPM4-ALK oncogenes in inflammatory myofibroblastic tumors.", "journal": "The American journal of pathology", "date": "2000", "authors": "Lawrence B, Perez-Atayde A, Hibbard MK, Rubin BP, Dal Cin P, Pinkus JL, Pinkus GS, Xiao S, Yi ES, Fletcher CD, Fletcher JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10934142", "url": "https://glygen.org/publication/PubMed/10934142" } ] }, { "title": "Glucocorticoids antagonize AP-1 by inhibiting the Activation/phosphorylation of JNK without affecting its subcellular distribution.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Gonzalez MV, Jimenez B, Berciano MT, Gonzalez-Sancho JM, Caelles C, Lafarga M, Munoz A", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "10974006", "url": "https://glygen.org/publication/PubMed/10974006" } ] }, { "title": "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.", "journal": "Cell", "date": "2000", "authors": "Lei M, Lu W, Meng W, Parrini MC, Eck MJ, Mayer BJ, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10975528", "url": "https://glygen.org/publication/PubMed/10975528" } ] }, { "title": "p53 and c-Jun functionally synergize in the regulation of the DNA repair gene hMSH2 in response to UV.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Scherer SJ, Maier SM, Seifert M, Hanselmann RG, Zang KD, Muller-Hermelink HK, Angel P, Welter C, Schartl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "10984493", "url": "https://glygen.org/publication/PubMed/10984493" } ] }, { "title": "Structural and functional characterization of the transforming growth factor-beta -induced Smad3/c-Jun transcriptional cooperativity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Qing J, Zhang Y, Derynck R", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "10995748", "url": "https://glygen.org/publication/PubMed/10995748" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Ras-dependent regulation of c-Jun phosphorylation is mediated by the Ral guanine nucleotide exchange factor-Ral pathway.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "de Ruiter ND, Wolthuis RM, van Dam H, Burgering BM, Bos JL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11046144", "url": "https://glygen.org/publication/PubMed/11046144" } ] }, { "title": "Redox regulation of casein kinase II autophosphorylation and its effect on Jun-DNA binding.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2000", "authors": "Moussazadeh M, Greene JJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11075956", "url": "https://glygen.org/publication/PubMed/11075956" } ] }, { "title": "c-Jun activation-dependent tumorigenic transformation induced paradoxically by overexpression or block of S-adenosylmethionine decarboxylase.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Paasinen-Sohns A, Kielosto M, Kaariainen E, Eloranta T, Laine A, Janne OA, Birrer MJ, Holtta E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11076965", "url": "https://glygen.org/publication/PubMed/11076965" } ] }, { "title": "Structural basis of the recognition of the dishevelled DEP domain in the Wnt signaling pathway.", "journal": "Nature structural biology", "date": "2000", "authors": "Wong HC, Mao J, Nguyen JT, Srinivas S, Zhang W, Liu B, Li L, Wu D, Zheng J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "11101902", "url": "https://glygen.org/publication/PubMed/11101902" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase associated with anaplastic large-cell lymphoma activates the phosphatidylinositol 3-kinase/Akt antiapoptotic signaling pathway.", "journal": "Blood", "date": "2000", "authors": "Bai RY, Ouyang T, Miething C, Morris SW, Peschel C, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11110708", "url": "https://glygen.org/publication/PubMed/11110708" } ] }, { "title": "Interleukin-6-induced tethering of STAT3 to the LAP/C/EBPbeta promoter suggests a new mechanism of transcriptional regulation by STAT3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Niehof M, Streetz K, Rakemann T, Bischoff SC, Manns MP, Horn F, Trautwein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11114305", "url": "https://glygen.org/publication/PubMed/11114305" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "In situ demonstration of phosphorylated c-jun and p38 MAP kinase in epidermal keratinocytes following ultraviolet B irradiation of human skin.", "journal": "The Journal of pathology", "date": "2001", "authors": "Pfundt R, van Vlijmen-Willems I, Bergers M, Wingens M, Cloin W, Schalkwijk J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11180173", "url": "https://glygen.org/publication/PubMed/11180173" } ] }, { "title": "Role of ATM in oxidative stress-mediated c-Jun phosphorylation in response to ionizing radiation and CdCl2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Lee SA, Dritschilo A, Jung M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11278277", "url": "https://glygen.org/publication/PubMed/11278277" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Role of phosphatidylinositol 3-kinase-Akt pathway in nucleophosmin/anaplastic lymphoma kinase-mediated lymphomagenesis.", "journal": "Cancer research", "date": "2001", "authors": "Slupianek A, Nieborowska-Skorska M, Hoser G, Morrione A, Majewski M, Xue L, Morris SW, Wasik MA, Skorski T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11280786", "url": "https://glygen.org/publication/PubMed/11280786" } ] }, { "title": "Mitogen-activated protein kinase kinase 4 metastasis suppressor gene expression is inversely related to histological pattern in advancing human prostatic cancers.", "journal": "Cancer research", "date": "2001", "authors": "Kim HL, Vander Griend DJ, Yang X, Benson DA, Dubauskas Z, Yoshida BA, Chekmareva MA, Ichikawa Y, Sokoloff MH, Zhan P, Karrison T, Lin A, Stadler WM, Ichikawa T, Rubin MA, Rinker-Schaeffer CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11306453", "url": "https://glygen.org/publication/PubMed/11306453" } ] }, { "title": "Molecular characterization of a new ALK translocation involving moesin (MSN-ALK) in anaplastic large cell lymphoma.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2001", "authors": "Tort F, Pinyol M, Pulford K, Roncador G, Hernandez L, Nayach I, Kluin-Nelemans HC, Kluin P, Touriol C, Delsol G, Mason D, Campo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11310834", "url": "https://glygen.org/publication/PubMed/11310834" } ] }, { "title": "A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Sorensen CS, Lukas C, Kramer ER, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11340163", "url": "https://glygen.org/publication/PubMed/11340163" } ] }, { "title": "Vav1 regulates phospholipase cgamma activation and calcium responses in mast cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Manetz TS, Gonzalez-Espinosa C, Arudchandran R, Xirasagar S, Tybulewicz V, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11340169", "url": "https://glygen.org/publication/PubMed/11340169" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "Identification of a p53 response element in the promoter region of the hMSH2 gene required for expression in A2780 ovarian cancer cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Warnick CT, Dabbas B, Ford CD, Strait KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11350971", "url": "https://glygen.org/publication/PubMed/11350971" } ] }, { "title": "Protective role for c-Jun in the cellular response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Potapova O, Basu S, Mercola D, Holbrook NJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11352915", "url": "https://glygen.org/publication/PubMed/11352915" } ] }, { "title": "Unipolar membrane association of Dishevelled mediates Frizzled planar cell polarity signaling.", "journal": "Genes & development", "date": "2001", "authors": "Axelrod JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "11358862", "url": "https://glygen.org/publication/PubMed/11358862" } ] }, { "title": "Tumor suppressor and anti-inflammatory actions of PPARgamma agonists are mediated via upregulation of PTEN.", "journal": "Current biology : CB", "date": "2001", "authors": "Patel L, Pass I, Coxon P, Downes CP, Smith SA, Macphee CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11378386", "url": "https://glygen.org/publication/PubMed/11378386" } ] }, { "title": "Protein kinase D is sufficient to suppress EGF-induced c-Jun Ser 63 phosphorylation.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Hurd C, Rozengurt E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11401472", "url": "https://glygen.org/publication/PubMed/11401472" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Pin1 is overexpressed in breast cancer and cooperates with Ras signaling in increasing the transcriptional activity of c-Jun towards cyclin D1.", "journal": "The EMBO journal", "date": "2001", "authors": "Wulf GM, Ryo A, Wulf GG, Lee SW, Niu T, Petkova V, Lu KP", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11432833", "url": "https://glygen.org/publication/PubMed/11432833" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "A phosphatidylinositol 3-kinase/Akt pathway promotes translocation of Mdm2 from the cytoplasm to the nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Mayo LD, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11504915", "url": "https://glygen.org/publication/PubMed/11504915" } ] }, { "title": "Regulation of PTEN transcription by p53.", "journal": "Molecular cell", "date": "2001", "authors": "Stambolic V, MacPherson D, Sas D, Lin Y, Snow B, Jang Y, Benchimol S, Mak TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11545734", "url": "https://glygen.org/publication/PubMed/11545734" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Borg proteins control septin organization and are negatively regulated by Cdc42.", "journal": "Nature cell biology", "date": "2001", "authors": "Joberty G, Perlungher RR, Sheffield PJ, Kinoshita M, Noda M, Haystead T, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11584266", "url": "https://glygen.org/publication/PubMed/11584266" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "A specific lysine in c-Jun is required for transcriptional repression by E1A and is acetylated by p300.", "journal": "The EMBO journal", "date": "2001", "authors": "Vries RG, Prudenziati M, Zwartjes C, Verlaan M, Kalkhoven E, Zantema A", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "11689449", "url": "https://glygen.org/publication/PubMed/11689449" } ] }, { "title": "Peroxisome proliferator-activated receptor agonists prevent 25-OH-cholesterol induced c-jun activation and cell death.", "journal": "BMC pharmacology", "date": "2001", "authors": "Chang JY, Liu LZ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11737865", "url": "https://glygen.org/publication/PubMed/11737865" } ] }, { "title": "c-Jun and hypoxia-inducible factor 1 functionally cooperate in hypoxia-induced gene transcription.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Alfranca A, Gutierrez MD, Vara A, Aragones J, Vidal F, Landazuri MO", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11739718", "url": "https://glygen.org/publication/PubMed/11739718" } ] }, { "title": "JNK functions in the non-canonical Wnt pathway to regulate convergent extension movements in vertebrates.", "journal": "EMBO reports", "date": "2002", "authors": "Yamanaka H, Moriguchi T, Masuyama N, Kusakabe M, Hanafusa H, Takada R, Takada S, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "11751577", "url": "https://glygen.org/publication/PubMed/11751577" } ] }, { "title": "Multilevel dysregulation of STAT3 activation in anaplastic lymphoma kinase-positive T/null-cell lymphoma.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Zhang Q, Raghunath PN, Xue L, Majewski M, Carpentieri DF, Odum N, Morris S, Skorski T, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11751994", "url": "https://glygen.org/publication/PubMed/11751994" } ] }, { "title": "Wnt/Frizzled activation of Rho regulates vertebrate gastrulation and requires a novel Formin homology protein Daam1.", "journal": "Cell", "date": "2001", "authors": "Habas R, Kato Y, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "11779461", "url": "https://glygen.org/publication/PubMed/11779461" } ] }, { "title": "The Egr-1 transcription factor directly activates PTEN during irradiation-induced signalling.", "journal": "Nature cell biology", "date": "2001", "authors": "Virolle T, Adamson ED, Baron V, Birle D, Mercola D, Mustelin T, de Belle I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11781575", "url": "https://glygen.org/publication/PubMed/11781575" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Cyclin-dependent kinase 5 prevents neuronal apoptosis by negative regulation of c-Jun N-terminal kinase 3.", "journal": "The EMBO journal", "date": "2002", "authors": "Li BS, Zhang L, Takahashi S, Ma W, Jaffe H, Kulkarni AB, Pant HC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11823425", "url": "https://glygen.org/publication/PubMed/11823425" } ] }, { "title": "Anaplastic lymphoma kinase (ALK) activates Stat3 and protects hematopoietic cells from cell death.", "journal": "Oncogene", "date": "2002", "authors": "Zamo A, Chiarle R, Piva R, Howes J, Fan Y, Chilosi M, Levy DE, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11850821", "url": "https://glygen.org/publication/PubMed/11850821" } ] }, { "title": "A novel human small subunit of calpains.", "journal": "The Biochemical journal", "date": "2002", "authors": "Schad E, Farkas A, Jekely G, Tompa P, Friedrich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "11853546", "url": "https://glygen.org/publication/PubMed/11853546" } ] }, { "title": "Role of MAP kinases in UVB-induced phosphorylation of p53 at serine 20.", "journal": "Oncogene", "date": "2002", "authors": "She QB, Ma WY, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11896587", "url": "https://glygen.org/publication/PubMed/11896587" } ] }, { "title": "Diversity of genomic breakpoints in TFG-ALK translocations in anaplastic large cell lymphomas: identification of a new TFG-ALK(XL) chimeric gene with transforming activity.", "journal": "The American journal of pathology", "date": "2002", "authors": "Hernandez L, Bea S, Bellosillo B, Pinyol M, Falini B, Carbone A, Ott G, Rosenwald A, Fernandez A, Pulford K, Mason D, Morris SW, Santos E, Campo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11943732", "url": "https://glygen.org/publication/PubMed/11943732" } ] }, { "title": "Protein kinase D complexes with C-Jun N-terminal kinase via activation loop phosphorylation and phosphorylates the C-Jun N-terminus.", "journal": "Oncogene", "date": "2002", "authors": "Hurd C, Waldron RT, Rozengurt E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11948398", "url": "https://glygen.org/publication/PubMed/11948398" } ] }, { "title": "p53 regulates cell survival by inhibiting PIK3CA in squamous cell carcinomas.", "journal": "Genes & development", "date": "2002", "authors": "Singh B, Reddy PG, Goberdhan A, Walsh C, Dao S, Ngai I, Chou TC, O-Charoenrat P, Levine AJ, Rao PH, Stoffel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11959846", "url": "https://glygen.org/publication/PubMed/11959846" } ] }, { "title": "Methamphetamine causes coordinate regulation of Src, Cas, Crk, and the Jun N-terminal kinase-Jun pathway.", "journal": "Molecular pharmacology", "date": "2002", "authors": "Jayanthi S, McCoy MT, Ladenheim B, Cadet JL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11961130", "url": "https://glygen.org/publication/PubMed/11961130" } ] }, { "title": "p53 Binds and activates the xeroderma pigmentosum DDB2 gene in humans but not mice.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Tan T, Chu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11971958", "url": "https://glygen.org/publication/PubMed/11971958" } ] }, { "title": "Sequential activation of the MEK-extracellular signal-regulated kinase and MKK3/6-p38 mitogen-activated protein kinase pathways mediates oncogenic ras-induced premature senescence.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Wang W, Chen JX, Liao R, Deng Q, Zhou JJ, Huang S, Sun P", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "11971971", "url": "https://glygen.org/publication/PubMed/11971971" } ] }, { "title": "AP-1 as a regulator of cell life and death.", "journal": "Nature cell biology", "date": "2002", "authors": "Shaulian E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11988758", "url": "https://glygen.org/publication/PubMed/11988758" } ] }, { "title": "Cyclin K as a direct transcriptional target of the p53 tumor suppressor.", "journal": "Neoplasia (New York, N.Y.)", "date": "2002", "authors": "Mori T, Anazawa Y, Matsui K, Fukuda S, Nakamura Y, Arakawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11988847", "url": "https://glygen.org/publication/PubMed/11988847" } ] }, { "title": "Prickle mediates feedback amplification to generate asymmetric planar cell polarity signaling.", "journal": "Cell", "date": "2002", "authors": "Tree DR, Shulman JM, Rousset R, Scott MP, Gubb D, Axelrod JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "12015986", "url": "https://glygen.org/publication/PubMed/12015986" } ] }, { "title": "Selective down-regulation of c-jun gene expression by pentoxifylline and c-jun antisense interrupts platelet-derived growth factor signaling: pentoxifylline inhibits phosphorylation of c-Jun on serine 73.", "journal": "Molecular pharmacology", "date": "2002", "authors": "Peterson TC, Peterson MR, Robertson HA, During M, Dragunow M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12021409", "url": "https://glygen.org/publication/PubMed/12021409" } ] }, { "title": "c-Jun N-terminal protein kinase (JNK) 2/3 is specifically activated by stress, mediating c-Jun activation, in the presence of constitutive JNK1 activity in cerebellar neurons.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Coffey ET, Smiciene G, Hongisto V, Cao J, Brecht S, Herdegen T, Courtney MJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12040039", "url": "https://glygen.org/publication/PubMed/12040039" } ] }, { "title": "Correlation of transcriptional repression by p21(SNFT) with changes in DNA.NF-AT complex interactions.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Bower KE, Zeller RW, Wachsman W, Martinez T, McGuire KL", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "12087103", "url": "https://glygen.org/publication/PubMed/12087103" } ] }, { "title": "Mechanisms of p75-mediated death of hippocampal neurons. Role of caspases.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Troy CM, Friedman JE, Friedman WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "12097334", "url": "https://glygen.org/publication/PubMed/12097334" } ] }, { "title": "Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor.", "journal": "Genes, chromosomes & cancer", "date": "2002", "authors": "Cools J, Wlodarska I, Somers R, Mentens N, Pedeutour F, Maes B, De Wolf-Peeters C, Pauwels P, Hagemeijer A, Marynen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12112524", "url": "https://glygen.org/publication/PubMed/12112524" } ] }, { "title": "Molecular interpretation of ERK signal duration by immediate early gene products.", "journal": "Nature cell biology", "date": "2002", "authors": "Murphy LO, Smith S, Chen RH, Fingar DC, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ] }, { "title": "Up-regulation of c-jun mRNA in cardiac myocytes requires the extracellular signal-regulated kinase cascade, but c-Jun N-terminal kinases are required for efficient up-regulation of c-Jun protein.", "journal": "The Biochemical journal", "date": "2002", "authors": "Clerk A, Kemp TJ, Harrison JG, Mullen AJ, Barton PJ, Sugden PH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12169099", "url": "https://glygen.org/publication/PubMed/12169099" } ] }, { "title": "Activation of anaplastic lymphoma kinase is responsible for hyperphosphorylation of ShcC in neuroblastoma cell lines.", "journal": "Oncogene", "date": "2002", "authors": "Miyake I, Hakomori Y, Shinohara A, Gamou T, Saito M, Iwamatsu A, Sakai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12185581", "url": "https://glygen.org/publication/PubMed/12185581" } ] }, { "title": "Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuura H, Nishitoh H, Takeda K, Matsuzawa A, Amagasa T, Ito M, Yoshioka K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12189133", "url": "https://glygen.org/publication/PubMed/12189133" } ] }, { "title": "Evidence of functional modulation of the MEKK/JNK/cJun signaling cascade by the low density lipoprotein receptor-related protein (LRP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lutz C, Nimpf J, Jenny M, Boecklinger K, Enzinger C, Utermann G, Baier-Bitterlich G, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12193592", "url": "https://glygen.org/publication/PubMed/12193592" } ] }, { "title": "Nocodazole-induced p53-dependent c-Jun N-terminal kinase activation reduces apoptosis in human colon carcinoma HCT116 cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Zhang H, Shi X, Zhang QJ, Hampong M, Paddon H, Wahyuningsih D, Pelech S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12221076", "url": "https://glygen.org/publication/PubMed/12221076" } ] }, { "title": "Acetylation of p53 inhibits its ubiquitination by Mdm2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li M, Luo J, Brooks CL, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12421820", "url": "https://glygen.org/publication/PubMed/12421820" } ] }, { "title": "NPM-ALK transgenic mice spontaneously develop T-cell lymphomas and plasma cell tumors.", "journal": "Blood", "date": "2003", "authors": "Chiarle R, Gong JZ, Guasparri I, Pesci A, Cai J, Liu J, Simmons WJ, Dhall G, Howes J, Piva R, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12424201", "url": "https://glygen.org/publication/PubMed/12424201" } ] }, { "title": "Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.", "journal": "Genes & development", "date": "2002", "authors": "Kuzmichev A, Nishioka K, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12435631", "url": "https://glygen.org/publication/PubMed/12435631" } ] }, { "title": "Increased expression and activation of c-Jun contributes to human amylin-induced apoptosis in pancreatic islet beta-cells.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Zhang S, Liu J, MacGibbon G, Dragunow M, Cooper GJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12441106", "url": "https://glygen.org/publication/PubMed/12441106" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "The cytoprotective aminothiol WR1065 activates p53 through a non-genotoxic signaling pathway involving c-Jun N-terminal kinase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Pluquet O, North S, Bhoumik A, Dimas K, Ronai Z, Hainaut P", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12531896", "url": "https://glygen.org/publication/PubMed/12531896" } ] }, { "title": "Coactivation of Rac and Rho by Wnt/Frizzled signaling is required for vertebrate gastrulation.", "journal": "Genes & development", "date": "2003", "authors": "Habas R, Dawid IB, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "12533515", "url": "https://glygen.org/publication/PubMed/12533515" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "An unexpected role for FosB in activation-induced cell death of T cells.", "journal": "Oncogene", "date": "2003", "authors": "Baumann S, Hess J, Eichhorst ST, Krueger A, Angel P, Krammer PH, Kirchhoff S", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "12618758", "url": "https://glygen.org/publication/PubMed/12618758" } ] }, { "title": "Uncoupling of protein kinase D from suppression of EGF-dependent c-Jun phosphorylation in cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hurd C, Rozengurt E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12646240", "url": "https://glygen.org/publication/PubMed/12646240" } ] }, { "title": "Vav1: a key signal transducer downstream of the TCR.", "journal": "Immunological reviews", "date": "2003", "authors": "Tybulewicz VL, Ardouin L, Prisco A, Reynolds LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "12670394", "url": "https://glygen.org/publication/PubMed/12670394" } ] }, { "title": "Novel human homologues of p47phox and p67phox participate in activation of superoxide-producing NADPH oxidases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Takeya R, Ueno N, Kami K, Taura M, Kohjima M, Izaki T, Nunoi H, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "12716910", "url": "https://glygen.org/publication/PubMed/12716910" } ] }, { "title": "The Wnt signaling inhibitor dickkopf-1 is required for reentry into the cell cycle of human adult stem cells from bone marrow.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gregory CA, Singh H, Perry AS, Prockop DJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12740383", "url": "https://glygen.org/publication/PubMed/12740383" } ] }, { "title": "ALK activation by the CLTC-ALK fusion is a recurrent event in large B-cell lymphoma.", "journal": "Blood", "date": "2003", "authors": "De Paepe P, Baens M, van Krieken H, Verhasselt B, Stul M, Simons A, Poppe B, Laureys G, Brons P, Vandenberghe P, Speleman F, Praet M, De Wolf-Peeters C, Marynen P, Wlodarska I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12750159", "url": "https://glygen.org/publication/PubMed/12750159" } ] }, { "title": "Non-muscle myosin heavy chain (MYH9): a new partner fused to ALK in anaplastic large cell lymphoma.", "journal": "Genes, chromosomes & cancer", "date": "2003", "authors": "Lamant L, Gascoyne RD, Duplantier MM, Armstrong F, Raghab A, Chhanabhai M, Rajcan-Separovic E, Raghab J, Delsol G, Espinos E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12800156", "url": "https://glygen.org/publication/PubMed/12800156" } ] }, { "title": "Regulation of PRAK subcellular location by p38 MAP kinases.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "New L, Jiang Y, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12808055", "url": "https://glygen.org/publication/PubMed/12808055" } ] }, { "title": "Rapid turnover of extracellular signal-regulated kinase 3 by the ubiquitin-proteasome pathway defines a novel paradigm of mitogen-activated protein kinase regulation during cellular differentiation.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Coulombe P, Rodier G, Pelletier S, Pellerin J, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12808096", "url": "https://glygen.org/publication/PubMed/12808096" } ] }, { "title": "Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Roux PP, Richards SA, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "12832467", "url": "https://glygen.org/publication/PubMed/12832467" } ] }, { "title": "JNK phosphorylation relieves HDAC3-dependent suppression of the transcriptional activity of c-Jun.", "journal": "The EMBO journal", "date": "2003", "authors": "Weiss C, Schneider S, Wagner EF, Zhang X, Seto E, Bohmann D", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12853483", "url": "https://glygen.org/publication/PubMed/12853483" } ] }, { "title": "A reinvestigation of the multisite phosphorylation of the transcription factor c-Jun.", "journal": "The EMBO journal", "date": "2003", "authors": "Morton S, Davis RJ, McLaren A, Cohen P", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12881422", "url": "https://glygen.org/publication/PubMed/12881422" } ] }, { "title": "Nuclear export of ERK3 by a CRM1-dependent mechanism regulates its inhibitory action on cell cycle progression.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Julien C, Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12915405", "url": "https://glygen.org/publication/PubMed/12915405" } ] }, { "title": "ALK+, CD30-, CD20- large B-cell lymphoma containing anaplastic lymphoma kinase (ALK) fused to clathrin heavy chain gene (CLTC).", "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc", "date": "2003", "authors": "Chikatsu N, Kojima H, Suzukawa K, Shinagawa A, Nagasawa T, Ozawa H, Yamashita Y, Mori N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12920229", "url": "https://glygen.org/publication/PubMed/12920229" } ] }, { "title": "Inhibition of JAK3 induces apoptosis and decreases anaplastic lymphoma kinase activity in anaplastic large cell lymphoma.", "journal": "Oncogene", "date": "2003", "authors": "Amin HM, Medeiros LJ, Ma Y, Feretzaki M, Das P, Leventaki V, Rassidakis GZ, O'Connor SL, McDonnell TJ, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12934099", "url": "https://glygen.org/publication/PubMed/12934099" } ] }, { "title": "An activator protein 1-like motif mediates 17beta-estradiol repression of gonadotropin-releasing hormone receptor promoter via an estrogen receptor alpha-dependent mechanism in ovarian and breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003", "authors": "Cheng CK, Chow BK, Leung PC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "12947046", "url": "https://glygen.org/publication/PubMed/12947046" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Expression of the MAPK kinases MKK-4 and MKK-7 in rheumatoid arthritis and their role as key regulators of JNK.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Sundarrajan M, Boyle DL, Chabaud-Riou M, Hammaker D, Firestein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "13130464", "url": "https://glygen.org/publication/PubMed/13130464" } ] }, { "title": "Affinity-purified c-Jun amino-terminal protein kinase requires serine/threonine phosphorylation for activity.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Adler V, Polotskaya A, Wagner F, Kraft AS", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1324919", "url": "https://glygen.org/publication/PubMed/1324919" } ] }, { "title": "Jun is phosphorylated by several protein kinases at the same sites that are modified in serum-stimulated fibroblasts.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Baker SJ, Kerppola TK, Luk D, Vandenberg MT, Marshak DR, Curran T, Abate C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1328860", "url": "https://glygen.org/publication/PubMed/1328860" } ] }, { "title": "Inhibition of c-Jun DNA binding by mitogen-activated protein kinase.", "journal": "Molecular biology of the cell", "date": "1992", "authors": "Chou SY, Baichwal V, Ferrell JE Jr", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1421569", "url": "https://glygen.org/publication/PubMed/1421569" } ] }, { "title": "HdmX stimulates Hdm2-mediated ubiquitination and degradation of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Linares LK, Hengstermann A, Ciechanover A, Muller S, Scheffner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14507994", "url": "https://glygen.org/publication/PubMed/14507994" } ] }, { "title": "Activation of calcium signaling by hepatitis B virus-X protein in liver cells.", "journal": "Experimental & molecular medicine", "date": "2003", "authors": "Oh JC, Jeong DL, Kim IK, Oh SH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "14508071", "url": "https://glygen.org/publication/PubMed/14508071" } ] }, { "title": "EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Bracken AP, Pasini D, Capra M, Prosperini E, Colli E, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14532106", "url": "https://glygen.org/publication/PubMed/14532106" } ] }, { "title": "JNK-dependent phosphorylation of c-Jun on serine 63 mediates nitric oxide-induced apoptosis of neuroblastoma cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Li L, Feng Z, Porter AG", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "14617628", "url": "https://glygen.org/publication/PubMed/14617628" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "Direct binding of the PDZ domain of Dishevelled to a conserved internal sequence in the C-terminal region of Frizzled.", "journal": "Molecular cell", "date": "2003", "authors": "Wong HC, Bourdelas A, Krauss A, Lee HJ, Shao Y, Wu D, Mlodzik M, Shi DL, Zheng J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "14636582", "url": "https://glygen.org/publication/PubMed/14636582" } ] }, { "title": "GDNF-deprived sympathetic neurons die via a novel nonmitochondrial pathway.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Yu LY, Jokitalo E, Sun YF, Mehlen P, Lindholm D, Saarma M, Arumae U", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "14657232", "url": "https://glygen.org/publication/PubMed/14657232" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Identification of an autoregulatory feedback pathway involving interleukin-1alpha in induction of constitutive NF-kappaB activation in pancreatic cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Niu J, Li Z, Peng B, Chiao PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "14679213", "url": "https://glygen.org/publication/PubMed/14679213" } ] }, { "title": "CEP11004, a novel inhibitor of the mixed lineage kinases, suppresses apoptotic death in dopamine neurons of the substantia nigra induced by 6-hydroxydopamine.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Ganguly A, Oo TF, Rzhetskaya M, Pratt R, Yarygina O, Momoi T, Kholodilov N, Burke RE", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "14690535", "url": "https://glygen.org/publication/PubMed/14690535" } ] }, { "title": "The ubiquitin ligase SCFFbw7 antagonizes apoptotic JNK signaling.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Nateri AS, Riera-Sans L, Da Costa C, Behrens A", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" } ] }, { "title": "Target specificity analysis of the Abl kinase using peptide microarray data.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Rychlewski L, Kschischo M, Dong L, Schutkowski M, Reimer U", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "14757045", "url": "https://glygen.org/publication/PubMed/14757045" } ] }, { "title": "NPM-ALK fusion kinase of anaplastic large-cell lymphoma regulates survival and proliferative signaling through modulation of FOXO3a.", "journal": "Blood", "date": "2004", "authors": "Gu TL, Tothova Z, Scheijen B, Griffin JD, Gilliland DG, Sternberg DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "14962911", "url": "https://glygen.org/publication/PubMed/14962911" } ] }, { "title": "p53 regulates thymic Notch1 activation.", "journal": "European journal of immunology", "date": "2004", "authors": "Laws AM, Osborne BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "14991602", "url": "https://glygen.org/publication/PubMed/14991602" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Activation of the c-Jun transcription factor following neurodegeneration in vivo.", "journal": "Neuroscience letters", "date": "2004", "authors": "Schenkel J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15135887", "url": "https://glygen.org/publication/PubMed/15135887" } ] }, { "title": "JNK interacting protein 1 (JIP-1) protects LNCaP prostate cancer cells from growth arrest and apoptosis mediated by 12-0-tetradecanoylphorbol-13-acetate (TPA).", "journal": "British journal of cancer", "date": "2004", "authors": "Ikezoe T, Yang Y, Taguchi H, Koeffler HP", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15138488", "url": "https://glygen.org/publication/PubMed/15138488" } ] }, { "title": "Wnt proteins induce dishevelled phosphorylation via an LRP5/6- independent mechanism, irrespective of their ability to stabilize beta-catenin.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Gonzalez-Sancho JM, Brennan KR, Castelo-Soccio LA, Brown AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "15143170", "url": "https://glygen.org/publication/PubMed/15143170" } ] }, { "title": "Casein kinase II is a negative regulator of c-Jun DNA binding and AP-1 activity.", "journal": "Cell", "date": "1992", "authors": "Lin A, Frost J, Deng T, Smeal T, al-Alawi N, Kikkawa U, Hunter T, Brenner D, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1516134", "url": "https://glygen.org/publication/PubMed/1516134" } ] }, { "title": "Stabilization of Mdm2 via decreased ubiquitination is mediated by protein kinase B/Akt-dependent phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Feng J, Tamaskovic R, Yang Z, Brazil DP, Merlo A, Hess D, Hemmings BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15169778", "url": "https://glygen.org/publication/PubMed/15169778" } ] }, { "title": "Differential effects of X-ALK fusion proteins on proliferation, transformation, and invasion properties of NIH3T3 cells.", "journal": "Oncogene", "date": "2004", "authors": "Armstrong F, Duplantier MM, Trempat P, Hieblot C, Lamant L, Espinos E, Racaud-Sultan C, Allouche M, Campo E, Delsol G, Touriol C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15208656", "url": "https://glygen.org/publication/PubMed/15208656" } ] }, { "title": "Organization of mammary epithelial cells into 3D acinar structures requires glucocorticoid and JNK signaling.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Murtagh J, McArdle E, Gilligan E, Thornton L, Furlong F, Martin F", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15226308", "url": "https://glygen.org/publication/PubMed/15226308" } ] }, { "title": "N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15226418", "url": "https://glygen.org/publication/PubMed/15226418" } ] }, { "title": "Heterodimer formation between c-Jun and Jun B proteins mediated by Epstein-Barr virus encoded latent membrane protein 1.", "journal": "Cellular signalling", "date": "2004", "authors": "Song X, Tao YG, Deng XY, Jin X, Tan YN, Tang M, Wu Q, Lee LM, Cao Y", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15240010", "url": "https://glygen.org/publication/PubMed/15240010" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Catalysis and function of the p38 alpha.MK2a signaling complex.", "journal": "Biochemistry", "date": "2004", "authors": "Lukas SM, Kroe RR, Wildeson J, Peet GW, Frego L, Davidson W, Ingraham RH, Pargellis CA, Labadia ME, Werneburg BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15287722", "url": "https://glygen.org/publication/PubMed/15287722" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Parallel identification of O-GlcNAc-modified proteins from cell lysates.", "journal": "Journal of the American Chemical Society", "date": "2004", "authors": "Tai HC, Khidekel N, Ficarro SB, Peters EC, Hsieh-Wilson LC", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "15327282", "url": "https://glygen.org/publication/PubMed/15327282" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Inhibition of Akt increases p27Kip1 levels and induces cell cycle arrest in anaplastic large cell lymphoma.", "journal": "Blood", "date": "2005", "authors": "Rassidakis GZ, Feretzaki M, Atwell C, Grammatikakis I, Lin Q, Lai R, Claret FX, Medeiros LJ, Amin HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15374880", "url": "https://glygen.org/publication/PubMed/15374880" } ] }, { "title": "c-Jun phosphorylation by the human vaccinia-related kinase 1 (VRK1) and its cooperation with the N-terminal kinase of c-Jun (JNK).", "journal": "Oncogene", "date": "2004", "authors": "Sevilla A, Santos CR, Barcia R, Vega FM, Lazo PA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15378002", "url": "https://glygen.org/publication/PubMed/15378002" } ] }, { "title": "UV-induced apoptosis in SH-SY5Y cells: contribution to apoptosis by JNK signaling and cytochrome c.", "journal": "Journal of neuroscience research", "date": "2004", "authors": "Berglund CM, Radesater AC, Persson MA, Budd Haeberlein SL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15389828", "url": "https://glygen.org/publication/PubMed/15389828" } ] }, { "title": "Transcriptional repression of MMP-1 by p21SNFT and reduced in vitro invasiveness of hepatocarcinoma cells.", "journal": "Oncogene", "date": "2004", "authors": "Bower KE, Fritz JM, McGuire KL", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "15467742", "url": "https://glygen.org/publication/PubMed/15467742" } ] }, { "title": "Activating mutations of NOTCH1 in human T cell acute lymphoblastic leukemia.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Weng AP, Ferrando AA, Lee W, Morris JP 4th, Silverman LB, Sanchez-Irizarry C, Blacklow SC, Look AT, Aster JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15472075", "url": "https://glygen.org/publication/PubMed/15472075" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Scaffolding by ERK3 regulates MK5 in development.", "journal": "The EMBO journal", "date": "2004", "authors": "Schumacher S, Laass K, Kant S, Shi Y, Visel A, Gruber AD, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15538386", "url": "https://glygen.org/publication/PubMed/15538386" } ] }, { "title": "PAK and other Rho-associated kinases--effectors with surprisingly diverse mechanisms of regulation.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zhao ZS, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "15548136", "url": "https://glygen.org/publication/PubMed/15548136" } ] }, { "title": "MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Voncken JW, Niessen H, Neufeld B, Rennefahrt U, Dahlmans V, Kubben N, Holzer B, Ludwig S, Rapp UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15563468", "url": "https://glygen.org/publication/PubMed/15563468" } ] }, { "title": "Activation of MK5/PRAK by the atypical MAP kinase ERK3 defines a novel signal transduction pathway.", "journal": "The EMBO journal", "date": "2004", "authors": "Seternes OM, Mikalsen T, Johansen B, Michaelsen E, Armstrong CG, Morrice NA, Turgeon B, Meloche S, Moens U, Keyse SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15577943", "url": "https://glygen.org/publication/PubMed/15577943" } ] }, { "title": "NPM/ALK downregulates p27Kip1 in a PI-3K-dependent manner.", "journal": "Experimental hematology", "date": "2004", "authors": "Slupianek A, Skorski T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15588951", "url": "https://glygen.org/publication/PubMed/15588951" } ] }, { "title": "Calcium signals induced by amyloid beta peptide and their consequences in neurons and astrocytes in culture.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Abramov AY, Canevari L, Duchen MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "15590058", "url": "https://glygen.org/publication/PubMed/15590058" } ] }, { "title": "Wnt signaling through Dishevelled, Rac and JNK regulates dendritic development.", "journal": "Nature neuroscience", "date": "2005", "authors": "Rosso SB, Sussman D, Wynshaw-Boris A, Salinas PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "15608632", "url": "https://glygen.org/publication/PubMed/15608632" } ] }, { "title": "Molecular determinants of NOTCH4 transcription in vascular endothelium.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Wu J, Iwata F, Grass JA, Osborne CS, Elnitski L, Fraser P, Ohneda O, Yamamoto M, Bresnick EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15684396", "url": "https://glygen.org/publication/PubMed/15684396" } ] }, { "title": "Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.", "journal": "Genes & development", "date": "2005", "authors": "Tachibana M, Ueda J, Fukuda M, Takeda N, Ohta T, Iwanari H, Sakihama T, Kodama T, Hamakubo T, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "15774718", "url": "https://glygen.org/publication/PubMed/15774718" } ] }, { "title": "Identification of the mismatch repair genes PMS2 and MLH1 as p53 target genes by using serial analysis of binding elements.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Chen J, Sadowski I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "15781865", "url": "https://glygen.org/publication/PubMed/15781865" } ] }, { "title": "Heterodimer formation between c-Jun and Jun B proteins mediated by Epstein Barr virus encoded latent membrane protein 1.", "journal": "Science in China. Series C, Life sciences", "date": "2005", "authors": "Song X, Tao Y, Tan Y, Lee LM, Deng X, Wu Q, Cao Y", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15844359", "url": "https://glygen.org/publication/PubMed/15844359" } ] }, { "title": "The rapamycin analog CCI-779 is a potent inhibitor of pancreatic cancer cell proliferation.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Asano T, Yao Y, Zhu J, Li D, Abbruzzese JL, Reddy SA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15845392", "url": "https://glygen.org/publication/PubMed/15845392" } ] }, { "title": "(-)-Epigallocatechin-3-gallate promotes pro-matrix metalloproteinase-7 production via activation of the JNK1/2 pathway in HT-29 human colorectal cancer cells.", "journal": "Carcinogenesis", "date": "2005", "authors": "Kim M, Murakami A, Kawabata K, Ohigashi H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15860507", "url": "https://glygen.org/publication/PubMed/15860507" } ] }, { "title": "Conserved docking site is essential for activation of mammalian MAP kinase kinases by specific MAP kinase kinase kinases.", "journal": "Molecular cell", "date": "2005", "authors": "Takekawa M, Tatebayashi K, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15866172", "url": "https://glygen.org/publication/PubMed/15866172" } ] }, { "title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2005", "authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "15867264", "url": "https://glygen.org/publication/PubMed/15867264" } ] }, { "title": "Stat3 is required for ALK-mediated lymphomagenesis and provides a possible therapeutic target.", "journal": "Nature medicine", "date": "2005", "authors": "Chiarle R, Simmons WJ, Cai H, Dhall G, Zamo A, Raz R, Karras JG, Levy DE, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15895073", "url": "https://glygen.org/publication/PubMed/15895073" } ] }, { "title": "Activation of c-Jun N-terminal kinase (JNK) pathway by HSV-1 immediate early protein ICP0.", "journal": "Experimental cell research", "date": "2005-08-01", "authors": "Diao Lirong, Zhang Bianhong, Xuan Chenghao, Sun Shaogang, Yang Kai, Tang Yujie, Qiao Wentao, Chen Qimin, Geng Yunqi, Wang Chen", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "15896775", "url": "https://glygen.org/publication/PubMed/15896775" } ] }, { "title": "Subcellular localization and signaling properties of dishevelled in developing vertebrate embryos.", "journal": "Current biology : CB", "date": "2005", "authors": "Park TJ, Gray RS, Sato A, Habas R, Wallingford JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "15936275", "url": "https://glygen.org/publication/PubMed/15936275" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "The v-Jun point mutation allows c-Jun to escape GSK3-dependent recognition and destruction by the Fbw7 ubiquitin ligase.", "journal": "Cancer cell", "date": "2005", "authors": "Wei W, Jin J, Schlisio S, Harper JW, Kaelin WG Jr", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16023596", "url": "https://glygen.org/publication/PubMed/16023596" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.", "journal": "Human molecular genetics", "date": "2005", "authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16079151", "url": "https://glygen.org/publication/PubMed/16079151" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Jak3 activation is significantly associated with ALK expression in anaplastic large cell lymphoma.", "journal": "Human pathology", "date": "2005", "authors": "Lai R, Rassidakis GZ, Lin Q, Atwell C, Medeiros LJ, Amin HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16153455", "url": "https://glygen.org/publication/PubMed/16153455" } ] }, { "title": "Fusion of the SEC31L1 and ALK genes in an inflammatory myofibroblastic tumor.", "journal": "International journal of cancer", "date": "2006", "authors": "Panagopoulos I, Nilsson T, Domanski HA, Isaksson M, Lindblom P, Mertens F, Mandahl N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16161041", "url": "https://glygen.org/publication/PubMed/16161041" } ] }, { "title": "Inhibition of ALK enzymatic activity in T-cell lymphoma cells induces apoptosis and suppresses proliferation and STAT3 phosphorylation independently of Jak3.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2005", "authors": "Marzec M, Kasprzycka M, Ptasznik A, Wlodarski P, Zhang Q, Odum N, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16170336", "url": "https://glygen.org/publication/PubMed/16170336" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Oncoprotein-mediated signalling cascade stimulates c-Jun activity by phosphorylation of serines 63 and 73.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Smeal T, Binetruy B, Mercola D, Grover-Bardwick A, Heidecker G, Rapp UR, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1630458", "url": "https://glygen.org/publication/PubMed/1630458" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Molecular interaction of NADPH oxidase 1 with betaPix and Nox Organizer 1.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Park HS, Park D, Bae YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "16329988", "url": "https://glygen.org/publication/PubMed/16329988" } ] }, { "title": "Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells.", "journal": "Molecular cell", "date": "2005", "authors": "Nicke B, Bastien J, Khanna SJ, Warne PH, Cowling V, Cook SJ, Peters G, Delpuech O, Schulze A, Berns K, Mullenders J, Beijersbergen RL, Bernards R, Ganesan TS, Downward J, Hancock DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16337592", "url": "https://glygen.org/publication/PubMed/16337592" } ] }, { "title": "Identification of extracellular signal-regulated kinase 3 as a new interaction partner of cyclin D3.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Sun M, Wei Y, Yao L, Xie J, Chen X, Wang H, Jiang J, Gu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16360641", "url": "https://glygen.org/publication/PubMed/16360641" } ] }, { "title": "Here come the septins: novel polymers that coordinate intracellular functions and organization.", "journal": "Journal of cell science", "date": "2006", "authors": "Spiliotis ET, Nelson WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16371649", "url": "https://glygen.org/publication/PubMed/16371649" } ] }, { "title": "Up-regulation of PTEN (phosphatase and tensin homolog deleted on chromosome ten) mediates p38 MAPK stress signal-induced inhibition of insulin signaling. A cross-talk between stress signaling and insulin signaling in resistin-treated human endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Shen YH, Zhang L, Gan Y, Wang X, Wang J, LeMaire SA, Coselli JS, Wang XL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16418168", "url": "https://glygen.org/publication/PubMed/16418168" } ] }, { "title": "DNA damage signaling and p53-dependent senescence after prolonged beta-interferon stimulation.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Moiseeva O, Mallette FA, Mukhopadhyay UK, Moores A, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16436515", "url": "https://glygen.org/publication/PubMed/16436515" } ] }, { "title": "Sp1 deacetylation induced by phorbol ester recruits p300 to activate 12(S)-lipoxygenase gene transcription.", "journal": "Mol. Cell. Biol.", "date": "2006", "authors": "Hung JJ, Wang YT, Chang WC", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "16478997", "url": "https://glygen.org/publication/PubMed/16478997" } ] }, { "title": "Activated c-Jun is present in neurofibrillary tangles in Alzheimer's disease brains.", "journal": "Neuroscience letters", "date": "2006", "authors": "Pearson AG, Byrne UT, MacGibbon GA, Faull RL, Dragunow M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16481106", "url": "https://glygen.org/publication/PubMed/16481106" } ] }, { "title": "Pro-Leu-Ser/Thr-Pro is a consensus primary sequence for substrate protein phosphorylation. Characterization of the phosphorylation of c-myc and c-jun proteins by an epidermal growth factor receptor threonine 669 protein kinase.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Alvarez E, Northwood IC, Gonzalez FA, Latour DA, Seth A, Abate C, Curran T, Davis RJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1651323", "url": "https://glygen.org/publication/PubMed/1651323" } ] }, { "title": "MicroRNA fingerprints during human megakaryocytopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16549775", "url": "https://glygen.org/publication/PubMed/16549775" } ] }, { "title": "Notch 1 activation in the molecular pathogenesis of T-cell acute lymphoblastic leukaemia.", "journal": "Nature reviews. Cancer", "date": "2006", "authors": "Grabher C, von Boehmer H, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "16612405", "url": "https://glygen.org/publication/PubMed/16612405" } ] }, { "title": "The MAP kinase ERK5 binds to and phosphorylates p90 RSK.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Ranganathan A, Pearson GW, Chrestensen CA, Sturgill TW, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "16626623", "url": "https://glygen.org/publication/PubMed/16626623" } ] }, { "title": "Nox1-dependent reactive oxygen generation is regulated by Rac1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cheng G, Diebold BA, Hughes Y, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "16636067", "url": "https://glygen.org/publication/PubMed/16636067" } ] }, { "title": "c-Jun promotes cellular survival by suppression of PTEN.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Hettinger K, Vikhanskaya F, Poh MK, Lee MK, de Belle I, Zhang JT, Reddy SA, Sabapathy K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16676006", "url": "https://glygen.org/publication/PubMed/16676006" } ] }, { "title": "Nobiletin, a citrus flavonoid, suppresses phorbol ester-induced expression of multiple scavenger receptor genes in THP-1 human monocytic cells.", "journal": "FEBS letters", "date": "2006", "authors": "Eguchi A, Murakami A, Ohigashi H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16698017", "url": "https://glygen.org/publication/PubMed/16698017" } ] }, { "title": "Nuclear receptor TLX prevents retinal dystrophy and recruits the corepressor atrophin1.", "journal": "Genes & development", "date": "2006", "authors": "Zhang CL, Zou Y, Yu RT, Gage FH, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16702404", "url": "https://glygen.org/publication/PubMed/16702404" } ] }, { "title": "c-Jun activation is associated with proliferation and angiogenesis in invasive breast cancer.", "journal": "Human pathology", "date": "2006", "authors": "Vleugel MM, Greijer AE, Bos R, van der Wall E, van Diest PJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16733206", "url": "https://glygen.org/publication/PubMed/16733206" } ] }, { "title": "COOH-terminal Src kinase-mediated c-Jun phosphorylation promotes c-Jun degradation and inhibits cell transformation.", "journal": "Cancer research", "date": "2006", "authors": "Zhu F, Choi BY, Ma WY, Zhao Z, Zhang Y, Cho YY, Choi HS, Imamoto A, Bode AM, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16740711", "url": "https://glygen.org/publication/PubMed/16740711" } ] }, { "title": "Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Miyano K, Ueno N, Takeya R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "16762923", "url": "https://glygen.org/publication/PubMed/16762923" } ] }, { "title": "ErbB4 (JM-b/CYT-1)-induced expression and phosphorylation of c-Jun is abrogated by human papillomavirus type 16 E5 protein.", "journal": "Oncogene", "date": "2007", "authors": "Chen SL, Lin ST, Tsai TC, Hsiao WC, Tsao YP", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16819515", "url": "https://glygen.org/publication/PubMed/16819515" } ] }, { "title": "Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.", "journal": "Blood", "date": "2006", "authors": "Han Y, Amin HM, Franko B, Frantz C, Shi X, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16825495", "url": "https://glygen.org/publication/PubMed/16825495" } ] }, { "title": "Coupling mitochondrial respiratory chain to cell death: an essential role of mitochondrial complex I in the interferon-beta and retinoic acid-induced cancer cell death.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Huang G, Chen Y, Lu H, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16826196", "url": "https://glygen.org/publication/PubMed/16826196" } ] }, { "title": "Streptococcus pneumoniae induced c-Jun-N-terminal kinase- and AP-1 -dependent IL-8 release by lung epithelial BEAS-2B cells.", "journal": "Respiratory research", "date": "2006", "authors": "Schmeck B, Moog K, Zahlten J, van Laak V, N'Guessan PD, Opitz B, Rosseau S, Suttorp N, Hippenstiel S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16834785", "url": "https://glygen.org/publication/PubMed/16834785" } ] }, { "title": "Restoration of shp1 expression by 5-AZA-2'-deoxycytidine is associated with downregulation of JAK3/STAT3 signaling in ALK-positive anaplastic large cell lymphoma.", "journal": "Leukemia", "date": "2006", "authors": "Han Y, Amin HM, Frantz C, Franko B, Lee J, Lin Q, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16871283", "url": "https://glygen.org/publication/PubMed/16871283" } ] }, { "title": "c-Jun N-terminal kinase mediates constitutive human eosinophil apoptosis.", "journal": "Pulmonary pharmacology & therapeutics", "date": "2007", "authors": "Hasala H, Zhang X, Saarelainen S, Moilanen E, Kankaanranta H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16934508", "url": "https://glygen.org/publication/PubMed/16934508" } ] }, { "title": "JSI-124 (cucurbitacin I) inhibits Janus kinase-3/signal transducer and activator of transcription-3 signalling, downregulates nucleophosmin-anaplastic lymphoma kinase (ALK), and induces apoptosis in ALK-positive anaplastic large cell lymphoma cells.", "journal": "British journal of haematology", "date": "2006", "authors": "Shi X, Franko B, Frantz C, Amin HM, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16939498", "url": "https://glygen.org/publication/PubMed/16939498" } ] }, { "title": "Involvement of protein phosphatase 2A nuclear accumulation and subsequent inactivation of activator protein-1 in leptomycin B-inhibited cyclin D1 expression.", "journal": "Oncogene", "date": "2007", "authors": "Tsuchiya A, Tashiro E, Yoshida M, Imoto M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "16964287", "url": "https://glygen.org/publication/PubMed/16964287" } ] }, { "title": "Regulation of MAPK-activated protein kinase 5 activity and subcellular localization by the atypical MAPK ERK4/MAPK4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Aberg E, Perander M, Johansen B, Julien C, Meloche S, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16971392", "url": "https://glygen.org/publication/PubMed/16971392" } ] }, { "title": "Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kant S, Schumacher S, Singh MK, Kispert A, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16973613", "url": "https://glygen.org/publication/PubMed/16973613" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Identification of multiple SNT-binding sites on NPM-ALK oncoprotein and their involvement in cell transformation.", "journal": "Oncogene", "date": "2007", "authors": "Chikamori M, Fujimoto J, Tokai-Nishizumi N, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17086210", "url": "https://glygen.org/publication/PubMed/17086210" } ] }, { "title": "Wnt11 controls cell contact persistence by local accumulation of Frizzled 7 at the plasma membrane.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Witzel S, Zimyanin V, Carreira-Barbosa F, Tada M, Heisenberg CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "17130287", "url": "https://glygen.org/publication/PubMed/17130287" } ] }, { "title": "Atypical mitogen-activated protein kinases: structure, regulation and functions.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17161475", "url": "https://glygen.org/publication/PubMed/17161475" } ] }, { "title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17185360", "url": "https://glygen.org/publication/PubMed/17185360" } ] }, { "title": "Cyclic AMP stimulates SF-1-dependent CYP11A1 expression through homeodomain-interacting protein kinase 3-mediated Jun N-terminal kinase and c-Jun phosphorylation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Lan HC, Li HJ, Lin G, Lai PY, Chung BC", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "17210646", "url": "https://glygen.org/publication/PubMed/17210646" } ] }, { "title": "pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene.", "journal": "Genes & development", "date": "2007", "authors": "Kotake Y, Cao R, Viatour P, Sage J, Zhang Y, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17210787", "url": "https://glygen.org/publication/PubMed/17210787" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "Crystal structure of the p38 alpha-MAPKAP kinase 2 heterodimer.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "ter Haar E, Prabhakar P, Liu X, Lepre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17255097", "url": "https://glygen.org/publication/PubMed/17255097" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "c-Jun expression and activation are restricted to CD30+ lymphoproliferative disorders.", "journal": "The American journal of surgical pathology", "date": "2007", "authors": "Drakos E, Leventaki V, Schlette EJ, Jones D, Lin P, Medeiros LJ, Rassidakis GZ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17325487", "url": "https://glygen.org/publication/PubMed/17325487" } ] }, { "title": "Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.", "journal": "The EMBO journal", "date": "2007", "authors": "Dietrich N, Bracken AP, Trinh E, Schjerling CK, Koseki H, Rappsilber J, Helin K, Hansen KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17332741", "url": "https://glygen.org/publication/PubMed/17332741" } ] }, { "title": "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.", "journal": "Genes & development", "date": "2007", "authors": "Bracken AP, Kleine-Kohlbrecher D, Dietrich N, Pasini D, Gargiulo G, Beekman C, Theilgaard-Monch K, Minucci S, Porse BT, Marine JC, Hansen KH, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17344414", "url": "https://glygen.org/publication/PubMed/17344414" } ] }, { "title": "Notch1 is a p53 target gene involved in human keratinocyte tumor suppression through negative regulation of ROCK1/2 and MRCKalpha kinases.", "journal": "Genes & development", "date": "2007", "authors": "Lefort K, Mandinova A, Ostano P, Kolev V, Calpini V, Kolfschoten I, Devgan V, Lieb J, Raffoul W, Hohl D, Neel V, Garlick J, Chiorino G, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17344417", "url": "https://glygen.org/publication/PubMed/17344417" } ] }, { "title": "Oncogenic tyrosine kinase NPM/ALK induces activation of the rapamycin-sensitive mTOR signaling pathway.", "journal": "Oncogene", "date": "2007", "authors": "Marzec M, Kasprzycka M, Liu X, El-Salem M, Halasa K, Raghunath PN, Bucki R, Wlodarski P, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17353907", "url": "https://glygen.org/publication/PubMed/17353907" } ] }, { "title": "Molecular basis of MAPK-activated protein kinase 2:p38 assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "White A, Pargellis CA, Studts JM, Werneburg BG, Farmer BT 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17395714", "url": "https://glygen.org/publication/PubMed/17395714" } ] }, { "title": "Endothelial cell migration during angiogenesis.", "journal": "Circulation research", "date": "2007", "authors": "Lamalice L, Le Boeuf F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17395884", "url": "https://glygen.org/publication/PubMed/17395884" } ] }, { "title": "NPM-ALK oncogenic kinase promotes cell-cycle progression through activation of JNK/cJun signaling in anaplastic large-cell lymphoma.", "journal": "Blood", "date": "2007", "authors": "Leventaki V, Drakos E, Medeiros LJ, Lim MS, Elenitoba-Johnson KS, Claret FX, Rassidakis GZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17416736", "url": "https://glygen.org/publication/PubMed/17416736" } ] }, { "title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17428788", "url": "https://glygen.org/publication/PubMed/17428788" } ] }, { "title": "c-Jun phosphorylation in Alzheimer disease.", "journal": "Journal of neuroscience research", "date": "2007", "authors": "Thakur A, Wang X, Siedlak SL, Perry G, Smith MA, Zhu X", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17455299", "url": "https://glygen.org/publication/PubMed/17455299" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The tyrosine phosphatase Shp2 interacts with NPM-ALK and regulates anaplastic lymphoma cell growth and migration.", "journal": "Cancer research", "date": "2007", "authors": "Voena C, Conte C, Ambrogio C, Boeri Erba E, Boccalatte F, Mohammed S, Jensen ON, Palestro G, Inghirami G, Chiarle R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17483340", "url": "https://glygen.org/publication/PubMed/17483340" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Src induces urokinase receptor gene expression and invasion/intravasation via activator protein-1/p-c-Jun in colorectal cancer.", "journal": "Molecular cancer research : MCR", "date": "2007", "authors": "Leupold JH, Asangani I, Maurer GD, Lengyel E, Post S, Allgayer H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17510314", "url": "https://glygen.org/publication/PubMed/17510314" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "GEFs and GAPs: critical elements in the control of small G proteins.", "journal": "Cell", "date": "2007", "authors": "Bos JL, Rehmann H, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "17540168", "url": "https://glygen.org/publication/PubMed/17540168" } ] }, { "title": "Transcriptional activation of miR-34a contributes to p53-mediated apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Raver-Shapira N, Marciano E, Meiri E, Spector Y, Rosenfeld N, Moskovits N, Bentwich Z, Oren M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540598", "url": "https://glygen.org/publication/PubMed/17540598" } ] }, { "title": "Transactivation of miR-34a by p53 broadly influences gene expression and promotes apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Chang TC, Wentzel EA, Kent OA, Ramachandran K, Mullendore M, Lee KH, Feldmann G, Yamakuchi M, Ferlito M, Lowenstein CJ, Arking DE, Beer MA, Maitra A, Mendell JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540599", "url": "https://glygen.org/publication/PubMed/17540599" } ] }, { "title": "A microRNA component of the p53 tumour suppressor network.", "journal": "Nature", "date": "2007", "authors": "He L, He X, Lim LP, de Stanchina E, Xuan Z, Liang Y, Xue W, Zender L, Magnus J, Ridzon D, Jackson AL, Linsley PS, Chen C, Lowe SW, Cleary MA, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17554337", "url": "https://glygen.org/publication/PubMed/17554337" } ] }, { "title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.", "journal": "The EMBO journal", "date": "1991", "authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1756725", "url": "https://glygen.org/publication/PubMed/1756725" } ] }, { "title": "Identification of the transforming EML4-ALK fusion gene in non-small-cell lung cancer.", "journal": "Nature", "date": "2007", "authors": "Soda M, Choi YL, Enomoto M, Takada S, Yamashita Y, Ishikawa S, Fujiwara S, Watanabe H, Kurashina K, Hatanaka H, Bando M, Ohno S, Ishikawa Y, Aburatani H, Niki T, Sohara Y, Sugiyama Y, Mano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17625570", "url": "https://glygen.org/publication/PubMed/17625570" } ] }, { "title": "XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway.", "journal": "The EMBO journal", "date": "2007", "authors": "Lee RH, Iioka H, Ohashi M, Iemura S, Natsume T, Kinoshita N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "17627283", "url": "https://glygen.org/publication/PubMed/17627283" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "DNA methylation regulates MicroRNA expression.", "journal": "Cancer biology & therapy", "date": "2007", "authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17660710", "url": "https://glygen.org/publication/PubMed/17660710" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Opposite regulation of oligodendrocyte apoptosis by JNK3 and Pin1 after spinal cord injury.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2007", "authors": "Li QM, Tep C, Yune TY, Zhou XZ, Uchida T, Lu KP, Yoon SO", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17670986", "url": "https://glygen.org/publication/PubMed/17670986" } ] }, { "title": "Monitoring Notch1 activity in development: evidence for a feedback regulatory loop.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2007", "authors": "Del Monte G, Grego-Bessa J, Gonzalez-Rajal A, Bolos V, De La Pompa JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17685488", "url": "https://glygen.org/publication/PubMed/17685488" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "14-3-3epsilon inhibits MK5-mediated cell migration by disrupting F-actin polymerization.", "journal": "Cellular signalling", "date": "2007", "authors": "Tak H, Jang E, Kim SB, Park J, Suk J, Yoon YS, Ahn JK, Lee JH, Joe CO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17728103", "url": "https://glygen.org/publication/PubMed/17728103" } ] }, { "title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17761849", "url": "https://glygen.org/publication/PubMed/17761849" } ] }, { "title": "Pro-inflammatory cytokines increase reactive oxygen species through mitochondria and NADPH oxidase in cultured RPE cells.", "journal": "Experimental eye research", "date": "2007", "authors": "Yang D, Elner SG, Bian ZM, Till GO, Petty HR, Elner VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17765224", "url": "https://glygen.org/publication/PubMed/17765224" } ] }, { "title": "Stress-induced c-Jun activation mediated by Polo-like kinase 3 in corneal epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Wang L, Dai W, Lu L", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17804415", "url": "https://glygen.org/publication/PubMed/17804415" } ] }, { "title": "MicroRNA-34b and MicroRNA-34c are targets of p53 and cooperate in control of cell proliferation and adhesion-independent growth.", "journal": "Cancer research", "date": "2007", "authors": "Corney DC, Flesken-Nikitin A, Godwin AK, Wang W, Nikitin AY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17823410", "url": "https://glygen.org/publication/PubMed/17823410" } ] }, { "title": "The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing.", "journal": "Cell", "date": "2007", "authors": "De Santa F, Totaro MG, Prosperini E, Notarbartolo S, Testa G, Natoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17825402", "url": "https://glygen.org/publication/PubMed/17825402" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Orphan nuclear receptor TLX recruits histone deacetylases to repress transcription and regulate neural stem cell proliferation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Sun G, Yu RT, Evans RM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "17873065", "url": "https://glygen.org/publication/PubMed/17873065" } ] }, { "title": "Targeted deletion of the mitogen-activated protein kinase kinase 4 gene in the nervous system causes severe brain developmental defects and premature death.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Wang X, Nadarajah B, Robinson AC, McColl BW, Jin JW, Dajas-Bailador F, Boot-Handford RP, Tournier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17875933", "url": "https://glygen.org/publication/PubMed/17875933" } ] }, { "title": "[c-Jun NH2-terminal kinase and extracellular signal-regulated protein kinase signaling pathways in regulation of benzo(a)pyrene-induced c-Jun activation in human embryo lung fibroblasts].", "journal": "Zhonghua lao dong wei sheng zhi ye bing za zhi = Zhonghua laodong weisheng zhiyebing zazhi = Chinese journal of industrial hygiene and occupational diseases", "date": "2007", "authors": "Jiao S, Liu BC, Shi XL, Huang CS, Gao A, Ye M, Jia XW", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17908424", "url": "https://glygen.org/publication/PubMed/17908424" } ] }, { "title": "Negative charged threonine 95 of c-Jun is essential for c-Jun N-terminal kinase-dependent phosphorylation of threonine 91/93 and stress-induced c-Jun biological activity.", "journal": "The international journal of biochemistry & cell biology", "date": "2008", "authors": "Vinciguerra M, Esposito I, Salzano S, Madeo A, Nagel G, Maggiolini M, Gallo A, Musti AM", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17920329", "url": "https://glygen.org/publication/PubMed/17920329" } ] }, { "title": "Modulation of F-actin rearrangement by the cyclic AMP/cAMP-dependent protein kinase (PKA) pathway is mediated by MAPK-activated protein kinase 5 and requires PKA-induced nuclear export of MK5.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Gerits N, Mikalsen T, Kostenko S, Shiryaev A, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17947239", "url": "https://glygen.org/publication/PubMed/17947239" } ] }, { "title": "Calcineurin-mediated dephosphorylation of c-Jun Ser-243 is required for c-Jun protein stability and cell transformation.", "journal": "Oncogene", "date": "2008", "authors": "Huang CC, Wang JM, Kikkawa U, Mukai H, Shen MR, Morita I, Chen BK, Chang WC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "17952113", "url": "https://glygen.org/publication/PubMed/17952113" } ] }, { "title": "Suppression of PTEN expression is essential for antiapoptosis and cellular transformation by oncogenic Ras.", "journal": "Cancer research", "date": "2007", "authors": "Vasudevan KM, Burikhanov R, Goswami A, Rangnekar VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "17974977", "url": "https://glygen.org/publication/PubMed/17974977" } ] }, { "title": "Kalirin-7 controls activity-dependent structural and functional plasticity of dendritic spines.", "journal": "Neuron", "date": "2007", "authors": "Xie Z, Srivastava DP, Photowala H, Kai L, Cahill ME, Woolfrey KM, Shum CY, Surmeier DJ, Penzes P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18031682", "url": "https://glygen.org/publication/PubMed/18031682" } ] }, { "title": "The anaplastic lymphoma kinase in the pathogenesis of cancer.", "journal": "Nature reviews. Cancer", "date": "2008", "authors": "Chiarle R, Voena C, Ambrogio C, Piva R, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18097461", "url": "https://glygen.org/publication/PubMed/18097461" } ] }, { "title": "Proto-oncogene ACTR/AIB1 promotes cancer cell invasion by up-regulating specific matrix metalloproteinase expression.", "journal": "Cancer letters", "date": "2008", "authors": "Li LB, Louie MC, Chen HW, Zou JX", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18162290", "url": "https://glygen.org/publication/PubMed/18162290" } ] }, { "title": "Repression of PTEN phosphatase by Snail1 transcriptional factor during gamma radiation-induced apoptosis.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Escriva M, Peiro S, Herranz N, Villagrasa P, Dave N, Montserrat-Sentis B, Murray SA, Franci C, Gridley T, Virtanen I, Garcia de Herreros A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18172008", "url": "https://glygen.org/publication/PubMed/18172008" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "A functional link between the human cell cycle-regulatory phosphatase Cdc14A and the atypical mitogen-activated kinase Erk3.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Hansen CA, Bartek J, Jensen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18235225", "url": "https://glygen.org/publication/PubMed/18235225" } ] }, { "title": "The Ser(186) phospho-acceptor site within ERK4 is essential for its ability to interact with and activate PRAK/MK5.", "journal": "The Biochemical journal", "date": "2008", "authors": "Perander M, Aberg E, Johansen B, Dreyer B, Guldvik IJ, Outzen H, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18248330", "url": "https://glygen.org/publication/PubMed/18248330" } ] }, { "title": "Angiopoietin-1 promotes endothelial cell proliferation and migration through AP-1-dependent autocrine production of interleukin-8.", "journal": "Blood", "date": "2008", "authors": "Abdel-Malak NA, Srikant CB, Kristof AS, Magder SA, Di Battista JA, Hussain SN", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18252863", "url": "https://glygen.org/publication/PubMed/18252863" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.", "journal": "Cell", "date": "2008", "authors": "Wajapeyee N, Serra RW, Zhu X, Mahalingam M, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18267069", "url": "https://glygen.org/publication/PubMed/18267069" } ] }, { "title": "TAN-1, the human homolog of the Drosophila notch gene, is broken by chromosomal translocations in T lymphoblastic neoplasms.", "journal": "Cell", "date": "1991", "authors": "Ellisen LW, Bird J, West DC, Soreng AL, Reynolds TC, Smith SD, Sklar J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "1831692", "url": "https://glygen.org/publication/PubMed/1831692" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "Identification of a conserved Rac-binding site on NADPH oxidases supports a direct GTPase regulatory mechanism.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kao YY, Gianni D, Bohl B, Taylor RM, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "18347018", "url": "https://glygen.org/publication/PubMed/18347018" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "p16(INK4a) translation suppressed by miR-24.", "journal": "PloS one", "date": "2008", "authors": "Lal A, Kim HH, Abdelmohsen K, Kuwano Y, Pullmann R Jr, Srikantan S, Subrahmanyam R, Martindale JL, Yang X, Ahmed F, Navarro F, Dykxhoorn D, Lieberman J, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18365017", "url": "https://glygen.org/publication/PubMed/18365017" } ] }, { "title": "Transrepressive function of TLX requires the histone demethylase LSD1.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Yokoyama A, Takezawa S, Schule R, Kitagawa H, Kato S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18391013", "url": "https://glygen.org/publication/PubMed/18391013" } ] }, { "title": "Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartupee J, Li X, Hamilton T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18411265", "url": "https://glygen.org/publication/PubMed/18411265" } ] }, { "title": "Pin1 promotes cell death in NGF-dependent neurons through a mechanism requiring c-Jun activity.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Barone MC, Desouza LA, Freeman RS", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18419764", "url": "https://glygen.org/publication/PubMed/18419764" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Regulation of growth factor signaling by FRS2 family docking/scaffold adaptor proteins.", "journal": "Cancer science", "date": "2008", "authors": "Gotoh N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18452557", "url": "https://glygen.org/publication/PubMed/18452557" } ] }, { "title": "Activation of protein kinase C decreases phosphorylation of c-Jun at sites that negatively regulate its DNA-binding activity.", "journal": "Cell", "date": "1991", "authors": "Boyle WJ, Smeal T, Defize LH, Angel P, Woodgett JR, Karin M, Hunter T", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "SALL4 is a key regulator of survival and apoptosis in human leukemic cells.", "journal": "Blood", "date": "2008", "authors": "Yang J, Chai L, Gao C, Fowles TC, Alipio Z, Dang H, Xu D, Fink LM, Ward DC, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18487508", "url": "https://glygen.org/publication/PubMed/18487508" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "Chemokine signaling via the CXCR2 receptor reinforces senescence.", "journal": "Cell", "date": "2008", "authors": "Acosta JC, O'Loghlen A, Banito A, Guijarro MV, Augert A, Raguz S, Fumagalli M, Da Costa M, Brown C, Popov N, Takatsu Y, Melamed J, d'Adda di Fagagna F, Bernard D, Hernando E, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555777", "url": "https://glygen.org/publication/PubMed/18555777" } ] }, { "title": "Oncogene-induced senescence relayed by an interleukin-dependent inflammatory network.", "journal": "Cell", "date": "2008", "authors": "Kuilman T, Michaloglou C, Vredeveld LC, Douma S, van Doorn R, Desmet CJ, Aarden LA, Mooi WJ, Peeper DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555778", "url": "https://glygen.org/publication/PubMed/18555778" } ] }, { "title": "Identification of novel isoforms of the EML4-ALK transforming gene in non-small cell lung cancer.", "journal": "Cancer research", "date": "2008", "authors": "Choi YL, Takeuchi K, Soda M, Inamura K, Togashi Y, Hatano S, Enomoto M, Hamada T, Haruta H, Watanabe H, Kurashina K, Hatanaka H, Ueno T, Takada S, Yamashita Y, Sugiyama Y, Ishikawa Y, Mano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18593892", "url": "https://glygen.org/publication/PubMed/18593892" } ] }, { "title": "Steroid receptor coactivator-3/AIB1 promotes cell migration and invasiveness through focal adhesion turnover and matrix metalloproteinase expression.", "journal": "Cancer research", "date": "2008", "authors": "Yan J, Erdem H, Li R, Cai Y, Ayala G, Ittmann M, Yu-Lee LY, Tsai SY, Tsai MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18593949", "url": "https://glygen.org/publication/PubMed/18593949" } ] }, { "title": "EML4-ALK fusion gene and efficacy of an ALK kinase inhibitor in lung cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2008", "authors": "Koivunen JP, Mermel C, Zejnullahu K, Murphy C, Lifshits E, Holmes AJ, Choi HG, Kim J, Chiang D, Thomas R, Lee J, Richards WG, Sugarbaker DJ, Ducko C, Lindeman N, Marcoux JP, Engelman JA, Gray NS, Lee C, Meyerson M, Janne PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18594010", "url": "https://glygen.org/publication/PubMed/18594010" } ] }, { "title": "The AIB1 oncogene promotes breast cancer metastasis by activation of PEA3-mediated matrix metalloproteinase 2 (MMP2) and MMP9 expression.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Qin L, Liao L, Redmond A, Young L, Yuan Y, Chen H, O'Malley BW, Xu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18644862", "url": "https://glygen.org/publication/PubMed/18644862" } ] }, { "title": "Activation of Polo-like kinase 3 by hypoxic stresses.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wang L, Gao J, Dai W, Lu L", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18650425", "url": "https://glygen.org/publication/PubMed/18650425" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Deregulated Cdk5 promotes oxidative stress and mitochondrial dysfunction.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Sun KH, de Pablo Y, Vincent F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "18691386", "url": "https://glygen.org/publication/PubMed/18691386" } ] }, { "title": "An inflammatory myofibroblastic tumor in liver with ALK and RANBP2 gene rearrangement: combination of distinct morphologic, immunohistochemical, and genetic features.", "journal": "Human pathology", "date": "2008", "authors": "Chen ST, Lee JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18701132", "url": "https://glygen.org/publication/PubMed/18701132" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Mammalian Rho GTPases: new insights into their functions from in vivo studies.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Heasman SJ, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "18719708", "url": "https://glygen.org/publication/PubMed/18719708" } ] }, { "title": "Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5.", "journal": "Journal of cellular physiology", "date": "2008", "authors": "Deleris P, Rousseau J, Coulombe P, Rodier G, Tanguay PL, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18720373", "url": "https://glygen.org/publication/PubMed/18720373" } ] }, { "title": "Identification of ALK as a major familial neuroblastoma predisposition gene.", "journal": "Nature", "date": "2008", "authors": "Mosse YP, Laudenslager M, Longo L, Cole KA, Wood A, Attiyeh EF, Laquaglia MJ, Sennett R, Lynch JE, Perri P, Laureys G, Speleman F, Kim C, Hou C, Hakonarson H, Torkamani A, Schork NJ, Brodeur GM, Tonini GP, Rappaport E, Devoto M, Maris JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18724359", "url": "https://glygen.org/publication/PubMed/18724359" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Yekta S, Tabin CJ, Bartel DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "18781158", "url": "https://glygen.org/publication/PubMed/18781158" } ] }, { "title": "c-Jun expression, activation and function in neural cell death, inflammation and repair.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Raivich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" } ] }, { "title": "1-Methyl-4-phenyl-pyridinium ion-induced oxidative stress, c-Jun phosphorylation and DNA fragmentation factor-45 cleavage in SK-N-SH cells are averted by selegiline.", "journal": "Neurochemistry international", "date": "2008", "authors": "Chetsawang B, Kooncumchoo P, Govitrapong P, Ebadi M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18805449", "url": "https://glygen.org/publication/PubMed/18805449" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "NDRG2 suppresses cell proliferation through down-regulation of AP-1 activity in human colon carcinoma cells.", "journal": "International journal of cancer", "date": "2009", "authors": "Kim YJ, Yoon SY, Kim JT, Choi SC, Lim JS, Kim JH, Song EY, Lee HG, Choi I, Kim JW", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "18844221", "url": "https://glygen.org/publication/PubMed/18844221" } ] }, { "title": "Somatic and germline activating mutations of the ALK kinase receptor in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "Janoueix-Lerosey I, Lequin D, Brugieres L, Ribeiro A, de Pontual L, Combaret V, Raynal V, Puisieux A, Schleiermacher G, Pierron G, Valteau-Couanet D, Frebourg T, Michon J, Lyonnet S, Amiel J, Delattre O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18923523", "url": "https://glygen.org/publication/PubMed/18923523" } ] }, { "title": "Oncogenic mutations of ALK kinase in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "Chen Y, Takita J, Choi YL, Kato M, Ohira M, Sanada M, Wang L, Soda M, Kikuchi A, Igarashi T, Nakagawara A, Hayashi Y, Mano H, Ogawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18923524", "url": "https://glygen.org/publication/PubMed/18923524" } ] }, { "title": "Activating mutations in ALK provide a therapeutic target in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "George RE, Sanda T, Hanna M, Frohling S, Luther W 2nd, Zhang J, Ahn Y, Zhou W, London WB, McGrady P, Xue L, Zozulya S, Gregor VE, Webb TR, Gray NS, Gilliland DG, Diller L, Greulich H, Morris SW, Meyerson M, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18923525", "url": "https://glygen.org/publication/PubMed/18923525" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.", "journal": "Journal of cellular biochemistry", "date": "2009", "authors": "Fernandez CC, Gudas LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19115252", "url": "https://glygen.org/publication/PubMed/19115252" } ] }, { "title": "Cyclin-dependent kinase-3-mediated c-Jun phosphorylation at Ser63 and Ser73 enhances cell transformation.", "journal": "Cancer research", "date": "2009", "authors": "Cho YY, Tang F, Yao K, Lu C, Zhu F, Zheng D, Pugliese A, Bode AM, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19118012", "url": "https://glygen.org/publication/PubMed/19118012" } ] }, { "title": "p21-activated kinase regulates mast cell degranulation via effects on calcium mobilization and cytoskeletal dynamics.", "journal": "Blood", "date": "2009", "authors": "Allen JD, Jaffer ZM, Park SJ, Burgin S, Hofmann C, Sells MA, Chen S, Derr-Yellin E, Michels EG, McDaniel A, Bessler WK, Ingram DA, Atkinson SJ, Travers JB, Chernoff J, Clapp DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19124833", "url": "https://glygen.org/publication/PubMed/19124833" } ] }, { "title": "NOTCH3 expression is induced in mural cells through an autoregulatory loop that requires endothelial-expressed JAGGED1.", "journal": "Circulation research", "date": "2009", "authors": "Liu H, Kennard S, Lilly B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19150886", "url": "https://glygen.org/publication/PubMed/19150886" } ] }, { "title": "PKA-induced F-actin rearrangement requires phosphorylation of Hsp27 by the MAPKAP kinase MK5.", "journal": "Cellular signalling", "date": "2009", "authors": "Kostenko S, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19166925", "url": "https://glygen.org/publication/PubMed/19166925" } ] }, { "title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.", "journal": "BMC molecular biology", "date": "2009", "authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19232136", "url": "https://glygen.org/publication/PubMed/19232136" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "Wnt/Fz signaling and the cytoskeleton: potential roles in tumorigenesis.", "journal": "Cell research", "date": "2009", "authors": "Lai SL, Chien AJ, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "19365405", "url": "https://glygen.org/publication/PubMed/19365405" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Stem cell factor SALL4 represses the transcriptions of PTEN and SALL1 through an epigenetic repressor complex.", "journal": "PloS one", "date": "2009", "authors": "Lu J, Jeong HW, Kong N, Yang Y, Carroll J, Luo HR, Silberstein LE, Yupoma, Chai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "19440552", "url": "https://glygen.org/publication/PubMed/19440552" } ] }, { "title": "The H3K27me3 demethylase JMJD3 contributes to the activation of the INK4A-ARF locus in response to oncogene- and stress-induced senescence.", "journal": "Genes & development", "date": "2009", "authors": "Agger K, Cloos PA, Rudkjaer L, Williams K, Andersen G, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451217", "url": "https://glygen.org/publication/PubMed/19451217" } ] }, { "title": "Histone demethylase JMJD3 contributes to epigenetic control of INK4a/ARF by oncogenic RAS.", "journal": "Genes & development", "date": "2009", "authors": "Barradas M, Anderton E, Acosta JC, Li S, Banito A, Rodriguez-Niedenfuhr M, Maertens G, Banck M, Zhou MM, Walsh MJ, Peters G, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451218", "url": "https://glygen.org/publication/PubMed/19451218" } ] }, { "title": "The FRS2 family of docking/scaffolding adaptor proteins as therapeutic targets of cancer treatment.", "journal": "Expert opinion on therapeutic targets", "date": "2009", "authors": "Sato T, Gotoh N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "19456272", "url": "https://glygen.org/publication/PubMed/19456272" } ] }, { "title": "Anaplastic lymphoma kinase: signalling in development and disease.", "journal": "The Biochemical journal", "date": "2009", "authors": "Palmer RH, Vernersson E, Grabbe C, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "19459784", "url": "https://glygen.org/publication/PubMed/19459784" } ] }, { "title": "Polycomb mediated epigenetic silencing and replication timing at the INK4a/ARF locus during senescence.", "journal": "PloS one", "date": "2009", "authors": "Agherbi H, Gaussmann-Wenger A, Verthuy C, Chasson L, Serrano M, Djabali M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19462008", "url": "https://glygen.org/publication/PubMed/19462008" } ] }, { "title": "Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Aberg E, Torgersen KM, Johansen B, Keyse SM, Perander M, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19473979", "url": "https://glygen.org/publication/PubMed/19473979" } ] }, { "title": "Involvement of Rac/Cdc42/PAK pathway in cytoskeletal rearrangements.", "journal": "Acta biochimica Polonica", "date": "2009", "authors": "Szczepanowska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19513348", "url": "https://glygen.org/publication/PubMed/19513348" } ] }, { "title": "Mitochondrial dysfunction contributes to oncogene-induced senescence.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Moiseeva O, Bourdeau V, Roux A, Deschenes-Simard X, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19528227", "url": "https://glygen.org/publication/PubMed/19528227" } ] }, { "title": "Protein kinase phosphorylation site sequences and consensus specificity motifs: tabulations.", "journal": "Methods in enzymology", "date": "1991", "authors": "Pearson RB, Kemp BE", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "1956339", "url": "https://glygen.org/publication/PubMed/1956339" } ] }, { "title": "Dissecting activation of the PAK1 kinase at protrusions in living cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Parrini MC, Camonis J, Matsuda M, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19574218", "url": "https://glygen.org/publication/PubMed/19574218" } ] }, { "title": "SLP-76 couples Syk to the osteoclast cytoskeleton.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Reeve JL, Zou W, Liu Y, Maltzman JS, Ross FP, Teitelbaum SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19592646", "url": "https://glygen.org/publication/PubMed/19592646" } ] }, { "title": "Heat shock protein 27 phosphorylation: kinases, phosphatases, functions and pathology.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Kostenko S, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19593530", "url": "https://glygen.org/publication/PubMed/19593530" } ] }, { "title": "Mammalian sterile 20-like kinase 3 (MST3) mediates oxidative-stress-induced cell death by modulating JNK activation.", "journal": "Bioscience reports", "date": "2009", "authors": "Chen CB, Ng JK, Choo PH, Wu W, Porter AG", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19604147", "url": "https://glygen.org/publication/PubMed/19604147" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "MicroRNA miR-34 inhibits human pancreatic cancer tumor-initiating cells.", "journal": "PloS one", "date": "2009", "authors": "Ji Q, Hao X, Zhang M, Tang W, Yang M, Li L, Xiang D, Desano JT, Bommer GT, Fan D, Fearon ER, Lawrence TS, Xu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19714243", "url": "https://glygen.org/publication/PubMed/19714243" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "MicroRNA-206 targets notch3, activates apoptosis, and inhibits tumor cell migration and focus formation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Song G, Zhang Y, Wang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19723635", "url": "https://glygen.org/publication/PubMed/19723635" } ] }, { "title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.", "journal": "Gastroenterology", "date": "2009", "authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19747919", "url": "https://glygen.org/publication/PubMed/19747919" } ] }, { "title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.", "journal": "Nature", "date": "1990", "authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1975088", "url": "https://glygen.org/publication/PubMed/1975088" } ] }, { "title": "MicroRNA-34a inhibits glioblastoma growth by targeting multiple oncogenes.", "journal": "Cancer research", "date": "2009", "authors": "Li Y, Guessous F, Zhang Y, Dipierro C, Kefas B, Johnson E, Marcinkiewicz L, Jiang J, Yang Y, Schmittgen TD, Lopes B, Schiff D, Purow B, Abounader R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19773441", "url": "https://glygen.org/publication/PubMed/19773441" } ] }, { "title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.", "journal": "Molecular cell", "date": "2009", "authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19782034", "url": "https://glygen.org/publication/PubMed/19782034" } ] }, { "title": "Cell surface-bound IL-1alpha is an upstream regulator of the senescence-associated IL-6/IL-8 cytokine network.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Orjalo AV, Bhaumik D, Gengler BK, Scott GK, Campisi J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "19805069", "url": "https://glygen.org/publication/PubMed/19805069" } ] }, { "title": "Basal cancer cell survival involves JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network.", "journal": "PloS one", "date": "2009", "authors": "Ahmed SU, Milner J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19806201", "url": "https://glygen.org/publication/PubMed/19806201" } ] }, { "title": "Tyrosine 170 is dispensable for c-Jun turnover.", "journal": "Cellular signalling", "date": "2010", "authors": "Xie M, Sabapathy K", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19818398", "url": "https://glygen.org/publication/PubMed/19818398" } ] }, { "title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.", "journal": "Molecular cell", "date": "2009", "authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19854132", "url": "https://glygen.org/publication/PubMed/19854132" } ] }, { "title": "LMP1-augmented kappa intron enhancer activity contributes to upregulation expression of Ig kappa light chain via NF-kappaB and AP-1 pathways in nasopharyngeal carcinoma cells.", "journal": "Molecular cancer", "date": "2009", "authors": "Liu H, Zheng H, Duan Z, Hu D, Li M, Liu S, Li Z, Deng X, Wang Z, Tang M, Shi Y, Yi W, Cao Y", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19860880", "url": "https://glygen.org/publication/PubMed/19860880" } ] }, { "title": "The polycomb group protein Bmi-1 represses the tumor suppressor PTEN and induces epithelial-mesenchymal transition in human nasopharyngeal epithelial cells.", "journal": "The Journal of clinical investigation", "date": "2009", "authors": "Song LB, Li J, Liao WT, Feng Y, Yu CP, Hu LJ, Kong QL, Xu LH, Zhang X, Liu WL, Li MZ, Zhang L, Kang TB, Fu LW, Huang WL, Xia YF, Tsao SW, Li M, Band V, Band H, Shi QH, Zeng YX, Zeng MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "19884659", "url": "https://glygen.org/publication/PubMed/19884659" } ] }, { "title": "Adapters in the organization of mast cell signaling.", "journal": "Immunological reviews", "date": "2009", "authors": "Alvarez-Errico D, Lessmann E, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19909365", "url": "https://glygen.org/publication/PubMed/19909365" } ] }, { "title": "Activation of c-Jun in the nuclei of neurons of the CA-1 in thrombin preconditioning occurs via PAR-1.", "journal": "Journal of neuroscience research", "date": "2010", "authors": "Price M, Badaut J, Thevenet J, Hirt L", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "19937805", "url": "https://glygen.org/publication/PubMed/19937805" } ] }, { "title": "Dishevelled: The hub of Wnt signaling.", "journal": "Cellular signalling", "date": "2010", "authors": "Gao C, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "20006983", "url": "https://glygen.org/publication/PubMed/20006983" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Involvement of epigenetically silenced microRNA-181c in gastric carcinogenesis.", "journal": "Carcinogenesis", "date": "2010", "authors": "Hashimoto Y, Akiyama Y, Otsubo T, Shimada S, Yuasa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20080834", "url": "https://glygen.org/publication/PubMed/20080834" } ] }, { "title": "Induced overexpression of protein kinase D1 stimulates mitogenic signaling in human pancreatic carcinoma PANC-1 cells.", "journal": "Journal of cellular physiology", "date": "2010", "authors": "Kisfalvi K, Hurd C, Guha S, Rozengurt E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20082306", "url": "https://glygen.org/publication/PubMed/20082306" } ] }, { "title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.", "journal": "FEBS letters", "date": "2010", "authors": "Yates JA, Menon T, Thompson BA, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "20085832", "url": "https://glygen.org/publication/PubMed/20085832" } ] }, { "title": "Transcriptional role of cyclin D1 in development revealed by a genetic-proteomic screen.", "journal": "Nature", "date": "2010", "authors": "Bienvenu F, Jirawatnotai S, Elias JE, Meyer CA, Mizeracka K, Marson A, Frampton GM, Cole MF, Odom DT, Odajima J, Geng Y, Zagozdzon A, Jecrois M, Young RA, Liu XS, Cepko CL, Gygi SP, Sicinski P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20090754", "url": "https://glygen.org/publication/PubMed/20090754" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Requirement of the mTOR kinase for the regulation of Maf1 phosphorylation and control of RNA polymerase III-dependent transcription in cancer cells.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Shor B, Wu J, Shakey Q, Toral-Barza L, Shi C, Follettie M, Yu K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "20233713", "url": "https://glygen.org/publication/PubMed/20233713" } ] }, { "title": "C-terminal domain phosphorylation of ERK3 controlled by Cdk1 and Cdc14 regulates its stability in mitosis.", "journal": "The Biochemical journal", "date": "2010", "authors": "Tanguay PL, Rodier G, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20236090", "url": "https://glygen.org/publication/PubMed/20236090" } ] }, { "title": "MicroRNA-34a suppresses invasion through downregulation of Notch1 and Jagged1 in cervical carcinoma and choriocarcinoma cells.", "journal": "Carcinogenesis", "date": "2010", "authors": "Pang RT, Leung CO, Ye TM, Liu W, Chiu PC, Lam KK, Lee KF, Yeung WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20351093", "url": "https://glygen.org/publication/PubMed/20351093" } ] }, { "title": "RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Lee S, Shuman JD, Guszczynski T, Sakchaisri K, Sebastian T, Copeland TD, Miller M, Cohen MS, Taunton J, Smart RC, Xiao Z, Yu LR, Veenstra TD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20351173", "url": "https://glygen.org/publication/PubMed/20351173" } ] }, { "title": "Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer.", "journal": "Cancer research", "date": "2010", "authors": "Xu YM, Zhu F, Cho YY, Carper A, Peng C, Zheng D, Yao K, Lau AT, Zykova TA, Kim HG, Bode AM, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20395206", "url": "https://glygen.org/publication/PubMed/20395206" } ] }, { "title": "DeltaNp63alpha repression of the Notch1 gene supports the proliferative capacity of normal human keratinocytes and cervical cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Yugawa T, Narisawa-Saito M, Yoshimatsu Y, Haga K, Ohno S, Egawa N, Fujita M, Kiyono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442293", "url": "https://glygen.org/publication/PubMed/20442293" } ] }, { "title": "Differential control of Notch1 gene transcription by Klf4 and Sp3 transcription factors in normal versus cancer-derived keratinocytes.", "journal": "PloS one", "date": "2010", "authors": "Lambertini C, Pantano S, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442780", "url": "https://glygen.org/publication/PubMed/20442780" } ] }, { "title": "CCAAT/Enhancer-binding protein beta DNA binding is auto-inhibited by multiple elements that also mediate association with p300/CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lee S, Miller M, Shuman JD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20452968", "url": "https://glygen.org/publication/PubMed/20452968" } ] }, { "title": "Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2.", "journal": "Journal of structural and functional genomics", "date": "2010", "authors": "Koshiba S, Li H, Motoda Y, Tomizawa T, Kasai T, Tochio N, Yabuki T, Harada T, Watanabe S, Tanaka A, Shirouzu M, Kigawa T, Yamamoto T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "20454865", "url": "https://glygen.org/publication/PubMed/20454865" } ] }, { "title": "Ror2/Frizzled complex mediates Wnt5a-induced AP-1 activation by regulating Dishevelled polymerization.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Nishita M, Itsukushima S, Nomachi A, Endo M, Wang Z, Inaba D, Qiao S, Takada S, Kikuchi A, Minami Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "20457807", "url": "https://glygen.org/publication/PubMed/20457807" } ] }, { "title": "BEX2 has a functional interplay with c-Jun/JNK and p65/RelA in breast cancer.", "journal": "Molecular cancer", "date": "2010", "authors": "Naderi A, Liu J, Hughes-Davies L", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20482821", "url": "https://glygen.org/publication/PubMed/20482821" } ] }, { "title": "SP600125, an inhibitor of c-Jun NH2-terminal kinase, blocks expression of angiotensin II-induced monocyte chemoattractant protein-1 in human mesangial cells.", "journal": "World journal of pediatrics : WJP", "date": "2010", "authors": "Ding GX, Zhang AH, Huang SM, Pan XQ, Chen RH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20490773", "url": "https://glygen.org/publication/PubMed/20490773" } ] }, { "title": "Epigenetically reprogramming metastatic tumor cells with an embryonic microenvironment.", "journal": "Epigenomics", "date": "2009", "authors": "Costa FF, Seftor EA, Bischof JM, Kirschmann DA, Strizzi L, Arndt K, Bonaldo Mde F, Soares MB, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20495621", "url": "https://glygen.org/publication/PubMed/20495621" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "mTORC1 directly phosphorylates and regulates human MAF1.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Michels AA, Robitaille AM, Buczynski-Ruchonnet D, Hodroj W, Reina JH, Hall MN, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "20516213", "url": "https://glygen.org/publication/PubMed/20516213" } ] }, { "title": "HSPB1, actin filament dynamics, and aging cells.", "journal": "Annals of the New York Academy of Sciences", "date": "2010", "authors": "Doshi BM, Hightower LE, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20536836", "url": "https://glygen.org/publication/PubMed/20536836" } ] }, { "title": "A global network of transcription factors, involving E2A, EBF1 and Foxo1, that orchestrates B cell fate.", "journal": "Nature immunology", "date": "2010", "authors": "Lin YC, Jhunjhunwala S, Benner C, Heinz S, Welinder E, Mansson R, Sigvardsson M, Hagman J, Espinoza CA, Dutkowski J, Ideker T, Glass CK, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20543837", "url": "https://glygen.org/publication/PubMed/20543837" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "Serine residue 115 of MAPK-activated protein kinase MK5 is crucial for its PKA-regulated nuclear export and biological function.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kostenko S, Shiryaev A, Gerits N, Dumitriu G, Klenow H, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20734105", "url": "https://glygen.org/publication/PubMed/20734105" } ] }, { "title": "NOTCH1 and NOTCH3 coordinate esophageal squamous differentiation through a CSL-dependent transcriptional network.", "journal": "Gastroenterology", "date": "2010", "authors": "Ohashi S, Natsuizaka M, Yashiro-Ohtani Y, Kalman RA, Nakagawa M, Wu L, Klein-Szanto AJ, Herlyn M, Diehl JA, Katz JP, Pear WS, Seykora JT, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20801121", "url": "https://glygen.org/publication/PubMed/20801121" } ] }, { "title": "Epithelial to mesenchymal transition is mechanistically linked with stem cell signatures in prostate cancer cells.", "journal": "PloS one", "date": "2010", "authors": "Kong D, Banerjee S, Ahmad A, Li Y, Wang Z, Sethi S, Sarkar FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20805998", "url": "https://glygen.org/publication/PubMed/20805998" } ] }, { "title": "Evidence that glycogen synthase kinase-3 isoforms have distinct substrate preference in the brain.", "journal": "Journal of neurochemistry", "date": "2010", "authors": "Soutar MP, Kim WY, Williamson R, Peggie M, Hastie CJ, McLauchlan H, Snider WD, Gordon-Weeks PR, Sutherland C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "20831597", "url": "https://glygen.org/publication/PubMed/20831597" } ] }, { "title": "Cross-talk between protein kinase A and the MAPK-activated protein kinases RSK1 and MK5.", "journal": "Journal of receptor and signal transduction research", "date": "2011", "authors": "Kostenko S, Shiryaev A, Dumitriu G, Gerits N, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20849292", "url": "https://glygen.org/publication/PubMed/20849292" } ] }, { "title": "Identification of a co-activator that links growth factor signalling to c-Jun/AP-1 activation.", "journal": "Nat. Cell Biol.", "date": "2010", "authors": "Davies CC, Chakraborty A, Cipriani F, Haigh K, Haigh JJ, Behrens A", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "20852630", "url": "https://glygen.org/publication/PubMed/20852630" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "Identification of a novel fusion, SQSTM1-ALK, in ALK-positive large B-cell lymphoma.", "journal": "Haematologica", "date": "2011", "authors": "Takeuchi K, Soda M, Togashi Y, Ota Y, Sekiguchi Y, Hatano S, Asaka R, Noguchi M, Mano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21134980", "url": "https://glygen.org/publication/PubMed/21134980" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Epithelioid inflammatory myofibroblastic sarcoma: An aggressive intra-abdominal variant of inflammatory myofibroblastic tumor with nuclear membrane or perinuclear ALK.", "journal": "The American journal of surgical pathology", "date": "2011", "authors": "Marino-Enriquez A, Wang WL, Roy A, Lopez-Terrada D, Lazar AJ, Fletcher CD, Coffin CM, Hornick JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21164297", "url": "https://glygen.org/publication/PubMed/21164297" } ] }, { "title": "P21-activated protein kinase (PAK2)-mediated c-Jun phosphorylation at 5 threonine sites promotes cell transformation.", "journal": "Carcinogenesis", "date": "2011", "authors": "Li T, Zhang J, Zhu F, Wen W, Zykova T, Li X, Liu K, Peng C, Ma W, Shi G, Dong Z, Bode AM, Dong Z", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" } ] }, { "title": "Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Deleris P, Trost M, Topisirovic I, Tanguay PL, Borden KL, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21177870", "url": "https://glygen.org/publication/PubMed/21177870" } ] }, { "title": "ALK rearrangement in sickle cell trait-associated renal medullary carcinoma.", "journal": "Genes, chromosomes & cancer", "date": "2011", "authors": "Marino-Enriquez A, Ou WB, Weldon CB, Fletcher JA, Perez-Atayde AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21213368", "url": "https://glygen.org/publication/PubMed/21213368" } ] }, { "title": "Involvement of glycogen synthase kinase-3beta in arsenic trioxide-induced p21 expression.", "journal": "Toxicological sciences : an official journal of the Society of Toxicology", "date": "2011", "authors": "Huang HS, Liu ZM, Cheng YL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21278055", "url": "https://glygen.org/publication/PubMed/21278055" } ] }, { "title": "Kruppel-like family of transcription factor 9, a differentiation-associated transcription factor, suppresses Notch1 signaling and inhibits glioblastoma-initiating stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2011", "authors": "Ying M, Sang Y, Li Y, Guerrero-Cazares H, Quinones-Hinojosa A, Vescovi AL, Eberhart CG, Xia S, Laterra J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21280156", "url": "https://glygen.org/publication/PubMed/21280156" } ] }, { "title": "Evi1 represses PTEN expression and activates PI3K/AKT/mTOR via interactions with polycomb proteins.", "journal": "Blood", "date": "2011", "authors": "Yoshimi A, Goyama S, Watanabe-Okochi N, Yoshiki Y, Nannya Y, Nitta E, Arai S, Sato T, Shimabe M, Nakagawa M, Imai Y, Kitamura T, Kurokawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "21289308", "url": "https://glygen.org/publication/PubMed/21289308" } ] }, { "title": "COX-2 contributes to P-glycoprotein-mediated multidrug resistance via phosphorylation of c-Jun at Ser63/73 in colorectal cancer.", "journal": "Carcinogenesis", "date": "2011", "authors": "Sui H, Zhou S, Wang Y, Liu X, Zhou L, Yin P, Fan Z, Li Q", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21296766", "url": "https://glygen.org/publication/PubMed/21296766" } ] }, { "title": "Hyperosmotic stress-induced corneal epithelial cell death through activation of Polo-like kinase 3 and c-Jun.", "journal": "Investigative ophthalmology & visual science", "date": "2011", "authors": "Wang L, Dai W, Lu L", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21296815", "url": "https://glygen.org/publication/PubMed/21296815" } ] }, { "title": "Identification of the atypical MAPK Erk3 as a novel substrate for p21-activated kinase (Pak) activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "De la Mota-Peynado A, Chernoff J, Beeser A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21317288", "url": "https://glygen.org/publication/PubMed/21317288" } ] }, { "title": "More, more, more: downregulation of a MK5-FoxO3a-mir34b/c pathway further increases c-Myc levels in colorectal cancer.", "journal": "Molecular cell", "date": "2011", "authors": "Myant K, Sansom OJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329875", "url": "https://glygen.org/publication/PubMed/21329875" } ] }, { "title": "The MK5/PRAK kinase and Myc form a negative feedback loop that is disrupted during colorectal tumorigenesis.", "journal": "Molecular cell", "date": "2011", "authors": "Kress TR, Cannell IG, Brenkman AB, Samans B, Gaestel M, Roepman P, Burgering BM, Bushell M, Rosenwald A, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329882", "url": "https://glygen.org/publication/PubMed/21329882" } ] }, { "title": "Role of the JNK/c-Jun/AP-1 signaling pathway in galectin-1-induced T-cell death.", "journal": "Cell death & disease", "date": "2010", "authors": "Brandt B, Abou-Eladab EF, Tiedge M, Walzel H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21364631", "url": "https://glygen.org/publication/PubMed/21364631" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "Endothelial Jarid2/Jumonji is required for normal cardiac development and proper Notch1 expression.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mysliwiec MR, Bresnick EH, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21402699", "url": "https://glygen.org/publication/PubMed/21402699" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Role of ERK-BIM and STAT3-survivin signaling pathways in ALK inhibitor-induced apoptosis in EML4-ALK-positive lung cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Takezawa K, Okamoto I, Nishio K, Janne PA, Nakagawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21415216", "url": "https://glygen.org/publication/PubMed/21415216" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Inhibition of anaplastic lymphoma kinase (ALK) activity provides a therapeutic approach for CLTC-ALK-positive human diffuse large B cell lymphomas.", "journal": "PloS one", "date": "2011", "authors": "Cerchietti L, Damm-Welk C, Vater I, Klapper W, Harder L, Pott C, Yang SN, Reiter A, Siebert R, Melnick A, Woessmann W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21494621", "url": "https://glygen.org/publication/PubMed/21494621" } ] }, { "title": "Modulation of microRNA expression in human T-cell development: targeting of NOTCH3 by miR-150.", "journal": "Blood", "date": "2011", "authors": "Ghisi M, Corradin A, Basso K, Frasson C, Serafin V, Mukherjee S, Mussolin L, Ruggero K, Bonanno L, Guffanti A, De Bellis G, Gerosa G, Stellin G, D'Agostino DM, Basso G, Bronte V, Indraccolo S, Amadori A, Zanovello P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21551231", "url": "https://glygen.org/publication/PubMed/21551231" } ] }, { "title": "CDK-mediated regulation of cell functions via c-Jun phosphorylation and AP-1 activation.", "journal": "PloS one", "date": "2011", "authors": "Vanden Bush TJ, Bishop GA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21559334", "url": "https://glygen.org/publication/PubMed/21559334" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Anaplastic thyroid cancers harbor novel oncogenic mutations of the ALK gene.", "journal": "Cancer research", "date": "2011", "authors": "Murugan AK, Xing M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21596819", "url": "https://glygen.org/publication/PubMed/21596819" } ] }, { "title": "Control of vertebrate multiciliogenesis by miR-449 through direct repression of the Delta/Notch pathway.", "journal": "Nature cell biology", "date": "2011", "authors": "Marcet B, Chevalier B, Luxardi G, Coraux C, Zaragosi LE, Cibois M, Robbe-Sermesant K, Jolly T, Cardinaud B, Moreilhon C, Giovannini-Chami L, Nawrocki-Raby B, Birembaut P, Waldmann R, Kodjabachian L, Barbry P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21602795", "url": "https://glygen.org/publication/PubMed/21602795" } ] }, { "title": "AP-1 is a component of the transcriptional network regulated by GSK-3 in quiescent cells.", "journal": "PloS one", "date": "2011", "authors": "Tullai JW, Tacheva S, Owens LJ, Graham JR, Cooper GM", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21647439", "url": "https://glygen.org/publication/PubMed/21647439" } ] }, { "title": "A novel KIF5B-ALK variant in nonsmall cell lung cancer.", "journal": "Cancer", "date": "2011", "authors": "Wong DW, Leung EL, Wong SK, Tin VP, Sihoe AD, Cheng LC, Au JS, Chung LP, Wong MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21656749", "url": "https://glygen.org/publication/PubMed/21656749" } ] }, { "title": "Genetic framework for GATA factor function in vascular biology.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Linnemann AK, O'Geen H, Keles S, Farnham PJ, Bresnick EH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21808000", "url": "https://glygen.org/publication/PubMed/21808000" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Activation of interleukin-6 gene expression through the NF-kappa B transcription factor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Libermann TA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2183031", "url": "https://glygen.org/publication/PubMed/2183031" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Activating ALK mutations found in neuroblastoma are inhibited by Crizotinib and NVP-TAE684.", "journal": "The Biochemical journal", "date": "2011", "authors": "Schonherr C, Ruuth K, Yamazaki Y, Eriksson T, Christensen J, Palmer RH, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21838707", "url": "https://glygen.org/publication/PubMed/21838707" } ] }, { "title": "Identification of oncogenic point mutations and hyperphosphorylation of anaplastic lymphoma kinase in lung cancer.", "journal": "Neoplasia (New York, N.Y.)", "date": "2011", "authors": "Wang YW, Tu PH, Lin KT, Lin SC, Ko JY, Jou YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21847362", "url": "https://glygen.org/publication/PubMed/21847362" } ] }, { "title": "Macrophage-elicited loss of estrogen receptor-alpha in breast cancer cells via involvement of MAPK and c-Jun at the ESR1 genomic locus.", "journal": "Oncogene", "date": "2012", "authors": "Stossi F, Madak-Erdogan Z, Katzenellenbogen BS", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "21860415", "url": "https://glygen.org/publication/PubMed/21860415" } ] }, { "title": "Notch signaling inhibits hepatocellular carcinoma following inactivation of the RB pathway.", "journal": "The Journal of experimental medicine", "date": "2011", "authors": "Viatour P, Ehmer U, Saddic LA, Dorrell C, Andersen JB, Lin C, Zmoos AF, Mazur PK, Schaffer BE, Ostermeier A, Vogel H, Sylvester KG, Thorgeirsson SS, Grompe M, Sage J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21875955", "url": "https://glygen.org/publication/PubMed/21875955" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Control of the senescence-associated secretory phenotype by NF-kappaB promotes senescence and enhances chemosensitivity.", "journal": "Genes & development", "date": "2011", "authors": "Chien Y, Scuoppo C, Wang X, Fang X, Balgley B, Bolden JE, Premsrirut P, Luo W, Chicas A, Lee CS, Kogan SC, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "21979375", "url": "https://glygen.org/publication/PubMed/21979375" } ] }, { "title": "Regulation of MDM2 E3 ligase activity by phosphorylation after DNA damage.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Cheng Q, Cross B, Li B, Chen L, Li Z, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "21986495", "url": "https://glygen.org/publication/PubMed/21986495" } ] }, { "title": "The Cyclin K/Cdk12 complex maintains genomic stability via regulation of expression of DNA damage response genes.", "journal": "Genes & development", "date": "2011", "authors": "Blazek D, Kohoutek J, Bartholomeeusen K, Johansen E, Hulinkova P, Luo Z, Cimermancic P, Ule J, Peterlin BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "22012619", "url": "https://glygen.org/publication/PubMed/22012619" } ] }, { "title": "Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.", "journal": "Oncogene", "date": "2012", "authors": "Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22020331", "url": "https://glygen.org/publication/PubMed/22020331" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Global analysis of gene expression in NGF-deprived sympathetic neurons identifies molecular pathways associated with cell death.", "journal": "BMC genomics", "date": "2011", "authors": "Kristiansen M, Menghi F, Hughes R, Hubank M, Ham J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22067274", "url": "https://glygen.org/publication/PubMed/22067274" } ] }, { "title": "The forkhead transcription factor FOXK2 promotes AP-1-mediated transcriptional regulation.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Ji Z, Donaldson IJ, Liu J, Hayes A, Zeef LA, Sharrocks AD", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "22083952", "url": "https://glygen.org/publication/PubMed/22083952" } ] }, { "title": "Jarid2 (Jumonji, AT rich interactive domain 2) regulates NOTCH1 expression via histone modification in the developing heart.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Mysliwiec MR, Carlson CD, Tietjen J, Hung H, Ansari AZ, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "22110129", "url": "https://glygen.org/publication/PubMed/22110129" } ] }, { "title": "Stem cell gene SALL4 suppresses transcription through recruitment of DNA methyltransferases.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Yang J, Corsello TR, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "22128185", "url": "https://glygen.org/publication/PubMed/22128185" } ] }, { "title": "DNA damage signaling triggers degradation of histone methyltransferases through APC/C(Cdh1) in senescent cells.", "journal": "Molecular cell", "date": "2012", "authors": "Takahashi A, Imai Y, Yamakoshi K, Kuninaka S, Ohtani N, Yoshimoto S, Hori S, Tachibana M, Anderton E, Takeuchi T, Shinkai Y, Peters G, Saya H, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22178396", "url": "https://glygen.org/publication/PubMed/22178396" } ] }, { "title": "Aberrant activation of ALK kinase by a novel truncated form ALK protein in neuroblastoma.", "journal": "Oncogene", "date": "2012", "authors": "Okubo J, Takita J, Chen Y, Oki K, Nishimura R, Kato M, Sanada M, Hiwatari M, Hayashi Y, Igarashi T, Ogawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22249260", "url": "https://glygen.org/publication/PubMed/22249260" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Inhibition of Gli1 results in altered c-Jun activation, inhibition of cisplatin-induced upregulation of ERCC1, XPD and XRCC1, and inhibition of platinum-DNA adduct repair.", "journal": "Oncogene", "date": "2012", "authors": "Kudo K, Gavin E, Das S, Amable L, Shevde LA, Reed E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22266871", "url": "https://glygen.org/publication/PubMed/22266871" } ] }, { "title": "A self-reinforcing regulatory network triggered by limiting IL-7 activates pre-BCR signaling and differentiation.", "journal": "Nature immunology", "date": "2012", "authors": "Ochiai K, Maienschein-Cline M, Mandal M, Triggs JR, Bertolino E, Sciammas R, Dinner AR, Clark MR, Singh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22267219", "url": "https://glygen.org/publication/PubMed/22267219" } ] }, { "title": "IGF2BP1 promotes cell migration by regulating MK5 and PTEN signaling.", "journal": "Genes & development", "date": "2012", "authors": "Stohr N, Kohn M, Lederer M, Glass M, Reinke C, Singer RH, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22279049", "url": "https://glygen.org/publication/PubMed/22279049" } ] }, { "title": "DYRK2 priming phosphorylation of c-Jun and c-Myc modulates cell cycle progression in human cancer cells.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Taira N, Mimoto R, Kurata M, Yamaguchi T, Kitagawa M, Miki Y, Yoshida K", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" } ] }, { "title": "PCGF homologs, CBX proteins, and RYBP define functionally distinct PRC1 family complexes.", "journal": "Molecular cell", "date": "2012", "authors": "Gao Z, Zhang J, Bonasio R, Strino F, Sawai A, Parisi F, Kluger Y, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22325352", "url": "https://glygen.org/publication/PubMed/22325352" } ] }, { "title": "Identification of new ALK and RET gene fusions from colorectal and lung cancer biopsies.", "journal": "Nature medicine", "date": "2012", "authors": "Lipson D, Capelletti M, Yelensky R, Otto G, Parker A, Jarosz M, Curran JA, Balasubramanian S, Bloom T, Brennan KW, Donahue A, Downing SR, Frampton GM, Garcia L, Juhn F, Mitchell KC, White E, White J, Zwirko Z, Peretz T, Nechushtan H, Soussan-Gutman L, Kim J, Sasaki H, Kim HR, Park SI, Ercan D, Sheehan CE, Ross JS, Cronin MT, Janne PA, Stephens PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22327622", "url": "https://glygen.org/publication/PubMed/22327622" } ] }, { "title": "Regulation of p14ARF expression by miR-24: a potential mechanism compromising the p53 response during retinoblastoma development.", "journal": "BMC cancer", "date": "2012", "authors": "To KH, Pajovic S, Gallie BL, Theriault BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22336108", "url": "https://glygen.org/publication/PubMed/22336108" } ] }, { "title": "KLC1-ALK: a novel fusion in lung cancer identified using a formalin-fixed paraffin-embedded tissue only.", "journal": "PloS one", "date": "2012", "authors": "Togashi Y, Soda M, Sakata S, Sugawara E, Hatano S, Asaka R, Nakajima T, Mano H, Takeuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22347464", "url": "https://glygen.org/publication/PubMed/22347464" } ] }, { "title": "Piclamilast inhibits the pro-apoptotic and anti-proliferative responses of A549 cells exposed to H(2)O(2) via mechanisms involving AP-1 activation.", "journal": "Free radical research", "date": "2012", "authors": "Mata M, Pallardo F, Morcillo EJ, Cortijo J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22360706", "url": "https://glygen.org/publication/PubMed/22360706" } ] }, { "title": "Pseudolaric acid B-driven phosphorylation of c-Jun impairs its role in stabilizing HIF-1alpha: a novel function-converter model.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2012", "authors": "Yu B, Li MH, Wang W, Wang YQ, Jiang Y, Yang SP, Yue JM, Ding J, Miao ZH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22406864", "url": "https://glygen.org/publication/PubMed/22406864" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Long W, Foulds CE, Qin J, Liu J, Ding C, Lonard DM, Solis LM, Wistuba II, Qin J, Tsai SY, Tsai MJ, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22505454", "url": "https://glygen.org/publication/PubMed/22505454" } ] }, { "title": "The extracellular signal-regulated kinase 3 (mitogen-activated protein kinase 6 [MAPK6])-MAPK-activated protein kinase 5 signaling complex regulates septin function and dendrite morphology.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Brand F, Schumacher S, Kant S, Menon MB, Simon R, Turgeon B, Britsch S, Meloche S, Gaestel M, Kotlyarov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22508986", "url": "https://glygen.org/publication/PubMed/22508986" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "The protein kinase C inhibitor, Ro-31-7459, is a potent activator of ERK and JNK MAP kinases in HUVECs and yet inhibits cyclic AMP-stimulated SOCS-3 gene induction through inactivation of the transcription factor c-Jun.", "journal": "Cellular signalling", "date": "2012", "authors": "Wiejak J, Dunlop J, Stoyle C, Lappin G, McIlroy A, Pediani JD, Gao S, Yarwood SJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22561846", "url": "https://glygen.org/publication/PubMed/22561846" } ] }, { "title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.", "journal": "Nature communications", "date": "2012", "authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22569366", "url": "https://glygen.org/publication/PubMed/22569366" } ] }, { "title": "Identification of anaplastic lymphoma kinase as a potential therapeutic target in ovarian cancer.", "journal": "Cancer research", "date": "2012", "authors": "Ren H, Tan ZP, Zhu X, Crosby K, Haack H, Ren JM, Beausoleil S, Moritz A, Innocenti G, Rush J, Zhang Y, Zhou XM, Gu TL, Yang YF, Comb MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22570254", "url": "https://glygen.org/publication/PubMed/22570254" } ] }, { "title": "A polymorphism in the upstream regulatory region of the interleukin-1alpha gene confers differential binding by transcription factors of the AP-1 family.", "journal": "Life sciences", "date": "2012", "authors": "Moerman-Herzog AM, Barger SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22634325", "url": "https://glygen.org/publication/PubMed/22634325" } ] }, { "title": "Fusion of dynactin 1 to anaplastic lymphoma kinase in inflammatory myofibroblastic tumor.", "journal": "Human pathology", "date": "2012", "authors": "Wang X, Krishnan C, Nguyen EP, Meyer KJ, Oliveira JL, Yang P, Yi ES, Erickson-Johnson MR, Yaszemski MJ, Maran A, Oliveira AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22658521", "url": "https://glygen.org/publication/PubMed/22658521" } ] }, { "title": "The mitochondrial pathway and reactive oxygen species are critical contributors to interferon-alpha/beta-mediated apoptosis in Ubp43-deficient hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Yim HY, Yang Y, Lim JS, Lee MS, Zhang DE, Kim KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22683641", "url": "https://glygen.org/publication/PubMed/22683641" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Li Q, Zhu F, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22705304", "url": "https://glygen.org/publication/PubMed/22705304" } ] }, { "title": "Tumour promoting and suppressing roles of the atypical MAP kinase signalling pathway ERK3/4-MK5.", "journal": "Journal of molecular signaling", "date": "2012", "authors": "Kostenko S, Dumitriu G, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22800433", "url": "https://glygen.org/publication/PubMed/22800433" } ] }, { "title": "Transcriptional regulation of PES1 expression by c-Jun in colon cancer.", "journal": "PloS one", "date": "2012", "authors": "Xie W, Feng Q, Su Y, Dong B, Wu J, Meng L, Qu L, Shou C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "22860098", "url": "https://glygen.org/publication/PubMed/22860098" } ] }, { "title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.", "journal": "PloS one", "date": "2012", "authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22879880", "url": "https://glygen.org/publication/PubMed/22879880" } ] }, { "title": "Deregulated Cdk5 triggers aberrant activation of cell cycle kinases and phosphatases inducing neuronal death.", "journal": "Journal of cell science", "date": "2012", "authors": "Chang KH, Vincent F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "22899714", "url": "https://glygen.org/publication/PubMed/22899714" } ] }, { "title": "Interaction of cyclin-dependent kinase 12/CrkRS with cyclin K1 is required for the phosphorylation of the C-terminal domain of RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Cheng SW, Kuzyk MA, Moradian A, Ichu TA, Chang VC, Tien JF, Vollett SE, Griffith M, Marra MA, Morin GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "22988298", "url": "https://glygen.org/publication/PubMed/22988298" } ] }, { "title": "Insulin-like growth factor 2 mRNA-binding proteins (IGF2BPs): post-transcriptional drivers of cancer progression?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2013", "authors": "Bell JL, Wachter K, Muhleck B, Pazaitis N, Kohn M, Lederer M, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23069990", "url": "https://glygen.org/publication/PubMed/23069990" } ] }, { "title": "Cell culture and Drosophila model systems define three classes of anaplastic lymphoma kinase mutations in neuroblastoma.", "journal": "Disease models & mechanisms", "date": "2013", "authors": "Chand D, Yamazaki Y, Ruuth K, Schonherr C, Martinsson T, Kogner P, Attiyeh EF, Maris J, Morozova O, Marra MA, Ohira M, Nakagawara A, Sandstrom PE, Palmer RH, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23104988", "url": "https://glygen.org/publication/PubMed/23104988" } ] }, { "title": "Tiam1 regulates the Wnt/Dvl/Rac1 signaling pathway and the differentiation of midbrain dopaminergic neurons.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Cajanek L, Ganji RS, Henriques-Oliveira C, Theofilopoulos S, Konik P, Bryja V, Arenas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "23109420", "url": "https://glygen.org/publication/PubMed/23109420" } ] }, { "title": "Characterization of rearrangements involving the ALK gene reveals a novel truncated form associated with tumor aggressiveness in neuroblastoma.", "journal": "Cancer research", "date": "2013", "authors": "Cazes A, Louis-Brennetot C, Mazot P, Dingli F, Lombard B, Boeva V, Daveau R, Cappo J, Combaret V, Schleiermacher G, Jouannet S, Ferrand S, Pierron G, Barillot E, Loew D, Vigny M, Delattre O, Janoueix-Lerosey I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23139213", "url": "https://glygen.org/publication/PubMed/23139213" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Anaplastic lymphoma kinase (ALK): structure, oncogenic activation, and pharmacological inhibition.", "journal": "Pharmacological research", "date": "2013", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23201355", "url": "https://glygen.org/publication/PubMed/23201355" } ] }, { "title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.", "journal": "Cancer letters", "date": "2013", "authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23219899", "url": "https://glygen.org/publication/PubMed/23219899" } ] }, { "title": "Crizotinib-resistant NPM-ALK mutants confer differential sensitivity to unrelated Alk inhibitors.", "journal": "Molecular cancer research : MCR", "date": "2013", "authors": "Ceccon M, Mologni L, Bisson W, Scapozza L, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23239810", "url": "https://glygen.org/publication/PubMed/23239810" } ] }, { "title": "Targeting transcription factor SALL4 in acute myeloid leukemia by interrupting its interaction with an epigenetic complex.", "journal": "Blood", "date": "2013", "authors": "Gao C, Dimitrov T, Yong KJ, Tatetsu H, Jeong HW, Luo HR, Bradner JE, Tenen DG, Chai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "23287862", "url": "https://glygen.org/publication/PubMed/23287862" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Functional consequences of Wnt-induced dishevelled 2 phosphorylation in canonical and noncanonical Wnt signaling.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Gonzalez-Sancho JM, Greer YE, Abrahams CL, Takigawa Y, Baljinnyam B, Lee KH, Lee KS, Rubin JS, Brown AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "23396967", "url": "https://glygen.org/publication/PubMed/23396967" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2013", "authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23534758", "url": "https://glygen.org/publication/PubMed/23534758" } ] }, { "title": "Protein kinase D2 regulates migration and invasion of U87MG glioblastoma cells in vitro.", "journal": "Experimental cell research", "date": "2013", "authors": "Bernhart E, Damm S, Wintersperger A, DeVaney T, Zimmer A, Raynham T, Ireson C, Sattler W", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23562655", "url": "https://glygen.org/publication/PubMed/23562655" } ] }, { "title": "Arginine methylation of the c-Jun coactivator RACO-1 is required for c-Jun/AP-1 activation.", "journal": "EMBO J.", "date": "2013", "authors": "Davies CC, Chakraborty A, Diefenbacher ME, Skehel M, Behrens A", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "23624934", "url": "https://glygen.org/publication/PubMed/23624934" } ] }, { "title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23630040", "url": "https://glygen.org/publication/PubMed/23630040" } ] }, { "title": "Urokinase-type Plasminogen Activator (uPA) is Inhibited with QLT0267 a Small Molecule Targeting Integrin-linked Kinase (ILK).", "journal": "Translational oncogenomics", "date": "2007", "authors": "Santos ND, Habibi G, Wang M, Law JH, Andrews HN, Wei D, Triche T, Dedhar S, Dunn SE", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23645983", "url": "https://glygen.org/publication/PubMed/23645983" } ] }, { "title": "Identification of recurrent FGFR3 fusion genes in lung cancer through kinome-centred RNA sequencing.", "journal": "The Journal of pathology", "date": "2013", "authors": "Majewski IJ, Mittempergher L, Davidson NM, Bosma A, Willems SM, Horlings HM, de Rink I, Greger L, Hooijer GK, Peters D, Nederlof PM, Hofland I, de Jong J, Wesseling J, Kluin RJ, Brugman W, Kerkhoven R, Nieboer F, Roepman P, Broeks A, Muley TR, Jassem J, Niklinski J, van Zandwijk N, Brazma A, Oshlack A, van den Heuvel M, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23661334", "url": "https://glygen.org/publication/PubMed/23661334" } ] }, { "title": "Regulation of bcl-2 transcription by estrogen receptor-alpha and c-Jun in human endometrium.", "journal": "Medical molecular morphology", "date": "2014", "authors": "Li ZL, Ueki K, Kumagai K, Araki R, Otsuki Y", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23665993", "url": "https://glygen.org/publication/PubMed/23665993" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "Desmoglein 3 promotes cancer cell migration and invasion by regulating activator protein 1 and protein kinase C-dependent-Ezrin activation.", "journal": "Oncogene", "date": "2014", "authors": "Brown L, Waseem A, Cruz IN, Szary J, Gunic E, Mannan T, Unadkat M, Yang M, Valderrama F, O'Toole EA, Wan H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23752190", "url": "https://glygen.org/publication/PubMed/23752190" } ] }, { "title": "A novel retro-inverso peptide is a preferential JNK substrate-competitive inhibitor.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Ngoei KR, Catimel B, Milech N, Watt PM, Bogoyevitch MA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23792175", "url": "https://glygen.org/publication/PubMed/23792175" } ] }, { "title": "Gpr125 modulates Dishevelled distribution and planar cell polarity signaling.", "journal": "Development (Cambridge, England)", "date": "2013", "authors": "Li X, Roszko I, Sepich DS, Ni M, Hamm HE, Marlow FL, Solnica-Krezel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "23821037", "url": "https://glygen.org/publication/PubMed/23821037" } ] }, { "title": "N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1alpha by human gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Murakami Y, Watari K, Shibata T, Uba M, Ureshino H, Kawahara A, Abe H, Izumi H, Mukaida N, Kuwano M, Ono M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "23846687", "url": "https://glygen.org/publication/PubMed/23846687" } ] }, { "title": "MK5 activates Rag transcription via Foxo1 in developing B cells.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Chow KT, Timblin GA, McWhirter SM, Schlissel MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23878308", "url": "https://glygen.org/publication/PubMed/23878308" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "The prognostic significance of Jun transcription factors in ovarian cancer.", "journal": "Journal of cancer research and clinical oncology", "date": "2013", "authors": "Eckhoff K, Flurschutz R, Trillsch F, Mahner S, Janicke F, Milde-Langosch K", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "23942796", "url": "https://glygen.org/publication/PubMed/23942796" } ] }, { "title": "Inflammatory myofibroblastic tumour of the lung with a novel PPFIBP1-ALK fusion variant.", "journal": "Histopathology", "date": "2013", "authors": "Yoshida A, Shibata T, Tsuta K, Watanabe S, Tsuda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23957430", "url": "https://glygen.org/publication/PubMed/23957430" } ] }, { "title": "Inhibition of apolipoprotein A-I expression by TNF-alpha in HepG2 cells: requirement for c-jun.", "journal": "Journal of cellular biochemistry", "date": "2014", "authors": "Parseghian S, Onstead-Haas LM, Wong NC, Mooradian AD, Haas MJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24038215", "url": "https://glygen.org/publication/PubMed/24038215" } ] }, { "title": "Involvement of a NF-kappa B-like transcription factor in the activation of the interleukin-6 gene by inflammatory lymphokines.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Shimizu H, Mitomo K, Watanabe T, Okamoto S, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2405250", "url": "https://glygen.org/publication/PubMed/2405250" } ] }, { "title": "Mechanistic insight into ALK receptor tyrosine kinase in human cancer biology.", "journal": "Nature reviews. Cancer", "date": "2013", "authors": "Hallberg B, Palmer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24060861", "url": "https://glygen.org/publication/PubMed/24060861" } ] }, { "title": "Multisite phosphorylation of c-Jun at threonine 91/93/95 triggers the onset of c-Jun pro-apoptotic activity in cerebellar granule neurons.", "journal": "Cell death & disease", "date": "2013-10-10", "authors": "Reddy C E, Albanito L, De Marco P, Aiello D, Maggiolini M, Napoli A, Musti A M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24113186", "url": "https://glygen.org/publication/PubMed/24113186" } ] }, { "title": "Repeated H2 O2 exposure drives cell cycle progression in an in vitro model of ulcerative colitis.", "journal": "Journal of cellular and molecular medicine", "date": "2013", "authors": "Poehlmann A, Reissig K, Schonfeld P, Walluscheck D, Schinlauer A, Hartig R, Lessel W, Guenther T, Silver A, Roessner A", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24118792", "url": "https://glygen.org/publication/PubMed/24118792" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Hox in motion: tracking HoxA cluster conformation during differentiation.", "journal": "Nucleic acids research", "date": "2014", "authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24174538", "url": "https://glygen.org/publication/PubMed/24174538" } ] }, { "title": "The Stress-response protein prostate-associated gene 4, interacts with c-Jun and potentiates its transactivation.", "journal": "Biochim. Biophys. Acta", "date": "2014", "authors": "Rajagopalan K, Qiu R, Mooney SM, Rao S, Shiraishi T, Sacho E, Huang H, Shapiro E, Weninger KR, Kulkarni P", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "24263171", "url": "https://glygen.org/publication/PubMed/24263171" } ] }, { "title": "KRIT1 loss of function causes a ROS-dependent upregulation of c-Jun.", "journal": "Free radical biology & medicine", "date": "2014", "authors": "Goitre L, De Luca E, Braggion S, Trapani E, Guglielmotto M, Biasi F, Forni M, Moglia A, Trabalzini L, Retta SF", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24291398", "url": "https://glygen.org/publication/PubMed/24291398" } ] }, { "title": "Phosphorylation of heat shock protein 40 (Hsp40/DnaJB1) by mitogen-activated protein kinase-activated protein kinase 5 (MK5/PRAK).", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Kostenko S, Jensen KL, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24309468", "url": "https://glygen.org/publication/PubMed/24309468" } ] }, { "title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.", "journal": "PloS one", "date": "2013", "authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24312487", "url": "https://glygen.org/publication/PubMed/24312487" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Kinase fusions are frequent in Spitz tumours and spitzoid melanomas.", "journal": "Nature communications", "date": "2014", "authors": "Wiesner T, He J, Yelensky R, Esteve-Puig R, Botton T, Yeh I, Lipson D, Otto G, Brennan K, Murali R, Garrido M, Miller VA, Ross JS, Berger MF, Sparatta A, Palmedo G, Cerroni L, Busam KJ, Kutzner H, Cronin MT, Stephens PJ, Bastian BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24445538", "url": "https://glygen.org/publication/PubMed/24445538" } ] }, { "title": "Identification of a recurrent STRN/ALK fusion in thyroid carcinomas.", "journal": "PloS one", "date": "2014", "authors": "Perot G, Soubeyran I, Ribeiro A, Bonhomme B, Savagner F, Boutet-Bouzamondo N, Hostein I, Bonichon F, Godbert Y, Chibon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24475247", "url": "https://glygen.org/publication/PubMed/24475247" } ] }, { "title": "HIP1-ALK, a novel ALK fusion variant that responds to crizotinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Fang DD, Zhang B, Gu Q, Lira M, Xu Q, Sun H, Qian M, Sheng W, Ozeck M, Wang Z, Zhang C, Chen X, Chen KX, Li J, Chen SH, Christensen J, Mao M, Chan CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24496003", "url": "https://glygen.org/publication/PubMed/24496003" } ] }, { "title": "Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer.", "journal": "Biochemistry", "date": "2014", "authors": "Stark JL, Mehla K, Chaika N, Acton TB, Xiao R, Singh PK, Montelione GT, Powers R", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24512202", "url": "https://glygen.org/publication/PubMed/24512202" } ] }, { "title": "HIP1-ALK, a novel fusion protein identified in lung adenocarcinoma.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Hong M, Kim RN, Song JY, Choi SJ, Oh E, Lira ME, Mao M, Takeuchi K, Han J, Kim J, Choi YL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24518094", "url": "https://glygen.org/publication/PubMed/24518094" } ] }, { "title": "Ovarian cancer-associated mutations disable catalytic activity of CDK12, a kinase that promotes homologous recombination repair and resistance to cisplatin and poly(ADP-ribose) polymerase inhibitors.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Joshi PM, Sutor SL, Huntoon CJ, Karnitz LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "24554720", "url": "https://glygen.org/publication/PubMed/24554720" } ] }, { "title": "Cancer/testis antigen PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1, a component of the stress-response pathway.", "journal": "Biochemistry", "date": "2014", "authors": "Mooney SM, Qiu R, Kim JJ, Sacho EJ, Rajagopalan K, Johng D, Shiraishi T, Kulkarni P, Weninger KR", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "24559171", "url": "https://glygen.org/publication/PubMed/24559171" } ] }, { "title": "ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.", "journal": "Journal of cellular physiology", "date": "2014", "authors": "Wang W, Bian K, Vallabhaneni S, Zhang B, Wu RC, O'Malley BW, Long W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24585635", "url": "https://glygen.org/publication/PubMed/24585635" } ] }, { "title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.", "journal": "PLoS genetics", "date": "2014", "authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24586203", "url": "https://glygen.org/publication/PubMed/24586203" } ] }, { "title": "Hyaluronan-CD44 interaction promotes c-Jun signaling and miRNA21 expression leading to Bcl-2 expression and chemoresistance in breast cancer cells.", "journal": "Molecular cancer", "date": "2014", "authors": "Chen L, Bourguignon LY", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24606718", "url": "https://glygen.org/publication/PubMed/24606718" } ] }, { "title": "Identification of the transforming STRN-ALK fusion as a potential therapeutic target in the aggressive forms of thyroid cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Kelly LM, Barila G, Liu P, Evdokimova VN, Trivedi S, Panebianco F, Gandhi M, Carty SE, Hodak SP, Luo J, Dacic S, Yu YP, Nikiforova MN, Ferris RL, Altschuler DL, Nikiforov YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24613930", "url": "https://glygen.org/publication/PubMed/24613930" } ] }, { "title": "Downstream signaling and genome-wide regulatory effects of PTK7 pseudokinase and its proteolytic fragments in cancer cells.", "journal": "Cell communication and signaling : CCS", "date": "2014", "authors": "Golubkov VS, Strongin AY", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24618420", "url": "https://glygen.org/publication/PubMed/24618420" } ] }, { "title": "A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.", "journal": "eLife", "date": "2014", "authors": "Serra RW, Fang M, Park SM, Hutchinson L, Green MR", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "24623306", "url": "https://glygen.org/publication/PubMed/24623306" } ] }, { "title": "The role of c-Jun in controlling the EPAC1-dependent induction of the SOCS3 gene in HUVECs.", "journal": "FEBS letters", "date": "2014", "authors": "Wiejak J, Dunlop J, Yarwood SJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24631457", "url": "https://glygen.org/publication/PubMed/24631457" } ] }, { "title": "The structure and substrate specificity of human Cdk12/Cyclin K.", "journal": "Nature communications", "date": "2014", "authors": "Bosken CA, Farnung L, Hintermair C, Merzel Schachter M, Vogel-Bachmayr K, Blazek D, Anand K, Fisher RP, Eick D, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "24662513", "url": "https://glygen.org/publication/PubMed/24662513" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "The tumor suppressor PTEN interacts with p53 in hereditary cancer (Review).", "journal": "International journal of oncology", "date": "2014", "authors": "Nakanishi A, Kitagishi Y, Ogura Y, Matsuda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "24718924", "url": "https://glygen.org/publication/PubMed/24718924" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "A novel fusion of TPR and ALK in lung adenocarcinoma.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Choi YL, Lira ME, Hong M, Kim RN, Choi SJ, Song JY, Pandy K, Mann DL, Stahl JA, Peckham HE, Zheng Z, Han J, Mao M, Kim J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24736082", "url": "https://glygen.org/publication/PubMed/24736082" } ] }, { "title": "Isorhapontigenin (ISO) inhibited cell transformation by inducing G0/G1 phase arrest via increasing MKP-1 mRNA Stability.", "journal": "Oncotarget", "date": "2014", "authors": "Gao G, Chen L, Li J, Zhang D, Fang Y, Huang H, Chen X, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24797581", "url": "https://glygen.org/publication/PubMed/24797581" } ] }, { "title": "Upregulation of sestrin-2 expression protects against endothelial toxicity of angiotensin II.", "journal": "Cell biology and toxicology", "date": "2014", "authors": "Yi L, Li F, Yong Y, Jianting D, Liting Z, Xuansheng H, Fei L, Jiewen L", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24838122", "url": "https://glygen.org/publication/PubMed/24838122" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "WNT5A enhances resistance of melanoma cells to targeted BRAF inhibitors.", "journal": "The Journal of clinical investigation", "date": "2014", "authors": "Anastas JN, Kulikauskas RM, Tamir T, Rizos H, Long GV, von Euw EM, Yang PT, Chen HW, Haydu L, Toroni RA, Lucero OM, Chien AJ, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "24865425", "url": "https://glygen.org/publication/PubMed/24865425" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "The neurotoxicity of 5-S-cysteinyldopamine is mediated by the early activation of ERK1/2 followed by the subsequent activation of ASK1/JNK1/2 pro-apoptotic signalling.", "journal": "The Biochemical journal", "date": "2014", "authors": "Vauzour D, Pinto JT, Cooper AJ, Spencer JP", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "24938188", "url": "https://glygen.org/publication/PubMed/24938188" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.", "journal": "PLoS genetics", "date": "2014", "authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25101834", "url": "https://glygen.org/publication/PubMed/25101834" } ] }, { "title": "A new tumour suppression mechanism by p27Kip1: EGFR down-regulation mediated by JNK/c-Jun pathway inhibition.", "journal": "The Biochemical journal", "date": "2014", "authors": "Fang Y, Wang Y, Wang Y, Meng Y, Zhu J, Jin H, Li J, Zhang D, Yu Y, Wu XR, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25121353", "url": "https://glygen.org/publication/PubMed/25121353" } ] }, { "title": "CXCL12 induces connective tissue growth factor expression in human lung fibroblasts through the Rac1/ERK, JNK, and AP-1 pathways.", "journal": "PloS one", "date": "2014", "authors": "Lin CH, Shih CH, Tseng CC, Yu CC, Tsai YJ, Bien MY, Chen BC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25121739", "url": "https://glygen.org/publication/PubMed/25121739" } ] }, { "title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25135475", "url": "https://glygen.org/publication/PubMed/25135475" } ] }, { "title": "Elevated DDX21 regulates c-Jun activity and rRNA processing in human breast cancers.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Zhang Y, Baysac KC, Yee LF, Saporita AJ, Weber JD", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25260534", "url": "https://glygen.org/publication/PubMed/25260534" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "Heat shock protein 27 phosphorylation state is associated with cancer progression.", "journal": "Frontiers in genetics", "date": "2014", "authors": "Katsogiannou M, Andrieu C, Rocchi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "25339975", "url": "https://glygen.org/publication/PubMed/25339975" } ] }, { "title": "Revisiting STAT3 signalling in cancer: new and unexpected biological functions.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Yu H, Lee H, Herrmann A, Buettner R, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "25342631", "url": "https://glygen.org/publication/PubMed/25342631" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "Identification of a novel HIP1-ALK fusion variant in Non-Small-Cell Lung Cancer (NSCLC) and discovery of ALK I1171 (I1171N/S) mutations in two ALK-rearranged NSCLC patients with resistance to Alectinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Ou SH, Klempner SJ, Greenbowe JR, Azada M, Schrock AB, Ali SM, Ross JS, Stephens PJ, Miller VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "25393796", "url": "https://glygen.org/publication/PubMed/25393796" } ] }, { "title": "Divergent behaviors and underlying mechanisms of cell migration and invasion in non-metastatic T24 and its metastatic derivative T24T bladder cancer cell lines.", "journal": "Oncotarget", "date": "2015", "authors": "Jin H, Yu Y, Hu Y, Lu C, Li J, Gu J, Zhang L, Huang H, Zhang D, Wu XR, Gao J, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25402510", "url": "https://glygen.org/publication/PubMed/25402510" } ] }, { "title": "Treatment Efficacy and Resistance Mechanisms Using the Second-Generation ALK Inhibitor AP26113 in Human NPM-ALK-Positive Anaplastic Large Cell Lymphoma.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Ceccon M, Mologni L, Giudici G, Piazza R, Pirola A, Fontana D, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "25421750", "url": "https://glygen.org/publication/PubMed/25421750" } ] }, { "title": "Acquisition of an immunosuppressive protumorigenic macrophage phenotype depending on c-Jun phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Hefetz-Sela S, Stein I, Klieger Y, Porat R, Sade-Feldman M, Zreik F, Nagler A, Pappo O, Quagliata L, Dazert E, Eferl R, Terracciano L, Wagner EF, Ben-Neriah Y, Baniyash M, Pikarsky E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25422452", "url": "https://glygen.org/publication/PubMed/25422452" } ] }, { "title": "Expression, purification, and identification of associated proteins of the full-length hCDK12/CyclinK complex.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Bartkowiak B, Greenleaf AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25429106", "url": "https://glygen.org/publication/PubMed/25429106" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "TGFbeta-induced invasion of prostate cancer cells is promoted by c-Jun-dependent transcriptional activation of Snail1.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2014", "authors": "Thakur N, Gudey SK, Marcusson A, Fu JY, Bergh A, Heldin CH, Landstrom M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25483191", "url": "https://glygen.org/publication/PubMed/25483191" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "Characterization of human cyclin-dependent kinase 12 (CDK12) and CDK13 complexes in C-terminal domain phosphorylation, gene transcription, and RNA processing.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Liang K, Gao X, Gilmore JM, Florens L, Washburn MP, Smith E, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25561469", "url": "https://glygen.org/publication/PubMed/25561469" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.", "journal": "Differentiation; research in biological diversity", "date": "1989", "authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "2570724", "url": "https://glygen.org/publication/PubMed/2570724" } ] }, { "title": "Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.", "journal": "Nucleic acids research", "date": "2015", "authors": "Ekumi KM, Paculova H, Lenasi T, Pospichalova V, Bosken CA, Rybarikova J, Bryja V, Geyer M, Blazek D, Barboric M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25712099", "url": "https://glygen.org/publication/PubMed/25712099" } ] }, { "title": "EBV-LMP1 targeted DNAzyme enhances radiosensitivity by inhibiting tumor angiogenesis via the JNKs/HIF-1 pathway in nasopharyngeal carcinoma.", "journal": "Oncotarget", "date": "2015", "authors": "Yang L, Liu L, Xu Z, Liao W, Feng D, Dong X, Xu S, Xiao L, Lu J, Luo X, Tang M, Bode AM, Dong Z, Sun L, Cao Y", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25714020", "url": "https://glygen.org/publication/PubMed/25714020" } ] }, { "title": "SLUG is a direct transcriptional repressor of PTEN tumor suppressor.", "journal": "The Prostate", "date": "2015", "authors": "Uygur B, Abramo K, Leikina E, Vary C, Liaw L, Wu WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "25728608", "url": "https://glygen.org/publication/PubMed/25728608" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "PTX3 gene activation in EGF-induced head and neck cancer cell metastasis.", "journal": "Oncotarget", "date": "2015", "authors": "Chang WC, Wu SL, Huang WC, Hsu JY, Chan SH, Wang JM, Tsai JP, Chen BK", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25797258", "url": "https://glygen.org/publication/PubMed/25797258" } ] }, { "title": "Novel ALK fusion partners in lung cancer.", "journal": "Cancer letters", "date": "2015", "authors": "Iyevleva AG, Raskin GA, Tiurin VI, Sokolenko AP, Mitiushkina NV, Aleksakhina SN, Garifullina AR, Strelkova TN, Merkulov VO, Ivantsov AO, Kuligina ESh, Pozharisski KM, Togo AV, Imyanitov EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "25813404", "url": "https://glygen.org/publication/PubMed/25813404" } ] }, { "title": "Systematic analysis of BRAF(V600E) melanomas reveals a role for JNK/c-Jun pathway in adaptive resistance to drug-induced apoptosis.", "journal": "Molecular systems biology", "date": "2015", "authors": "Fallahi-Sichani M, Moerke NJ, Niepel M, Zhang T, Gray NS, Sorger PK", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25814555", "url": "https://glygen.org/publication/PubMed/25814555" } ] }, { "title": "By activating matrix metalloproteinase-7, shear stress promotes chondrosarcoma cell motility, invasion and lung colonization.", "journal": "Oncotarget", "date": "2015", "authors": "Guan PP, Yu X, Guo JJ, Wang Y, Wang T, Li JY, Konstantopoulos K, Wang ZY, Wang P", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "25823818", "url": "https://glygen.org/publication/PubMed/25823818" } ] }, { "title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.", "journal": "FEBS letters", "date": "2015", "authors": "Lonfat N, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25913784", "url": "https://glygen.org/publication/PubMed/25913784" } ] }, { "title": "BIRC6-ALK, a Novel Fusion Gene in ALK Break-Apart FISH-Negative Lung Adenocarcinoma, Responds to Crizotinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2015", "authors": "Shan L, Jiang P, Xu F, Zhang W, Guo L, Wu J, Zeng Y, Jiao Y, Ying J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "26001147", "url": "https://glygen.org/publication/PubMed/26001147" } ] }, { "title": "Interplay between TAp73 Protein and Selected Activator Protein-1 (AP-1) Family Members Promotes AP-1 Target Gene Activation and Cellular Growth.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Subramanian D, Bunjobpol W, Sabapathy K", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26018080", "url": "https://glygen.org/publication/PubMed/26018080" } ] }, { "title": "Overexpression of MAPK15 in gastric cancer is associated with copy number gain and contributes to the stability of c-Jun.", "journal": "Oncotarget", "date": "2015", "authors": "Jin DH, Lee J, Kim KM, Kim S, Kim DH, Park J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26035356", "url": "https://glygen.org/publication/PubMed/26035356" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "STUMP un`stumped`: anti-tumor response to anaplastic lymphoma kinase (ALK) inhibitor based targeted therapy in uterine inflammatory myofibroblastic tumor with myxoid features harboring DCTN1-ALK fusion.", "journal": "Journal of hematology & oncology", "date": "2015", "authors": "Subbiah V, McMahon C, Patel S, Zinner R, Silva EG, Elvin JA, Subbiah IM, Ohaji C, Ganeshan DM, Anand D, Levenback CF, Berry J, Brennan T, Chmielecki J, Chalmers ZR, Mayfield J, Miller VA, Stephens PJ, Ross JS, Ali SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "26062823", "url": "https://glygen.org/publication/PubMed/26062823" } ] }, { "title": "Galloyl benzamide-based compounds modulating tumour necrosis factor alpha-stimulated c-Jun N-terminal kinase and p38 mitogen-activated protein kinase signalling pathways.", "journal": "The Journal of pharmacy and pharmacology", "date": "2015", "authors": "Leo V, Stefanachi A, Nacci C, Leonetti F, de Candia M, Carotti A, Altomare CD, Montagnani M, Cellamare S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26078032", "url": "https://glygen.org/publication/PubMed/26078032" } ] }, { "title": "The c-Jun/RHOB/AKT pathway confers resistance of BRAF-mutant melanoma cells to MAPK inhibitors.", "journal": "Oncotarget", "date": "2015", "authors": "Delmas A, Cherier J, Pohorecka M, Medale-Giamarchi C, Meyer N, Casanova A, Sordet O, Lamant L, Savina A, Pradines A, Favre G", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26098773", "url": "https://glygen.org/publication/PubMed/26098773" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "Phosphorylation-induced conformational ensemble switching in an intrinsically disordered cancer/testis antigen.", "journal": "J. Biol. Chem.", "date": "2015", "authors": "He Y, Chen Y, Mooney SM, Rajagopalan K, Bhargava A, Sacho E, Weninger K, Bryan PN, Kulkarni P, Orban J", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "26242913", "url": "https://glygen.org/publication/PubMed/26242913" } ] }, { "title": "Aschantin targeting on the kinase domain of mammalian target of rapamycin suppresses epidermal growth factor-induced neoplastic cell transformation.", "journal": "Carcinogenesis", "date": "2015", "authors": "Lee CJ, Jang JH, Lee JY, Lee MH, Li Y, Ryu HW, Choi KI, Dong Z, Lee HS, Oh SR, Surh YJ, Cho YY", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26243309", "url": "https://glygen.org/publication/PubMed/26243309" } ] }, { "title": "Transcriptional regulation of Annexin A2 promotes starvation-induced autophagy.", "journal": "Nature communications", "date": "2015", "authors": "Moreau K, Ghislat G, Hochfeld W, Renna M, Zavodszky E, Runwal G, Puri C, Lee S, Siddiqi F, Menzies FM, Ravikumar B, Rubinsztein DC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26289944", "url": "https://glygen.org/publication/PubMed/26289944" } ] }, { "title": "RAS-MAPK dependence underlies a rational polytherapy strategy in EML4-ALK-positive lung cancer.", "journal": "Nature medicine", "date": "2015", "authors": "Hrustanovic G, Olivas V, Pazarentzos E, Tulpule A, Asthana S, Blakely CM, Okimoto RA, Lin L, Neel DS, Sabnis A, Flanagan J, Chan E, Varella-Garcia M, Aisner DL, Vaishnavi A, Ou SH, Collisson EA, Ichihara E, Mack PC, Lovly CM, Karachaliou N, Rosell R, Riess JW, Doebele RC, Bivona TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "26301689", "url": "https://glygen.org/publication/PubMed/26301689" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "TOPK promotes lung cancer resistance to EGFR tyrosine kinase inhibitors by phosphorylating and activating c-Jun.", "journal": "Oncotarget", "date": "2016", "authors": "Li Y, Yang Z, Li W, Xu S, Wang T, Wang T, Niu M, Zhang S, Jia L, Li S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26745678", "url": "https://glygen.org/publication/PubMed/26745678" } ] }, { "title": "Cdk3-promoted epithelial-mesenchymal transition through activating AP-1 is involved in colorectal cancer metastasis.", "journal": "Oncotarget", "date": "2016", "authors": "Lu J, Zhang ZL, Huang D, Tang N, Li Y, Peng Z, Lu C, Dong Z, Tang F", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "26755651", "url": "https://glygen.org/publication/PubMed/26755651" } ] }, { "title": "High Glucose Stimulates Tumorigenesis in Hepatocellular Carcinoma Cells Through AGER-Dependent O-GlcNAcylation of c-Jun.", "journal": "Diabetes", "date": "2016", "authors": "Qiao Y, Zhang X, Zhang Y, Wang Y, Xu Y, Liu X, Sun F, Wang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "26825459", "url": "https://glygen.org/publication/PubMed/26825459" } ] }, { "title": "MAF1 suppresses AKT-mTOR signaling and liver cancer through activation of PTEN transcription.", "journal": "Hepatology (Baltimore, Md.)", "date": "2016", "authors": "Li Y, Tsang CK, Wang S, Li XX, Yang Y, Fu L, Huang W, Li M, Wang HY, Zheng XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "26910647", "url": "https://glygen.org/publication/PubMed/26910647" } ] }, { "title": "missing tag=TI", "journal": "missing tag=JT", "date": "missing", "authors": "author information missing", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "26962010", "url": "https://glygen.org/publication/PubMed/26962010" } ] }, { "title": "Protein Kinase Ciota Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.", "journal": "Cancer cell", "date": "2016", "authors": "Ali SA, Justilien V, Jamieson L, Murray NR, Fields AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "26977885", "url": "https://glygen.org/publication/PubMed/26977885" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "The oncogenic transcription factor c-Jun regulates glutaminase expression and sensitizes cells to glutaminase-targeted therapy.", "journal": "Nature communications", "date": "2016", "authors": "Lukey MJ, Greene KS, Erickson JW, Wilson KF, Cerione RA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27089238", "url": "https://glygen.org/publication/PubMed/27089238" } ] }, { "title": "Comprehensive Genomic Profiling Identifies a Subset of Crizotinib-Responsive ALK-Rearranged Non-Small Cell Lung Cancer Not Detected by Fluorescence In Situ Hybridization.", "journal": "The oncologist", "date": "2016", "authors": "Ali SM, Hensing T, Schrock AB, Allen J, Sanford E, Gowen K, Kulkarni A, He J, Suh JH, Lipson D, Elvin JA, Yelensky R, Chalmers Z, Chmielecki J, Peled N, Klempner SJ, Firozvi K, Frampton GM, Molina JR, Menon S, Brahmer JR, MacMahon H, Nowak J, Ou SH, Zauderer M, Ladanyi M, Zakowski M, Fischbach N, Ross JS, Stephens PJ, Miller VA, Wakelee H, Ganesan S, Salgia R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "27245569", "url": "https://glygen.org/publication/PubMed/27245569" } ] }, { "title": "EF1A1/HSC70 Cooperatively Suppress Brain Endothelial Cell Apoptosis via Regulating JNK Activity.", "journal": "CNS neuroscience & therapeutics", "date": "2016", "authors": "Liu Y, Jiang S, Yang PY, Zhang YF, Li TJ, Rui YC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27324700", "url": "https://glygen.org/publication/PubMed/27324700" } ] }, { "title": "Synaptonuclear messenger PRR7 inhibits c-Jun ubiquitination and regulates NMDA-mediated excitotoxicity.", "journal": "The EMBO journal", "date": "2016", "authors": "Kravchick DO, Karpova A, Hrdinka M, Lopez-Rojas J, Iacobas S, Carbonell AU, Iacobas DA, Kreutz MR, Jordan BA", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "27458189", "url": "https://glygen.org/publication/PubMed/27458189" } ] }, { "title": "Induction of Connective Tissue Growth Factor Expression by Hypoxia in Human Lung Fibroblasts via the MEKK1/MEK1/ERK1/GLI-1/GLI-2 and AP-1 Pathways.", "journal": "PloS one", "date": "2016", "authors": "Cheng Y, Lin CH, Chen JY, Li CH, Liu YT, Chen BC", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27486656", "url": "https://glygen.org/publication/PubMed/27486656" } ] }, { "title": "Cheliensisin A (Chel A) induces apoptosis in human bladder cancer cells by promoting PHLPP2 protein degradation.", "journal": "Oncotarget", "date": "2016", "authors": "Zhang R, Che X, Zhang J, Li Y, Li J, Deng X, Zhu J, Jin H, Zhao Q, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27556506", "url": "https://glygen.org/publication/PubMed/27556506" } ] }, { "title": "The role of the ALK receptor in cancer biology.", "journal": "Annals of oncology : official journal of the European Society for Medical Oncology", "date": "2016", "authors": "Hallberg B, Palmer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "27573755", "url": "https://glygen.org/publication/PubMed/27573755" } ] }, { "title": "The activation of p38MAPK and JNK pathways in bovine herpesvirus 1 infected MDBK cells.", "journal": "Veterinary research", "date": "2016", "authors": "Zhu L, Yuan C, Huang L, Ding X, Wang J, Zhang D, Zhu G", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27590675", "url": "https://glygen.org/publication/PubMed/27590675" } ] }, { "title": "ERK/c-Jun Recruits Tet1 to Induce Zta Expression and Epstein-Barr Virus Reactivation through DNA Demethylation.", "journal": "Scientific reports", "date": "2016", "authors": "Zhang W, Han D, Wan P, Pan P, Cao Y, Liu Y, Wu K, Wu J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27708396", "url": "https://glygen.org/publication/PubMed/27708396" } ] }, { "title": "A systems study reveals concurrent activation of AMPK and mTOR by amino acids.", "journal": "Nature communications", "date": "2016", "authors": "Dalle Pezze P, Ruf S, Sonntag AG, Langelaar-Makkinje M, Hall P, Heberle AM, Razquin Navas P, van Eunen K, Tolle RC, Schwarz JJ, Wiese H, Warscheid B, Deitersen J, Stork B, Fassler E, Schauble S, Hahn U, Horvatovich P, Shanley DP, Thedieck K", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "27869123", "url": "https://glygen.org/publication/PubMed/27869123" } ] }, { "title": "ALK oncoproteins in atypical inflammatory myofibroblastic tumours: novel RRBP1-ALK fusions in epithelioid inflammatory myofibroblastic sarcoma.", "journal": "The Journal of pathology", "date": "2017", "authors": "Lee JC, Li CF, Huang HY, Zhu MJ, Marino-Enriquez A, Lee CT, Ou WB, Hornick JL, Fletcher JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "27874193", "url": "https://glygen.org/publication/PubMed/27874193" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "XIAP BIR domain suppresses miR-200a expression and subsequently promotes EGFR protein translation and anchorage-independent growth of bladder cancer cell.", "journal": "Journal of hematology & oncology", "date": "2017", "authors": "Huang C, Zeng X, Jiang G, Liao X, Liu C, Li J, Jin H, Zhu J, Sun H, Wu XR, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28057023", "url": "https://glygen.org/publication/PubMed/28057023" } ] }, { "title": "Chloroquine inhibits human CD4(+) T-cell activation by AP-1 signaling modulation.", "journal": "Scientific reports", "date": "2017", "authors": "Schmidt RL, Jutz S, Goldhahn K, Witzeneder N, Gerner MC, Trapin D, Greiner G, Hoermann G, Steiner G, Pickl WF, Burgmann H, Steinberger P, Ratzinger F, Schmetterer KG", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28169350", "url": "https://glygen.org/publication/PubMed/28169350" } ] }, { "title": "Rhein exhibits antitumorigenic effects by interfering with the interaction between prolyl isomerase Pin1 and c-Jun.", "journal": "Oncology reports", "date": "2017", "authors": "Cho JH, Chae JI, Shim JH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28184937", "url": "https://glygen.org/publication/PubMed/28184937" } ] }, { "title": "Human proto-oncogene c-jun encodes a DNA binding protein with structural and functional properties of transcription factor AP-1.", "journal": "Science", "date": "1987", "authors": "Bohmann D, Bos T J, Admon A, Nishimura T, Vogt P K, Tjian R", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "2825349", "url": "https://glygen.org/publication/PubMed/2825349" } ] }, { "title": "Identification of a novel crizotinib-sensitive BCL11A-ALK gene fusion in a nonsmall cell lung cancer patient.", "journal": "The European respiratory journal", "date": "2017", "authors": "Tian Q, Deng WJ, Li ZW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "28404650", "url": "https://glygen.org/publication/PubMed/28404650" } ] }, { "title": "DKK3 Overexpression Increases the Malignant Properties of Head and Neck Squamous Cell Carcinoma Cells.", "journal": "Oncology research", "date": "2018", "authors": "Katase N, Nishimatsu SI, Yamauchi A, Yamamura M, Terada K, Itadani M, Okada N, Hassan NMM, Nagatsuka H, Ikeda T, Nohno T, Fujita S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28470144", "url": "https://glygen.org/publication/PubMed/28470144" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "Low level of Lck kinase in Th2 cells limits expression of CD4 co-receptor and S73 phosphorylation of transcription factor c-Jun.", "journal": "Scientific reports", "date": "2017", "authors": "Shebzukhov YV, Stanislawiak S, Bezhaeva TR, Nedospasov SA, Kuprash DV", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28539628", "url": "https://glygen.org/publication/PubMed/28539628" } ] }, { "title": "Cigarette smoke inhibits LPS-induced FABP5 expression by preventing c-Jun binding to the FABP5 promoter.", "journal": "PloS one", "date": "2017", "authors": "Rao D, Perraud AL, Schmitz C, Gally F", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28542209", "url": "https://glygen.org/publication/PubMed/28542209" } ] }, { "title": "Anaplastic lymphoma kinase-positive anaplastic large cell lymphoma with the variant RNF213-, ATIC- and TPM3-ALK fusions is characterized by copy number gain of the rearranged ALK gene.", "journal": "Haematologica", "date": "2017", "authors": "van der Krogt JA, Bempt MV, Ferreiro JF, Mentens N, Jacobs K, Pluys U, Doms K, Geerdens E, Uyttebroeck A, Pierre P, Michaux L, Devos T, Vandenberghe P, Tousseyn T, Cools J, Wlodarska I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "28659337", "url": "https://glygen.org/publication/PubMed/28659337" } ] }, { "title": "Molecular breakdown: a comprehensive view of anaplastic lymphoma kinase (ALK)-rearranged non-small cell lung cancer.", "journal": "The Journal of pathology", "date": "2017", "authors": "Noh KW, Lee MS, Lee SE, Song JY, Shin HT, Kim YJ, Oh DY, Jung K, Sung M, Kim M, An S, Han J, Shim YM, Zo JI, Kim J, Park WY, Lee SH, Choi YL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "28741662", "url": "https://glygen.org/publication/PubMed/28741662" } ] }, { "title": "The lichen secondary metabolite atranorin suppresses lung cancer cell motility and tumorigenesis.", "journal": "Scientific reports", "date": "2017", "authors": "Zhou R, Yang Y, Park SY, Nguyen TT, Seo YW, Lee KH, Lee JH, Kim KK, Hur JS, Kim H", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "28811522", "url": "https://glygen.org/publication/PubMed/28811522" } ] }, { "title": "VRK1 promotes cisplatin resistance by up-regulating c-MYC via c-Jun activation and serves as a therapeutic target in esophageal squamous cell carcinoma.", "journal": "Oncotarget", "date": "2017", "authors": "Liu ZC, Cao K, Xiao ZH, Qiao L, Wang XQ, Shang B, Jia Y, Wang Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "29029460", "url": "https://glygen.org/publication/PubMed/29029460" } ] }, { "title": "Targeting autophagy inhibits melanoma growth by enhancing NK cells infiltration in a CCL5-dependent manner.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Mgrditchian T, Arakelian T, Paggetti J, Noman MZ, Viry E, Moussay E, Van Moer K, Kreis S, Guerin C, Buart S, Robert C, Borg C, Vielh P, Chouaib S, Berchem G, Janji B", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "29078276", "url": "https://glygen.org/publication/PubMed/29078276" } ] }, { "title": "Human NOTCH4 is a key target of RUNX1 in megakaryocytic differentiation.", "journal": "Blood", "date": "2018", "authors": "Li Y, Jin C, Bai H, Gao Y, Sun S, Chen L, Qin L, Liu PP, Cheng L, Wang QF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "29101237", "url": "https://glygen.org/publication/PubMed/29101237" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "A c-Jun N-terminal kinase inhibitor, JNK-IN-8, sensitizes triple negative breast cancer cells to lapatinib.", "journal": "Oncotarget", "date": "2017", "authors": "Ebelt ND, Kaoud TS, Edupuganti R, Van Ravenstein S, Dalby KN, Van Den Berg CL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "29285221", "url": "https://glygen.org/publication/PubMed/29285221" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "database": "O-GlcNAc Atlas", "id": "P05412", "url": "https://oglcnac.org/atlas/detail/P05412" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Role and targeting of anaplastic lymphoma kinase in cancer.", "journal": "Molecular cancer", "date": "2018", "authors": "Della Corte CM, Viscardi G, Di Liello R, Fasano M, Martinelli E, Troiani T, Ciardiello F, Morgillo F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "29455642", "url": "https://glygen.org/publication/PubMed/29455642" } ] }, { "title": "STAT3: a multifaceted oncoprotein.", "journal": "Growth factors (Chur, Switzerland)", "date": "2018", "authors": "Guanizo AC, Fernando CD, Garama DJ, Gough DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "29873274", "url": "https://glygen.org/publication/PubMed/29873274" } ] }, { "title": "c-Jun Proto-Oncoprotein Plays a Protective Role in Lung Epithelial Cells Exposed to Staphylococcal alpha-Toxin.", "journal": "Frontiers in cellular and infection microbiology", "date": "2018", "authors": "Moyano AJ, Racca AC, Soria G, Saka HA, Andreoli V, Smania AM, Sola C, Bocco JL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "29888211", "url": "https://glygen.org/publication/PubMed/29888211" } ] }, { "title": "Schwann cell O-GlcNAcylation promotes peripheral nerve remyelination via attenuation of the AP-1 transcription factor JUN.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Kim S, Maynard JC, Strickland A, Burlingame AL, Milbrandt J", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P05412", "url": "https://oglcnac.org/atlas/detail/P05412" } ], "reference": [ { "type": "PubMed", "id": "30012597", "url": "https://glygen.org/publication/PubMed/30012597" } ] }, { "title": "Dependency on the TYK2/STAT1/MCL1 axis in anaplastic large cell lymphoma.", "journal": "Leukemia", "date": "2019", "authors": "Prutsch N, Gurnhofer E, Suske T, Liang HC, Schlederer M, Roos S, Wu LC, Simonitsch-Klupp I, Alvarez-Hernandez A, Kornauth C, Leone DA, Svinka J, Eferl R, Limberger T, Aufinger A, Shirsath N, Wolf P, Hielscher T, Aberger F, Schmoellerl J, Stoiber D, Strobl B, Jager U, Staber PB, Grebien F, Moriggl R, Muller M, Inghirami GG, Sanda T, Look AT, Turner SD, Kenner L, Merkel O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "30131584", "url": "https://glygen.org/publication/PubMed/30131584" } ] }, { "title": "ISO, via Upregulating MiR-137 Transcription, Inhibits GSK3beta-HSP70-MMP-2 Axis, Resulting in Attenuating Urothelial Cancer Invasion.", "journal": "Molecular therapy. Nucleic acids", "date": "2018", "authors": "Guo X, Huang H, Jin H, Xu J, Risal S, Li J, Li X, Yan H, Zeng X, Xue L, Chen C, Huang C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "30195772", "url": "https://glygen.org/publication/PubMed/30195772" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "Resistance to Src inhibition alters the BRAF-mutant tumor secretome to promote an invasive phenotype and therapeutic escape through a FAK>p130Cas>c-Jun signaling axis.", "journal": "Oncogene", "date": "2019", "authors": "Kessler BE, Mishall KM, Kellett MD, Clark EG, Pugazhenthi U, Pozdeyev N, Kim J, Tan AC, Schweppe RE", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "30531837", "url": "https://glygen.org/publication/PubMed/30531837" } ] }, { "title": "The Transcriptional Regulator Sin3A Contributes to the Oncogenic Potential of STAT3.", "journal": "Cancer research", "date": "2019", "authors": "Gambi G, Di Simone E, Basso V, Ricci L, Wang R, Verma A, Elemento O, Ponzoni M, Inghirami G, Icardi L, Mondino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "30692217", "url": "https://glygen.org/publication/PubMed/30692217" } ] }, { "title": "Epimagnolin targeting on an active pocket of mammalian target of rapamycin suppressed cell transformation and colony growth of lung cancer cells.", "journal": "Molecular carcinogenesis", "date": "2019", "authors": "Yoo SM, Lee CJ, Kang HC, Lee HS, Lee JY, Kim KD, Kim DJ, An HJ, Cho YY", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "30887599", "url": "https://glygen.org/publication/PubMed/30887599" } ] }, { "title": "PDIA6 modulates apoptosis and autophagy of non-small cell lung cancer cells via the MAP4K1/JNK signaling pathway.", "journal": "EBioMedicine", "date": "2019", "authors": "Bai Y, Liu X, Qi X, Liu X, Peng F, Li H, Fu H, Pei S, Chen L, Chi X, Zhang L, Zhu X, Song Y, Wang Y, Meng S, Jiang T, Shao S", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "30922965", "url": "https://glygen.org/publication/PubMed/30922965" } ] }, { "title": "Identification of ARKL1 as a Negative Regulator of Epstein-Barr Virus Reactivation.", "journal": "Journal of virology", "date": "2019-10-15", "authors": "Siddiqi Umama Z, Vaidya Anup S, Li Xinliu, Marcon Edyta, Tsao Sai Wah, Greenblatt Jack, Frappier Lori", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "31341047", "url": "https://glygen.org/publication/PubMed/31341047" } ] }, { "title": "The Transcriptional Roles of ALK Fusion Proteins in Tumorigenesis.", "journal": "Cancers", "date": "2019", "authors": "Ducray SP, Natarajan K, Garland GD, Turner SD, Egger G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "31366041", "url": "https://glygen.org/publication/PubMed/31366041" } ] }, { "title": "O-GlcNAcylated c-Jun antagonizes ferroptosis via inhibiting GSH synthesis in liver cancer.", "journal": "Cellular signalling", "date": "2019", "authors": "Chen Y, Zhu G, Liu Y, Wu Q, Zhang X, Bian Z, Zhang Y, Pan Q, Sun F", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "31394193", "url": "https://glygen.org/publication/PubMed/31394193" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" }, { "database": "O-GlcNAc Atlas", "id": "P05412", "url": "https://oglcnac.org/atlas/detail/P05412" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "JNK-Dependent cJun Phosphorylation Mitigates TGF\u03b2- and EGF-Induced Pre-Malignant Breast Cancer Cell Invasion by Suppressing AP-1-Mediated Transcriptional Responses.", "journal": "Cells", "date": "2019-11-21", "authors": "Sundqvist Anders, Voytyuk Oleksandr, Hamdi Mohamed, Popeijus Herman E, van der Burgt Corina Bijlsma-, Janssen Josephine, Martens John W M, Moustakas Aristidis, Heldin Carl-Henrik, Ten Dijke Peter, van Dam Hans", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31766464", "url": "https://glygen.org/publication/PubMed/31766464" } ] }, { "title": "Overexpressed miR-200a promotes bladder cancer invasion through direct regulating Dicer/miR-16/JNK2/MMP-2 axis.", "journal": "Oncogene", "date": "2020-02", "authors": "Yang Rui, Xu Jiheng, Hua Xiaohui, Tian Zhongxian, Xie Qipeng, Li Jingxia, Jiang Guosong, Cohen Mitchell, Sun Hong, Huang Chuanshu", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31772330", "url": "https://glygen.org/publication/PubMed/31772330" } ] }, { "title": "ROR2 induces cell apoptosis via activating IRE1alpha/JNK/CHOP pathway in high-grade serous ovarian carcinoma in vitro and in vivo.", "journal": "Journal of translational medicine", "date": "2019", "authors": "Li R, Liu T, Shi J, Luan W, Wei X, Yu J, Mao H, Liu P", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31878941", "url": "https://glygen.org/publication/PubMed/31878941" } ] }, { "title": "Selenium-binding protein 1 transcriptionally activates p21 expression via p53-independent mechanism and its frequent reduction associates with poor prognosis in bladder cancer.", "journal": "Journal of translational medicine", "date": "2020-01-09", "authors": "Wang Yulei, Zhu Wenzhen, Chen Xiaoqing, Wei Guangnan, Jiang Guosong, Zhang Guochun", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31918717", "url": "https://glygen.org/publication/PubMed/31918717" } ] }, { "title": "JNK/AP1 Pathway Regulates MYC Expression and BCR Signaling through Ig Enhancers in Burkitt Lymphoma Cells.", "journal": "Journal of Cancer", "date": "2020", "authors": "Ding Xiaoling, Wang Xiaoying, Zhu Xueting, Zhang Jie, Zhu Yiqing, Shao Xiaoyi, Zhou Xiaorong", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31942184", "url": "https://glygen.org/publication/PubMed/31942184" } ] }, { "title": "Structure and chromosomal localization of the functional intronless human JUN protooncogene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Hattori K, Angel P, Le Beau M M, Karin M", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "3194415", "url": "https://glygen.org/publication/PubMed/3194415" } ] }, { "title": "Stress-induced lncRNA LASTR fosters cancer cell fitness by regulating the activity of the U4/U6 recycling factor SART3.", "journal": "Nucleic acids research", "date": "2020", "authors": "De Troyer L, Zhao P, Pastor T, Baietti MF, Barra J, Vendramin R, Dok R, Lechat B, Najm P, Van Haver D, Impens F, Leucci E, Sablina AA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31956895", "url": "https://glygen.org/publication/PubMed/31956895" } ] }, { "title": "Cycling hypoxia promotes a pro-inflammatory phenotype in macrophages via JNK/p65 signaling pathway.", "journal": "Scientific reports", "date": "2020-01-21", "authors": "Delprat Victor, Tellier C\u00e9line, Demazy Catherine, Raes Martine, Feron Olivier, Michiels Carine", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "31964911", "url": "https://glygen.org/publication/PubMed/31964911" } ] }, { "title": "c-Jun, Foxo3a, and c-Myc Transcription Factors are Key Regulators of ATP-Mediated Angiogenic Responses in Pulmonary Artery Vasa Vasorum Endothelial Cells.", "journal": "Cells", "date": "2020-02-11", "authors": "Strassheim Derek, Karoor Vijaya, Nijmeh Hala, Weston Philip, Lapel Martin, Schaack Jerome, Sullivan Timothy, Dempsey Edward C, Stenmark Kurt R, Gerasimovskaya Evgenia", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "32054096", "url": "https://glygen.org/publication/PubMed/32054096" } ] }, { "title": "Phosphorylation of vaccinia-related kinase 1 at threonine 386 transduces glucose stress signal in human liver cells.", "journal": "Bioscience reports", "date": "2020", "authors": "Yokobori K, Miyauchi Y, Williams JG, Negishi M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "32266931", "url": "https://glygen.org/publication/PubMed/32266931" } ] }, { "title": "Activation of c-Jun by human cytomegalovirus UL42 through JNK activation.", "journal": "PloS one", "date": "2020", "authors": "Koshizuka T, Inoue N", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "32369499", "url": "https://glygen.org/publication/PubMed/32369499" } ] }, { "title": "Long noncoding RNA MAPKAPK5-AS1 promotes colorectal cancer progression by cis-regulating the nearby gene MK5 and acting as a let-7f-1-3p sponge.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2020-07-20", "authors": "Yang Ting, Chen Wei-Cong, Shi Pei-Cong, Liu Man-Ru, Jiang Tao, Song Hu, Wang Jia-Qi, Fan Rui-Zhi, Pei Dong-Sheng, Song Jun", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "32690100", "url": "https://glygen.org/publication/PubMed/32690100" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Tandem Bioorthogonal Labeling Uncovers Endogenous Cotranslationally O-GlcNAc Modified Nascent Proteins.", "journal": "Journal of the American Chemical Society", "date": "2020", "authors": "Zhu Y, Willems LI, Salas D, Cecioni S, Wu WB, Foster LJ, Vocadlo DJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "32870666", "url": "https://glygen.org/publication/PubMed/32870666" } ] }, { "title": "Theabrownin Induces Apoptosis and Tumor Inhibition of Hepatocellular Carcinoma Huh7 Cells Through ASK1-JNK-c-Jun Pathway.", "journal": "OncoTargets and therapy", "date": "2020", "authors": "Xu Jiaan, Yan Bo, Zhang Lei, Zhou Li, Zhang Jin, Yu Wenhua, Dong Xiaoqiao, Yao Li, Shan Letian", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "32982289", "url": "https://glygen.org/publication/PubMed/32982289" } ] }, { "title": "Pyruvate Kinase M2 Promotes Prostate Cancer Metastasis Through Regulating ERK1/2-COX-2 Signaling.", "journal": "Frontiers in oncology", "date": "2020", "authors": "Guo Wenjing, Zhang Zhishuai, Li Guihuan, Lai Xiaoju, Gu Ruonan, Xu Wanfu, Chen Hua, Xing Zhe, Chen Liping, Qian Jiabi, Xu Shiyuan, Zeng Fangyin, Deng Fan", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "33117682", "url": "https://glygen.org/publication/PubMed/33117682" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Target protein deglycosylation in living cells by a nanobody-fused split O-GlcNAcase.", "journal": "Nature chemical biology", "date": "2021", "authors": "Ge Y, Ramirez DH, Yang B, D'Souza AK, Aonbangkhen C, Wong S, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "33686291", "url": "https://glygen.org/publication/PubMed/33686291" } ] }, { "title": "miR-190 promotes malignant transformation and\u00a0progression of human urothelial cells through CDKN1B/p27 inhibition.", "journal": "Cancer cell international", "date": "2021-04-29", "authors": "Huang Shirui, Hua Xiaohui, Kuang Mengjiao, Zhu Junlan, Mu Haiqi, Tian Zhongxian, Zheng Xiaoqun, Xie Qipeng", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "33926470", "url": "https://glygen.org/publication/PubMed/33926470" } ] }, { "title": "Stimulation of c-Jun/AP-1-Activity by the Cell Cycle Inhibitor p57Kip2.", "journal": "Frontiers in cell and developmental biology", "date": "2021", "authors": "Kullmann Michael Keith, Pegka Fragka, Ploner Christian, Hengst Ludger", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "33928088", "url": "https://glygen.org/publication/PubMed/33928088" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05412", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05412" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "LncRNA THRIL, transcriptionally activated by AP-1 and stabilized by METTL14-mediated m6A modification, accelerates LPS-evoked acute injury in alveolar epithelial cells.", "journal": "International immunopharmacology", "date": "2023-10", "authors": "Shi Qian, Li Zhiliang, Dong Yixin, Yang Guigui, Li Miao", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" } ], "reference": [ { "type": "PubMed", "id": "37543013", "url": "https://glygen.org/publication/PubMed/37543013" } ] }, { "title": "c-JUN is a barrier in hESC to cardiomyocyte transition.", "journal": "Life science alliance", "date": "2023-11", "authors": "Zhong Hui, Zhang Ran, Li Guihuan, Huang Ping, Zhang Yudan, Zhu Jieying, Kuang Junqi, Hutchins Andrew P, Qin Dajiang, Zhu Ping, Pei Duanqing, Li Dongwei", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" } ], "reference": [ { "type": "PubMed", "id": "37604584", "url": "https://glygen.org/publication/PubMed/37604584" } ] }, { "title": "Thrombin-Induced COX-2 Expression and PGE2 Synthesis in Human Tracheal Smooth Muscle Cells: Role of PKC\u03b4/Pyk2-Dependent AP-1 Pathway Modulation.", "journal": "International journal of molecular sciences", "date": "2023-10-13", "authors": "Yang Chien-Chung, Lee I-Ta, Lin Yan-Jyun, Wu Wen-Bin, Hsiao Li-Der, Yang Chuen-Mao", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" } ], "reference": [ { "type": "PubMed", "id": "37894811", "url": "https://glygen.org/publication/PubMed/37894811" } ] }, { "title": "Cooperation of MLL1 and Jun in controlling H3K4me3 on enhancers in colorectal cancer.", "journal": "Genome biology", "date": "2023-11-27", "authors": "Lin Xiang, Chen Ji-Dong, Wang Chen-Yu, Cai Zhen, Zhan Rui, Yang Chen, Zhang La-Ying, Li Lian-Yun, Xiao Yong, Chen Ming-Kai, Wu Min", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" } ], "reference": [ { "type": "PubMed", "id": "38012744", "url": "https://glygen.org/publication/PubMed/38012744" } ] }, { "title": "Homeobox Protein PROX1 Expression is Negatively Regulated by Histone Deacetylase 1 and c-JUN Complex in MDA-MB-231 Human Breast Cancer Cells.", "journal": "Folia biologica", "date": "2023", "authors": "Jeong Munki, Jung Euitaek, Oh Sukjin, Shin Soon Young", "evidence": [ { "database": "RefSeq", "id": "NP_002219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002219" } ], "reference": [ { "type": "PubMed", "id": "38206773", "url": "https://glygen.org/publication/PubMed/38206773" } ] }, { "title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7488013", "url": "https://glygen.org/publication/PubMed/7488013" } ] }, { "title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "1996", "authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7501971", "url": "https://glygen.org/publication/PubMed/7501971" } ] }, { "title": "Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Raingeaud J, Gupta S, Rogers JS, Dickens M, Han J, Ulevitch RJ, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7535770", "url": "https://glygen.org/publication/PubMed/7535770" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "The Mos/MAP kinase pathway stabilizes c-Fos by phosphorylation and augments its transforming activity in NIH 3T3 cells.", "journal": "The EMBO journal", "date": "1995", "authors": "Okazaki K, Sagata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ] }, { "title": "Preference of calcium-dependent interactions between calmodulin-like domains of calpain and calpastatin subdomains.", "journal": "FEBS letters", "date": "1995", "authors": "Takano E, Ma H, Yang HQ, Maki M, Hatanaka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "7698360", "url": "https://glygen.org/publication/PubMed/7698360" } ] }, { "title": "ATF-2 is preferentially activated by stress-activated protein kinases to mediate c-jun induction in response to genotoxic agents.", "journal": "The EMBO journal", "date": "1995", "authors": "van Dam H, Wilhelm D, Herr I, Steffen A, Herrlich P, Angel P", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "7737130", "url": "https://glygen.org/publication/PubMed/7737130" } ] }, { "title": "Modulation of cellular thermoresistance and actin filament stability accompanies phosphorylation-induced changes in the oligomeric structure of heat shock protein 27.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Lavoie JN, Lambert H, Hickey E, Weber LA, Landry J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7799959", "url": "https://glygen.org/publication/PubMed/7799959" } ] }, { "title": "Altering the specificity of signal transduction cascades: positive regulation of c-Jun transcriptional activity by protein kinase A.", "journal": "The EMBO journal", "date": "1994", "authors": "Smeal T, Hibi M, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "7813438", "url": "https://glygen.org/publication/PubMed/7813438" } ] }, { "title": "Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA.", "journal": "Nature", "date": "1995", "authors": "Glover JN, Harrison SC", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7816143", "url": "https://glygen.org/publication/PubMed/7816143" } ] }, { "title": "Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Morris SW, Kirstein MN, Valentine MB, Dittmer K, Shapiro DN, Look AT, Saltman DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "7824924", "url": "https://glygen.org/publication/PubMed/7824924" } ] }, { "title": "A retinoic acid-triggered cascade of HOXB1 gene activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ogura T, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7831296", "url": "https://glygen.org/publication/PubMed/7831296" } ] }, { "title": "MAPKs: new JNK expands the group.", "journal": "Trends in biochemical sciences", "date": "1994", "authors": "Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7855889", "url": "https://glygen.org/publication/PubMed/7855889" } ] }, { "title": "Lack of cyclin D-Cdk complexes in Rb-negative cells correlates with high levels of p16INK4/MTS1 tumour suppressor gene product.", "journal": "The EMBO journal", "date": "1995", "authors": "Parry D, Bates S, Mann DJ, Peters G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7859739", "url": "https://glygen.org/publication/PubMed/7859739" } ] }, { "title": "Stress-activated protein kinases bind directly to the delta domain of c-Jun in resting cells: implications for repression of c-Jun function.", "journal": "Oncogene", "date": "1995", "authors": "Dai T, Rubie E, Franklin CC, Kraft A, Gillespie DA, Avruch J, Kyriakis JM, Woodgett JR", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "7898927", "url": "https://glygen.org/publication/PubMed/7898927" } ] }, { "title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.", "journal": "Blood", "date": "1994", "authors": "Sengupta PK, Lavelle DE, DeSimone J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7906964", "url": "https://glygen.org/publication/PubMed/7906964" } ] }, { "title": "Regulation of the human HOXD4 gene by retinoids.", "journal": "Mechanisms of development", "date": "1993", "authors": "Moroni MC, Vigano MA, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7908827", "url": "https://glygen.org/publication/PubMed/7908827" } ] }, { "title": "c-Jun N-terminal phosphorylation correlates with activation of the JNK subgroup but not the ERK subgroup of mitogen-activated protein kinases.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Minden A, Lin A, Smeal T, Derijard B, Cobb M, Davis R, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "7935387", "url": "https://glygen.org/publication/PubMed/7935387" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Activation of stress-activated protein kinase by MEKK1 phosphorylation of its activator SEK1.", "journal": "Nature", "date": "1994", "authors": "Yan M, Dai T, Deak JC, Kyriakis JM, Zon LI, Woodgett JR, Templeton DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7997270", "url": "https://glygen.org/publication/PubMed/7997270" } ] }, { "title": "Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.", "journal": "Genes & development", "date": "1994", "authors": "Guan KL, Jenkins CW, Li Y, Nichols MA, Wu X, O'Keefe CL, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8001816", "url": "https://glygen.org/publication/PubMed/8001816" } ] }, { "title": "Oncogenic Ras activates c-Jun via a separate pathway from the activation of extracellular signal-regulated kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Westwick JK, Cox AD, Der CJ, Cobb MH, Hibi M, Karin M, Brenner DA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8016110", "url": "https://glygen.org/publication/PubMed/8016110" } ] }, { "title": "Transcriptional activation by the v-Jun oncoprotein is independent of positive regulatory phosphorylation.", "journal": "Oncogene", "date": "1994", "authors": "Black EJ, Catling AD, Woodgett JR, Kilbey A, Gillespie DA", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8036019", "url": "https://glygen.org/publication/PubMed/8036019" } ] }, { "title": "c-Fos transcriptional activity stimulated by H-Ras-activated protein kinase distinct from JNK and ERK.", "journal": "Nature", "date": "1994", "authors": "Deng T, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8072547", "url": "https://glygen.org/publication/PubMed/8072547" } ] }, { "title": "p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.", "journal": "Nature", "date": "1994", "authors": "Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8078588", "url": "https://glygen.org/publication/PubMed/8078588" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "JNK1: a protein kinase stimulated by UV light and Ha-Ras that binds and phosphorylates the c-Jun activation domain.", "journal": "Cell", "date": "1994", "authors": "Derijard B, Hibi M, Wu IH, Barrett T, Su B, Deng T, Karin M, Davis RJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8137421", "url": "https://glygen.org/publication/PubMed/8137421" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Identification of an oncoprotein- and UV-responsive protein kinase that binds and potentiates the c-Jun activation domain.", "journal": "Genes & development", "date": "1993", "authors": "Hibi M, Lin A, Smeal T, Minden A, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8224842", "url": "https://glygen.org/publication/PubMed/8224842" } ] }, { "title": "Transcription factors NF-IL6 and NF-kappa B synergistically activate transcription of the inflammatory cytokines, interleukin 6 and interleukin 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Matsusaka T, Fujikawa K, Nishio Y, Mukaida N, Matsushima K, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8234276", "url": "https://glygen.org/publication/PubMed/8234276" } ] }, { "title": "A new regulatory motif in cell-cycle control causing specific inhibition of cyclin D/CDK4.", "journal": "Nature", "date": "1993", "authors": "Serrano M, Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8259215", "url": "https://glygen.org/publication/PubMed/8259215" } ] }, { "title": "The p53-mdm-2 autoregulatory feedback loop.", "journal": "Genes & development", "date": "1993", "authors": "Wu X, Bayle JH, Olson D, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8319905", "url": "https://glygen.org/publication/PubMed/8319905" } ] }, { "title": "In vivo protein-DNA interactions at the c-jun promoter: preformed complexes mediate the UV response.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Rozek D, Pfeifer GP", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8355696", "url": "https://glygen.org/publication/PubMed/8355696" } ] }, { "title": "Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Nakajima T, Kinoshita S, Sasagawa T, Sasaki K, Naruto M, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8384717", "url": "https://glygen.org/publication/PubMed/8384717" } ] }, { "title": "NF-kappa B subunit-specific regulation of the interleukin-8 promoter.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Kunsch C, Rosen CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413215", "url": "https://glygen.org/publication/PubMed/8413215" } ] }, { "title": "Distinct mechanisms for regulation of the interleukin-8 gene involve synergism and cooperativity between C/EBP and NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Stein B, Baldwin AS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413306", "url": "https://glygen.org/publication/PubMed/8413306" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Co-purification of mitogen-activated protein kinases with phorbol ester-induced c-Jun kinase activity in U937 leukaemic cells.", "journal": "Oncogene", "date": "1993", "authors": "Pulverer BJ, Hughes K, Franklin CC, Kraft AS, Leevers SJ, Woodgett JR", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8426747", "url": "https://glygen.org/publication/PubMed/8426747" } ] }, { "title": "c-Jun is phosphorylated by the DNA-dependent protein kinase in vitro; definition of the minimal kinase recognition motif.", "journal": "Nucleic acids research", "date": "1993", "authors": "Bannister AJ, Gottlieb TM, Kouzarides T, Jackson SP", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8464713", "url": "https://glygen.org/publication/PubMed/8464713" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Interleukin-1 alpha activates an NF-kappaB-like factor in osteoclast-like cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8617720", "url": "https://glygen.org/publication/PubMed/8617720" } ] }, { "title": "MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Raingeaud J, Whitmarsh AJ, Barrett T, Derijard B, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622669", "url": "https://glygen.org/publication/PubMed/8622669" } ] }, { "title": "3pK, a new mitogen-activated protein kinase-activated protein kinase located in the small cell lung cancer tumor suppressor gene region.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Sithanandam G, Latif F, Duh FM, Bernal R, Smola U, Li H, Kuzmin I, Wixler V, Geil L, Shrestha S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622688", "url": "https://glygen.org/publication/PubMed/8622688" } ] }, { "title": "Identification of mitogen-activated protein (MAP) kinase-activated protein kinase-3, a novel substrate of CSBP p38 MAP kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "McLaughlin MM, Kumar S, McDonnell PC, Van Horn S, Lee JC, Livi GP, Young PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8626550", "url": "https://glygen.org/publication/PubMed/8626550" } ] }, { "title": "Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Fujimoto J, Shiota M, Iwahara T, Seki N, Satoh H, Mori S, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "8633037", "url": "https://glygen.org/publication/PubMed/8633037" } ] }, { "title": "Selective interaction of JNK protein kinase isoforms with transcription factors.", "journal": "The EMBO journal", "date": "1996", "authors": "Gupta S, Barrett T, Whitmarsh AJ, Cavanagh J, Sluss HK, Derijard B, Davis RJ", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8654373", "url": "https://glygen.org/publication/PubMed/8654373" } ] }, { "title": "High resolution NMR solution structure of the leucine zipper domain of the c-Jun homodimer.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Junius F K, O'Donoghue S I, Nilges M, Weiss A S, King G F", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "8662824", "url": "https://glygen.org/publication/PubMed/8662824" } ] }, { "title": "Syk-dependent phosphorylation of Shc. A potential link between FcepsilonRI and the Ras/mitogen-activated protein kinase signaling pathway through SOS and Grb2.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jabril-Cuenod B, Zhang C, Scharenberg AM, Paolini R, Numerof R, Beaven MA, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8663278", "url": "https://glygen.org/publication/PubMed/8663278" } ] }, { "title": "Cross-talk between different enhancer elements during mitogenic induction of the human stromelysin-1 gene.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Kirstein M, Sanz L, Qui\u00f1ones S, Moscat J, Diaz-Meco M T, Saus J", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "8663478", "url": "https://glygen.org/publication/PubMed/8663478" } ] }, { "title": "Vav and SLP-76 interact and functionally cooperate in IL-2 gene activation.", "journal": "Immunity", "date": "1996", "authors": "Wu J, Motto DG, Koretzky GA, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8673706", "url": "https://glygen.org/publication/PubMed/8673706" } ] }, { "title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.", "journal": "Development (Cambridge, England)", "date": "1996", "authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8674428", "url": "https://glygen.org/publication/PubMed/8674428" } ] }, { "title": "The transcription factor AP-1 binds to the human interleukin 1 alpha promoter.", "journal": "European cytokine network", "date": "1996", "authors": "Bailly S, Fay M, Israel N, Gougerot-Pocidalo MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8688489", "url": "https://glygen.org/publication/PubMed/8688489" } ] }, { "title": "Phosphorylation of SLP-76 by the ZAP-70 protein-tyrosine kinase is required for T-cell receptor function.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bubeck Wardenburg J, Fu C, Jackman JK, Flotow H, Wilkinson SE, Williams DH, Johnson R, Kong G, Chan AC, Findell PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8702662", "url": "https://glygen.org/publication/PubMed/8702662" } ] }, { "title": "Isolation and characterization of p19INK4d, a p16-related inhibitor specific to CDK6 and CDK4.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Guan KL, Jenkins CW, Li Y, O'Keefe CL, Noh S, Wu X, Zariwala M, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8741839", "url": "https://glygen.org/publication/PubMed/8741839" } ] }, { "title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.", "journal": "Nucleic acids research", "date": "1996", "authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8759021", "url": "https://glygen.org/publication/PubMed/8759021" } ] }, { "title": "A comparison of the substrate specificity of MAPKAP kinase-2 and MAPKAP kinase-3 and their activation by cytokines and cellular stress.", "journal": "FEBS letters", "date": "1996", "authors": "Clifton AD, Young PR, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8774846", "url": "https://glygen.org/publication/PubMed/8774846" } ] }, { "title": "A new group of conserved coactivators that increase the specificity of AP-1 transcription factors.", "journal": "Nature", "date": "1996", "authors": "Claret FX, Hibi M, Dhut S, Toda T, Karin M", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "8837781", "url": "https://glygen.org/publication/PubMed/8837781" } ] }, { "title": "Identification of novel phosphorylation sites required for activation of MAPKAP kinase-2.", "journal": "The EMBO journal", "date": "1995", "authors": "Ben-Levy R, Leighton IA, Doza YN, Attwood P, Morrice N, Marshall CJ, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8846784", "url": "https://glygen.org/publication/PubMed/8846784" } ] }, { "title": "Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Enslen H, Tokumitsu H, Stork PJ, Davis RJ, Soderling TR", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "8855261", "url": "https://glygen.org/publication/PubMed/8855261" } ] }, { "title": "Phosphorylation-dependent targeting of c-Jun ubiquitination by Jun N-kinase.", "journal": "Oncogene", "date": "1996", "authors": "Fuchs SY, Dolan L, Davis RJ, Ronai Z", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "8875991", "url": "https://glygen.org/publication/PubMed/8875991" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Notch3 mutations in CADASIL, a hereditary adult-onset condition causing stroke and dementia.", "journal": "Nature", "date": "1996", "authors": "Joutel A, Corpechot C, Ducros A, Vahedi K, Chabriat H, Mouton P, Alamowitch S, Domenga V, Cecillion M, Marechal E, Maciazek J, Vayssiere C, Cruaud C, Cabanis EA, Ruchoux MM, Weissenbach J, Bach JF, Bousser MG, Tournier-Lasserve E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "8878478", "url": "https://glygen.org/publication/PubMed/8878478" } ] }, { "title": "Dermatotoxic chemical stimulate of c-jun and c-fos transcription and AP-1 DNA binding in human keratinocytes.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1996", "authors": "Burleson FG, Simeonova PP, Germolec DR, Luster MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8884985", "url": "https://glygen.org/publication/PubMed/8884985" } ] }, { "title": "An AP-1 site is involved in the NGF induction of IL-1 alpha in PC12 cells.", "journal": "Neurochemistry international", "date": "1996", "authors": "Alheim K, McDowell TL, Symons JA, Duff GW, Bartfai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8939459", "url": "https://glygen.org/publication/PubMed/8939459" } ] }, { "title": "Roles for Rac1 and Cdc42 in planar polarization and hair outgrowth in the wing of Drosophila.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Eaton S, Wepf R, Simons K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "8947551", "url": "https://glygen.org/publication/PubMed/8947551" } ] }, { "title": "Induction of apoptosis by ASK1, a mammalian MAPKKK that activates SAPK/JNK and p38 signaling pathways.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Ichijo H, Nishida E, Irie K, ten Dijke P, Saitoh M, Moriguchi T, Takagi M, Matsumoto K, Miyazono K, Gotoh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8974401", "url": "https://glygen.org/publication/PubMed/8974401" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "SLP-76 is a substrate of the high affinity IgE receptor-stimulated protein tyrosine kinases in rat basophilic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hendricks-Taylor LR, Motto DG, Zhang J, Siraganian RP, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8995445", "url": "https://glygen.org/publication/PubMed/8995445" } ] }, { "title": "Regulatory mechanisms involved in activator-protein-1 (AP-1)-mediated activation of glutathione-S-transferase gene expression by chemical agents.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Ainbinder E, Bergelson S, Pinkus R, Daniel V", "evidence": [ { "database": "Reactome", "id": "R-HSA-450341", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341" } ], "reference": [ { "type": "PubMed", "id": "9030721", "url": "https://glygen.org/publication/PubMed/9030721" } ] }, { "title": "p53 activates Fanconi anemia group C gene expression.", "journal": "Human molecular genetics", "date": "1997", "authors": "Liebetrau W, Budde A, Savoia A, Grummt F, Hoehn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "9063748", "url": "https://glygen.org/publication/PubMed/9063748" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "The Jun kinase/stress-activated protein kinase pathway functions to regulate DNA repair and inhibition of the pathway sensitizes tumor cells to cisplatin.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Potapova O, Haghighi A, Bost F, Liu C, Birrer MJ, Gjerset R, Mercola D", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9162025", "url": "https://glygen.org/publication/PubMed/9162025" } ] }, { "title": "Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Deacon K, Blank JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9162092", "url": "https://glygen.org/publication/PubMed/9162092" } ] }, { "title": "Magnitude of protein tyrosine phosphorylation-linked signals determines growth versus death of thymic T lymphocytes.", "journal": "European journal of immunology", "date": "1997", "authors": "Akhand AA, Pu M, Du J, Kato M, Suzuki H, Hamaguchi M, Nakashima I", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9174618", "url": "https://glygen.org/publication/PubMed/9174618" } ] }, { "title": "A novel mechanism of JNK1 activation. Nuclear translocation and activation of JNK1 during ischemia and reperfusion.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizukami Y, Yoshioka K, Morimoto S, Yoshida Ki", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9195981", "url": "https://glygen.org/publication/PubMed/9195981" } ] }, { "title": "Shc contains two Grb2 binding sites needed for efficient formation of complexes with SOS in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Harmer SL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9199344", "url": "https://glygen.org/publication/PubMed/9199344" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Di Rocco G, Mavilio F, Zappavigna V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9218805", "url": "https://glygen.org/publication/PubMed/9218805" } ] }, { "title": "Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.", "journal": "Nature structural biology", "date": "1997", "authors": "Lin GD, Chattopadhyay D, Maki M, Wang KK, Carson M, Jin L, Yuen PW, Takano E, Hatanaka M, DeLucas LJ, Narayana SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "9228946", "url": "https://glygen.org/publication/PubMed/9228946" } ] }, { "title": "HOXD4 and regulation of the group 4 paralog genes.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9272954", "url": "https://glygen.org/publication/PubMed/9272954" } ] }, { "title": "Ligation of membrane IgM stimulates a novel c-Jun amino-terminal domain kinase activity in Daudi human B cells.", "journal": "Molecular immunology", "date": "1997", "authors": "Li X, Franklin CC, Kraft AS, Carter RH", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9293774", "url": "https://glygen.org/publication/PubMed/9293774" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Activated phosphatidylinositol 3-kinase and Akt kinase promote survival of superior cervical neurons.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Philpott KL, McCarthy MJ, Klippel A, Rubin LL", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9348296", "url": "https://glygen.org/publication/PubMed/9348296" } ] }, { "title": "Cells transformed by ODC, c-Ha-ras and v-src exhibit MAP kinase/Erk-independent constitutive phosphorylation of Sos, Raf and c-Jun activation domain, and reduced PDGF receptor expression.", "journal": "Oncogene", "date": "1997", "authors": "Paasinen-Sohns A, Holtta E", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9365242", "url": "https://glygen.org/publication/PubMed/9365242" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "Nuclear hormone receptor antagonism with AP-1 by inhibition of the JNK pathway.", "journal": "Genes & development", "date": "1997-12-15", "authors": "Caelles C, Gonz\u00e1lez-Sancho J M, Mu\u00f1oz A", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9407028", "url": "https://glygen.org/publication/PubMed/9407028" } ] }, { "title": "The JUN kinase/stress-activated protein kinase pathway is required for epidermal growth factor stimulation of growth of human A549 lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Bost F, McKay R, Dean N, Mercola D", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9407138", "url": "https://glygen.org/publication/PubMed/9407138" } ] }, { "title": "Phosphorylation of c-Jun is necessary for apoptosis induced by survival signal withdrawal in cerebellar granule neurons.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998", "authors": "Watson A, Eilers A, Lallemand D, Kyriakis J, Rubin LL, Ham J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9425017", "url": "https://glygen.org/publication/PubMed/9425017" } ] }, { "title": "Role of the Jun kinase pathway in the regulation of c-Jun expression and apoptosis in sympathetic neurons.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998", "authors": "Eilers A, Whitfield J, Babij C, Rubin LL, Ham J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9464996", "url": "https://glygen.org/publication/PubMed/9464996" } ] }, { "title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.", "journal": "The EMBO journal", "date": "1998", "authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9482740", "url": "https://glygen.org/publication/PubMed/9482740" } ] }, { "title": "Bone-specific expression of the alpha chain of the nascent polypeptide-associated complex, a coactivator potentiating c-Jun-mediated transcription.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Moreau A, Yotov WV, Glorieux FH, St-Arnaud R", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9488446", "url": "https://glygen.org/publication/PubMed/9488446" } ] }, { "title": "The small GTP-binding protein Cdc42 is required for nerve growth factor withdrawal-induced neuronal death.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Bazenet CE, Mota MA, Rubin LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "9520479", "url": "https://glygen.org/publication/PubMed/9520479" } ] }, { "title": "ARF promotes MDM2 degradation and stabilizes p53: ARF-INK4a locus deletion impairs both the Rb and p53 tumor suppression pathways.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, Xiong Y, Yarbrough WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9529249", "url": "https://glygen.org/publication/PubMed/9529249" } ] }, { "title": "Interaction of Rac1 with GTPase-activating proteins and putative effectors. A comparison with Cdc42 and RhoA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang B, Chernoff J, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9535855", "url": "https://glygen.org/publication/PubMed/9535855" } ] }, { "title": "Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1.", "journal": "The EMBO journal", "date": "1998", "authors": "Saitoh M, Nishitoh H, Fujii M, Takeda K, Tobiume K, Sawada Y, Kawabata M, Miyazono K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9564042", "url": "https://glygen.org/publication/PubMed/9564042" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "Differential activation of stress-activated protein kinase kinases SKK4/MKK7 and SKK1/MKK4 by the mixed-lineage kinase-2 and mitogen-activated protein kinase kinase (MKK) kinase-1.", "journal": "The Biochemical journal", "date": "1998", "authors": "Cuenda A, Dorow DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9639556", "url": "https://glygen.org/publication/PubMed/9639556" } ] }, { "title": "Lasting N-terminal phosphorylation of c-Jun and activation of c-Jun N-terminal kinases after neuronal injury.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998", "authors": "Herdegen T, Claret FX, Kallunki T, Martin-Villalba A, Winter C, Hunter T, Karin M", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9651196", "url": "https://glygen.org/publication/PubMed/9651196" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "Dishevelled activates JNK and discriminates between JNK pathways in planar polarity and wingless signaling.", "journal": "Cell", "date": "1998", "authors": "Boutros M, Paricio N, Strutt DI, Mlodzik M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "9674432", "url": "https://glygen.org/publication/PubMed/9674432" } ] }, { "title": "Placement of the BCL2 family member BAX in the death pathway of sympathetic neurons activated by trophic factor deprivation.", "journal": "Experimental neurology", "date": "1998", "authors": "Deckwerth TL, Easton RM, Knudson CM, Korsmeyer SJ, Johnson EM Jr", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9682022", "url": "https://glygen.org/publication/PubMed/9682022" } ] }, { "title": "Differential regulation of c-Jun by ERK and JNK during PC12 cell differentiation.", "journal": "The EMBO journal", "date": "1998", "authors": "Leppa S, Saffrich R, Ansorge W, Bohmann D", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9687508", "url": "https://glygen.org/publication/PubMed/9687508" } ] }, { "title": "Cloning, characterization, and the complete 56.8-kilobase DNA sequence of the human NOTCH4 gene.", "journal": "Genomics", "date": "1998", "authors": "Li L, Huang GM, Banta AB, Deng Y, Smith T, Dong P, Friedman C, Chen L, Trask BJ, Spies T, Rowen L, Hood L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "9693032", "url": "https://glygen.org/publication/PubMed/9693032" } ] }, { "title": "Differential recruitment of Dishevelled provides signaling specificity in the planar cell polarity and Wingless signaling pathways.", "journal": "Genes & development", "date": "1998", "authors": "Axelrod JD, Miller JR, Shulman JM, Moon RT, Perrimon N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673324", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324" } ], "reference": [ { "type": "PubMed", "id": "9716412", "url": "https://glygen.org/publication/PubMed/9716412" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription.", "journal": "Nature", "date": "1998", "authors": "Zhang Y, Feng X H, Derynck R", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "reference": [ { "type": "PubMed", "id": "9732876", "url": "https://glygen.org/publication/PubMed/9732876" } ] }, { "title": "Insulin-stimulated expression of c-fos, fra1 and c-jun accompanies the activation of the activator protein-1 (AP-1) transcriptional complex.", "journal": "The Biochemical journal", "date": "1998", "authors": "Griffiths MR, Black EJ, Culbert AA, Dickens M, Shaw PE, Gillespie DA, Tavare JM", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9742208", "url": "https://glygen.org/publication/PubMed/9742208" } ] }, { "title": "Cyclin D3: requirement for G1/S transition and high abundance in quiescent tissues suggest a dual role in proliferation and differentiation.", "journal": "Oncogene", "date": "1998", "authors": "Bartkova J, Lukas J, Strauss M, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9747882", "url": "https://glygen.org/publication/PubMed/9747882" } ] }, { "title": "Nuclear export of the stress-activated protein kinase p38 mediated by its substrate MAPKAP kinase-2.", "journal": "Current biology : CB", "date": "1998", "authors": "Ben-Levy R, Hooper S, Wilson R, Paterson HF, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9768359", "url": "https://glygen.org/publication/PubMed/9768359" } ] }, { "title": "Identification of a novel stress activated kinase in kidney and heart.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "De Silva H, Cioffi C, Yin T, Sandhu G, Webb RL, Whelan J", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9784400", "url": "https://glygen.org/publication/PubMed/9784400" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Bai RY, Dieter P, Peschel C, Morris SW, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "9819383", "url": "https://glygen.org/publication/PubMed/9819383" } ] }, { "title": "Erk-independent partial activation of AP-1 sites by the hepatitis B virus HBx protein.", "journal": "The Journal of general virology", "date": "1998", "authors": "Henkler F, Lopes AR, Jones M, Koshy R", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9820149", "url": "https://glygen.org/publication/PubMed/9820149" } ] }, { "title": "Mdm2 association with p53 targets its ubiquitination.", "journal": "Oncogene", "date": "1998", "authors": "Fuchs SY, Adler V, Buschmann T, Wu X, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9824166", "url": "https://glygen.org/publication/PubMed/9824166" } ] }, { "title": "c-Jun regulates cell cycle progression and apoptosis by distinct mechanisms.", "journal": "The EMBO journal", "date": "1999", "authors": "Wisdom R, Johnson RS, Moore C", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9878062", "url": "https://glygen.org/publication/PubMed/9878062" } ] }, { "title": "c-Jun is a JNK-independent coactivator of the PU.1 transcription factor.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Behre G, Whitmarsh AJ, Coghlan MP, Hoang T, Carpenter CL, Zhang DE, Davis RJ, Tenen DG", "evidence": [ { "database": "iPTMnet", "id": "P05412", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05412" } ], "reference": [ { "type": "PubMed", "id": "9988737", "url": "https://glygen.org/publication/PubMed/9988737" } ] }, { "title": "Mechanism of activation of Pak1 kinase by membrane localization.", "journal": "Oncogene", "date": "1999", "authors": "Lu W, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9989831", "url": "https://glygen.org/publication/PubMed/9989831" } ] } ], "pathway": [ { "id": "hsa:3725", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3725", "resource": "KEGG Pathway" }, { "id": "R-HSA-1912408", "name": "Pre-NOTCH Transcription and Translation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "resource": "Reactome", "description": "Pre-NOTCH Transcription and Translation" }, { "id": "R-HSA-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-HSA-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-HSA-2871796", "name": "FCERI mediated MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "resource": "Reactome", "description": "FCERI mediated MAPK activation" }, { "id": "R-HSA-450341", "name": "Activation of the AP-1 family of transcription factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450341", "resource": "Reactome", "description": "Activation of the AP-1 family of transcription factors" }, { "id": "R-HSA-5617472", "name": "Activation of anterior HOX genes in hindbrain development during early embryogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "resource": "Reactome", "description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis" }, { "id": "R-HSA-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-HSA-6796648", "name": "TP53 Regulates Transcription of DNA Repair Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648", "resource": "Reactome", "description": "TP53 Regulates Transcription of DNA Repair Genes" }, { "id": "R-HSA-8862803", "name": "Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803", "resource": "Reactome", "description": "Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models" }, { "id": "R-HSA-8943724", "name": "Regulation of PTEN gene transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724", "resource": "Reactome", "description": "Regulation of PTEN gene transcription" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9673324", "name": "WNT5:FZD7-mediated leishmania damping", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673324", "resource": "Reactome", "description": "WNT5:FZD7-mediated leishmania damping" }, { "id": "R-HSA-9725370", "name": "Signaling by ALK fusions and activated point mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370", "resource": "Reactome", "description": "Signaling by ALK fusions and activated point mutants" } ], "orthologs": [ { "uniprot_canonical_ac": "P05627-1", "protein_name": "Transcription factor Jun", "gene_name": "Jun", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF", "length": 334 }, "evidence": [ { "id": "45924303", "url": "http://www.informatics.jax.org/homology/45924303", "database": "MGI" }, { "id": "P05412", "url": "https://omabrowser.org/oma/group/P05412/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P17325-1", "protein_name": "Transcription factor Jun", "gene_name": "Jun", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF", "length": 334 }, "evidence": [ { "id": "45924303", "url": "http://www.informatics.jax.org/homology/45924303", "database": "MGI" }, { "id": "P05412", "url": "https://omabrowser.org/oma/group/P05412/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "release from viral latency", "id": "GO:0019046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019046", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "transforming growth factor beta receptor signaling pathway", "id": "GO:0007179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007179", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "SMAD protein signal transduction", "id": "GO:0060395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060395", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation of vascular associated smooth muscle cell proliferation", "id": "GO:1904707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904707", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "cellular response to reactive oxygen species", "id": "GO:0034614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034614", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "cellular response to cadmium ion", "id": "GO:0071276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071276", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress", "id": "GO:1990441", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990441", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "negative regulation by host of viral transcription", "id": "GO:0043922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043922", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation by host of viral transcription", "id": "GO:0043923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043923", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "regulation of cell cycle", "id": "GO:0051726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051726", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription initiation", "id": "GO:2000144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000144", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "negative regulation of DNA binding", "id": "GO:0043392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043392", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "integrated stress response signaling", "id": "GO:0140467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140467", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 18, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "GTPase activator activity", "id": "GO:0005096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "cAMP response element binding", "id": "GO:0035497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035497", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "R-SMAD binding", "id": "GO:0070412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070412", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "ubiquitin-like protein ligase binding", "id": "GO:0044389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044389", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "general transcription initiation factor binding", "id": "GO:0140296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140296", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "nuclear chromosome", "id": "GO:0000228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000228", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" }, { "name": "transcription factor AP-1 complex", "id": "GO:0035976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035976", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 15, "end_pos": 17, "annotation": "n_glycosylation_sequon" }, { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated at Lys-271 by EP300.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "11689449", "url": "https://glygen.org/publication/PubMed/11689449" } ] }, { "annotation": "Phosphorylated by CaMK4 and PRKDC; phosphorylation enhances the transcriptional activity. Phosphorylated by HIPK3. Phosphorylated by DYRK2 at Ser-243; this primes the protein for subsequent phosphorylation by GSK3B at Thr-239. Phosphorylated at Thr-239, Ser-243 and Ser-249 by GSK3B; phosphorylation reduces its ability to bind DNA. Phosphorylated by PAK2 at Thr-2, Thr-8, Thr-89, Thr-93 and Thr-286 thereby promoting JUN-mediated cell proliferation and transformation. Phosphorylated by PLK3 following hypoxia or UV irradiation, leading to increase DNA-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" }, { "database": "PubMed", "id": "8855261", "url": "https://glygen.org/publication/PubMed/8855261" }, { "database": "PubMed", "id": "21177766", "url": "https://glygen.org/publication/PubMed/21177766" }, { "database": "PubMed", "id": "8464713", "url": "https://glygen.org/publication/PubMed/8464713" }, { "database": "PubMed", "id": "17210646", "url": "https://glygen.org/publication/PubMed/17210646" }, { "database": "PubMed", "id": "22307329", "url": "https://glygen.org/publication/PubMed/22307329" }, { "database": "PubMed", "id": "1846781", "url": "https://glygen.org/publication/PubMed/1846781" }, { "database": "PubMed", "id": "17804415", "url": "https://glygen.org/publication/PubMed/17804415" }, { "database": "PubMed", "id": "18650425", "url": "https://glygen.org/publication/PubMed/18650425" } ] }, { "annotation": "Ubiquitinated by the SCF(FBXW7), leading to its degradation (PubMed:14739463, PubMed:27458189). Ubiquitination takes place following phosphorylation, that promotes interaction with FBXW7 (PubMed:14739463).", "evidence": [ { "database": "UniProtKB", "id": "P05412", "url": "https://www.uniprot.org/uniprot/P05412" }, { "database": "PubMed", "id": "14739463", "url": "https://glygen.org/publication/PubMed/14739463" }, { "database": "PubMed", "id": "27458189", "url": "https://glygen.org/publication/PubMed/27458189" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 73, 83, 84, 90, 91, 95, 131, 132 ], "snv_sites": [ 37, 73, 91, 129, 131, 132, 140, 160, 177 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 8, 26, 58, 62, 63, 73, 89, 91, 93, 95, 131, 170, 231, 239, 243, 249, 286 ], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 15, "end_pos": 17 }, { "start_pos": 172, "end_pos": 174 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 54 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 817 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }