{ "uniprot_canonical_ac": "P05187-1", "uniprot_ac": "P05187", "uniprot_id": "PPB1_HUMAN", "mass": { "chemical_mass": 57954.0, "monoisotopic_mass": 57954.0 }, "refseq": { "ac": "NP_001623", "name": "alkaline phosphatase, placental type preproprotein", "summary": "The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. [provided by RefSeq, Aug 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" }, "gene_names": [ { "name": "ALPP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05187", "id": "P05187" }, { "name": "ALP; ALPI; IAP; PALP; PLAP; PLAP-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623", "id": "NP_001623" }, { "name": "ALPP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623", "id": "NP_001623" }, { "name": "PLAP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05187", "id": "P05187" } ], "protein_names": [ { "name": "Alkaline phosphatase, placental type", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05187" }, { "name": "3.1.3.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05187" }, { "name": "Alkaline phosphatase Regan isozyme", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05187" }, { "name": "PLAP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05187" }, { "name": "Placental alkaline phosphatase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05187" }, { "name": "alkaline phosphatase, placental type preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623", "id": "NP_001623" }, { "name": "alkaline phosphomonoesterase; glycerophosphatase; alkaline phosphatase, placental type; placental alkaline phosphatase 1; alkaline phosphatase Regan isozyme; Intestinal-type alkaline phosphatase; Intestinal alkaline phosphatase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623", "id": "NP_001623" } ], "function": [ { "annotation": "Alkaline Phosphatase is an Independent Risk Factor for Periprosthetic Fractures in Total Joint Arthroplasty. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" }, { "database": "PubMed", "id": "36763725", "url": "https://glygen.org/publication/PubMed/36763725" } ] }, { "annotation": "Alkaline phosphatase that can hydrolyze various phosphate compounds.", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187#function" }, { "database": "PubMed", "id": "25775211", "url": "https://glygen.org/publication/PubMed/25775211" }, { "database": "PubMed", "id": "1939159", "url": "https://glygen.org/publication/PubMed/1939159" } ] }, { "annotation": "Data indicate that p180 is required for the efficient targeting of placental alkaline phosphatase (ALPP) mRNA to the endoplasmic reticulum (ER).", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" }, { "database": "PubMed", "id": "24019514", "url": "https://glygen.org/publication/PubMed/24019514" } ] }, { "annotation": "Differential expression of Pl(1) and Pl(2) probably results from linkage disequilibrium with the sequence variation rs2014683G>A in the ALPP gene promoter that was shown to have allele-specific binding patterns to placental nuclear proteins.", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" }, { "database": "PubMed", "id": "20663553", "url": "https://glygen.org/publication/PubMed/20663553" } ] }, { "annotation": "Role of serum alkaline phosphatase as a potential biomarker of severity and prognosis in intracerebral hemorrhage.", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" }, { "database": "PubMed", "id": "37952310", "url": "https://glygen.org/publication/PubMed/37952310" } ] }, { "annotation": "Structure of placental alkaline phosphatase with pNPP contained only p-nitrophenol in three distinct sites, while the structure with 5'-AMP contained the p-nitrophenyl group in two of the sites instead of 5'-AMP", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" }, { "database": "PubMed", "id": "20693656", "url": "https://glygen.org/publication/PubMed/20693656" } ] }, { "annotation": "The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. [provided by RefSeq, Aug 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1170744134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170744134" }, { "id": "rs1170744134", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170744134" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 144, "end_pos": 144, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->HTT).", "chr_id": "2", "chr_pos": "232379633", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N144", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs146026871", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146026871" }, { "id": "rs146026871", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146026871" }, { "id": "rs146026871", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146026871" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 146, "end_pos": 146, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTI).", "chr_id": "2", "chr_pos": "232379640", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T146", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1269117429", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1269117429" }, { "id": "rs1269117429", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1269117429" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 169, "end_pos": 169, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TTT->NTT).", "chr_id": "2", "chr_pos": "232379785", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T169", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1487377668", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1487377668" }, { "id": "rs1487377668", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1487377668#frequency_tab" }, { "id": "rs1487377668", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1487377668" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 189, "end_pos": 189, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRN->NRS).", "chr_id": "2", "chr_pos": "232379845", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N189", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05187", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05187" } ], "glycoeffect": [], "start_pos": 209, "end_pos": 209, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "232379904", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A209", "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P05187", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05187" }, { "id": "rs1235031507", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1235031507" }, { "id": "rs1235031507", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1235031507" }, { "id": "rs1235031507", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1235031507#frequency_tab" }, { "id": "rs1235031507", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1235031507" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 271, "end_pos": 271, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "2", "chr_pos": "232380440", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "N271", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs148586042", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148586042" }, { "id": "rs148586042", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148586042" }, { "id": "rs148586042", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148586042#frequency_tab" }, { "id": "rs148586042", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148586042" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 272, "end_pos": 272, "sequence_org": "R", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NPT).", "chr_id": "2", "chr_pos": "232380442", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R272", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1225894542", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1225894542" }, { "id": "rs1225894542", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1225894542" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 273, "end_pos": 273, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRA).", "chr_id": "2", "chr_pos": "232380444", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T273", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1307945599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307945599" }, { "id": "rs1307945599", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1307945599#frequency_tab" }, { "id": "rs1307945599", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1307945599" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 273, "end_pos": 273, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRN).", "chr_id": "2", "chr_pos": "232380445", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T273", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05187", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05187" } ], "glycoeffect": [], "start_pos": 319, "end_pos": 319, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "2", "chr_pos": "232380712", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R319", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1393887224", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1393887224" }, { "id": "rs1393887224", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1393887224" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 379, "end_pos": 379, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DHS->NHS).", "chr_id": "2", "chr_pos": "232380974", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D379", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "36.8", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "27.66", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "70.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "37.69", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "37.81", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "35.09", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "34.46", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "42.92", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "27.84", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05187" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "common_name": "Human" } ], "gene": [ { "name": "ALPP", "url": "https://www.uniprot.org/uniprot/P05187", "locus": { "chromosome": "2", "start_pos": 232382889, "end_pos": 232378724, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000163283", "url": "https://www.ensembl.org/id/ENSG00000163283" } ] } } ], "crossref": [ { "id": "ENSG00000163283", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163283", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P05187", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05187", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "3.1.3.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.3.1&UniProtAcc=P05187", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd16012", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16012", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4458", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4458", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ALPP", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ALPP", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "250", "url": "https://www.ncbi.nlm.nih.gov/gene/250", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "439", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=439", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P05187", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05187*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018299", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018299", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:250", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:250", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "171800", "url": "http://www.omim.org/entry/171800", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P05187", "url": "https://www.nextprot.org/entry/NX_P05187", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NMPCSAR", "url": "https://omabrowser.org/oma/group/NMPCSAR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "35876at2759", "url": "http://www.orthodb.org/?query=35876at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11596", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11596", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11596:SF69", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11596:SF69", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1EW2", "url": "https://www.rcsb.org/structure/1EW2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZEB", "url": "https://www.rcsb.org/structure/1ZEB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZED", "url": "https://www.rcsb.org/structure/1ZED", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZEF", "url": "https://www.rcsb.org/structure/1ZEF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GLQ", "url": "https://www.rcsb.org/structure/2GLQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MK0", "url": "https://www.rcsb.org/structure/3MK0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MK1", "url": "https://www.rcsb.org/structure/3MK1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MK2", "url": "https://www.rcsb.org/structure/3MK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00245", "url": "http://pfam.xfam.org/family/PF00245", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P05187", "url": "https://pharos.nih.gov/targets/P05187", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P05187", "url": "http://purl.obolibrary.org/obo/PR_P05187", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "15017", "url": "https://www.rhea-db.org/rhea/15017", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05187-1", "url": "https://www.uniprot.org/uniprot/P05187-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP", "length": 535, "header": "sp|P05187-1|PPB1_HUMAN Isoform 1 of Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2 CANONICAL=P05187-1" }, "isoforms": [ { "isoform_ac": "P05187-1", "url": "", "sequence": { "sequence": "MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP", "length": 535, "header": "sp|P05187-1|PPB1_HUMAN Isoform 1 of Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2 CANONICAL=P05187-1" }, "locus": { "chromosome": "2", "start_pos": 232381792, "end_pos": 232378803, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000392027.3", "url": "https://www.ensembl.org/id/ENST00000392027.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000375881.2", "url": "https://www.ensembl.org/id/ENSP00000375881.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "P05187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05187#ptm_processing" }, { "id": "16815919", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16815919" }, { "id": "15946677", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15946677" }, { "id": "20693656", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20693656" }, { "id": "1EW2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1EW2" }, { "id": "1ZEB", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZEB" }, { "id": "1ZED", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZED" }, { "id": "1ZEF", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZEF" }, { "id": "2GLQ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2GLQ" }, { "id": "3MK0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3MK0" }, { "id": "3MK1", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3MK1" }, { "id": "3MK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3MK2" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "P05187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05187#ptm_processing" }, { "id": "16815919", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16815919" }, { "id": "15946677", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15946677" }, { "id": "20693656", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20693656" }, { "id": "1ZEB", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZEB" }, { "id": "1ZED", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZED" }, { "id": "1ZEF", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZEF" }, { "id": "2GLQ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2GLQ" }, { "id": "3MK0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3MK0" }, { "id": "3MK1", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3MK1" }, { "id": "3MK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3MK2" } ] } ], "phosphorylation": [ { "start_pos": 114, "end_pos": 114, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P05187", "url": "http://phospho.elm.eu.org/byAccession/P05187.html" } ], "site_lbl": "Ser114" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P05187", "url": "http://phospho.elm.eu.org/byAccession/P05187.html" } ], "site_lbl": "Thr117" }, { "start_pos": 119, "end_pos": 119, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr119" }, { "start_pos": 273, "end_pos": 273, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ], "site_lbl": "Thr273" }, { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser283" }, { "start_pos": 314, "end_pos": 314, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr314" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr410" }, { "start_pos": 415, "end_pos": 415, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr415" }, { "start_pos": 421, "end_pos": 421, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr421" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "GMAP-210, A cis-Golgi network-associated protein, is a minus end microtubule-binding protein.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Infante C, Ramos-Morales F, Fedriani C, Bornens M, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10189370", "url": "https://glygen.org/publication/PubMed/10189370" } ] }, { "title": "Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10652308", "url": "https://glygen.org/publication/PubMed/10652308" } ] }, { "title": "Turning on ARF: the Sec7 family of guanine-nucleotide-exchange factors.", "journal": "Trends in cell biology", "date": "2000", "authors": "Jackson CL, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10652516", "url": "https://glygen.org/publication/PubMed/10652516" } ] }, { "title": "Crystal structure of alkaline phosphatase from human placenta at 1.8 A resolution. Implication for a substrate specificity.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Le Du MH, Stigbrand T, Taussig MJ, Menez A, Stura EA", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "11124260", "url": "https://glygen.org/publication/PubMed/11124260" } ] }, { "title": "Identification of rabaptin-5, rabex-5, and GM130 as putative effectors of rab33b, a regulator of retrograde traffic between the Golgi apparatus and ER.", "journal": "FEBS letters", "date": "2001", "authors": "Valsdottir R, Hashimoto H, Ashman K, Koda T, Storrie B, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "11718716", "url": "https://glygen.org/publication/PubMed/11718716" } ] }, { "title": "Sorting of Golgi resident proteins into different subpopulations of COPI vesicles: a role for ArfGAP1.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Lanoix J, Ouwendijk J, Stark A, Szafer E, Cassel D, Dejgaard K, Weiss M, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "11748249", "url": "https://glygen.org/publication/PubMed/11748249" } ] }, { "title": "Function assignment to conserved residues in mammalian alkaline phosphatases.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Kozlenkov A, Manes T, Hoylaerts MF, Millan JL", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "11937510", "url": "https://glygen.org/publication/PubMed/11937510" } ] }, { "title": "The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Suvorova ES, Duden R, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12011112", "url": "https://glygen.org/publication/PubMed/12011112" } ] }, { "title": "The overexpression of GMAP-210 blocks anterograde and retrograde transport between the ER and the Golgi apparatus.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Pernet-Gallay K, Antony C, Johannes L, Bornens M, Goud B, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12383348", "url": "https://glygen.org/publication/PubMed/12383348" } ] }, { "title": "CASP, the alternatively spliced product of the gene encoding the CCAAT-displacement protein transcription factor, is a Golgi membrane protein related to giantin.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Gillingham AK, Pfeifer AC, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12429822", "url": "https://glygen.org/publication/PubMed/12429822" } ] }, { "title": "The GTPase Arf1p and the ER to Golgi cargo receptor Erv14p cooperate to recruit the golgin Rud3p to the cis-Golgi.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Gillingham AK, Tong AH, Boone C, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15504911", "url": "https://glygen.org/publication/PubMed/15504911" } ] }, { "title": "Golgin tethers define subpopulations of COPI vesicles.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Malsam J, Satoh A, Pelletier L, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15718469", "url": "https://glygen.org/publication/PubMed/15718469" } ] }, { "title": "Cog3p depletion blocks vesicle-mediated Golgi retrograde trafficking in HeLa cells.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Zolov SN, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15728195", "url": "https://glygen.org/publication/PubMed/15728195" } ] }, { "title": "Cisternal rab proteins regulate Golgi apparatus redistribution in response to hypotonic stress.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Jiang S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15758030", "url": "https://glygen.org/publication/PubMed/15758030" } ] }, { "title": "Structural studies of human placental alkaline phosphatase in complex with functional ligands.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Llinas P, Stura EA, Menez A, Kiss Z, Stigbrand T, Millan JL, Le Du MH", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187#ptm_processing" }, { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "15946677", "url": "https://glygen.org/publication/PubMed/15946677" } ] }, { "title": "Structural studies of human alkaline phosphatase in complex with strontium: implication for its secondary effect in bones.", "journal": "Protein science : a publication of the Protein Society", "date": "2006", "authors": "Llinas P, Masella M, Stigbrand T, Menez A, Stura EA, Le Du MH", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187#ptm_processing" }, { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "16815919", "url": "https://glygen.org/publication/PubMed/16815919" } ] }, { "title": "The interaction of two tethering factors, p115 and COG complex, is required for Golgi integrity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sohda M, Misumi Y, Yoshimura S, Nakamura N, Fusano T, Ogata S, Sakisaka S, Ikehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "17274799", "url": "https://glygen.org/publication/PubMed/17274799" } ] }, { "title": "Site-specific mutations in the COOH-terminus of placental alkaline phosphatase: a single amino acid change converts a phosphatidylinositol-glycan-anchored protein to a secreted protein.", "journal": "J. Cell Biol.", "date": "1992", "authors": "Lowe ME", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "1730777", "url": "https://glygen.org/publication/PubMed/1730777" } ] }, { "title": "Interaction of the conserved oligomeric Golgi complex with t-SNARE Syntaxin5a/Sed5 enhances intra-Golgi SNARE complex stability.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Shestakova A, Suvorova E, Pavliv O, Khaidakova G, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18086915", "url": "https://glygen.org/publication/PubMed/18086915" } ] }, { "title": "Large scale screening for novel rab effectors reveals unexpected broad Rab binding specificity.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "Fukuda M, Kanno E, Ishibashi K, Itoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18256213", "url": "https://glygen.org/publication/PubMed/18256213" } ] }, { "title": "Asymmetric tethering of flat and curved lipid membranes by a golgin.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Drin G, Morello V, Casella JF, Gounon P, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18451304", "url": "https://glygen.org/publication/PubMed/18451304" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "Mutation of a single amino acid converts germ cell alkaline phosphatase to placental alkaline phosphatase.", "journal": "The Journal of biological chemistry", "date": "1991-11-05", "authors": "Watanabe T, Wada N, Kim E E, Wyckoff H W, Chou J Y", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "1939159", "url": "https://glygen.org/publication/PubMed/1939159" } ] }, { "title": "Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing.", "journal": "The EMBO journal", "date": "2009", "authors": "Laufman O, Kedan A, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19536132", "url": "https://glygen.org/publication/PubMed/19536132" } ] }, { "title": "Golgi localisation of GMAP210 requires two distinct cis-membrane binding mechanisms.", "journal": "BMC biology", "date": "2009", "authors": "Cardenas J, Rivero S, Goud B, Bornens M, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19715559", "url": "https://glygen.org/publication/PubMed/19715559" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P05187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05187" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Rab33b and Rab6 are functionally overlapping regulators of Golgi homeostasis and trafficking.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Starr T, Sun Y, Wilkins N, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "20163571", "url": "https://glygen.org/publication/PubMed/20163571" } ] }, { "title": "A sequence variation in the promoter of the placental alkaline phosphatase gene (ALPP) is associated with allele-specific expression in human term placenta.", "journal": "Placenta", "date": "2010", "authors": "Bellazi L, Germond S, Dupont C, Brun-Heath I, Taillandier A, De Mazancourt P, Dieudonne MN, Mornet E", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" } ], "reference": [ { "type": "PubMed", "id": "20663553", "url": "https://glygen.org/publication/PubMed/20663553" } ] }, { "title": "Refined structures of placental alkaline phosphatase show a consistent pattern of interactions at the peripheral site.", "journal": "Acta crystallographica. Section F, Structural biology and crystallization communications", "date": "2010", "authors": "Stec B, Cheltsov A, Millan JL", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187#ptm_processing" }, { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" }, { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" } ], "reference": [ { "type": "PubMed", "id": "20693656", "url": "https://glygen.org/publication/PubMed/20693656" } ] }, { "title": "Interaction of Golgin-84 with the COG complex mediates the intra-Golgi retrograde transport.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Sohda M, Misumi Y, Yamamoto A, Nakamura N, Ogata S, Sakisaka S, Hirose S, Ikehara Y, Oda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "20874812", "url": "https://glygen.org/publication/PubMed/20874812" } ] }, { "title": "Selectivity of the cleavage/attachment site of phosphatidylinositol-glycan-anchored membrane proteins determined by site-specific mutagenesis at Asp-484 of placental alkaline phosphatase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Micanovic R, Gerber L D, Berger J, Kodukula K, Udenfriend S", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "2153284", "url": "https://glygen.org/publication/PubMed/2153284" } ] }, { "title": "The COG complex interacts directly with Syntaxin 6 and positively regulates endosome-to-TGN retrograde transport.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "21807881", "url": "https://glygen.org/publication/PubMed/21807881" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "Rab30 is required for the morphological integrity of the Golgi apparatus.", "journal": "Biology of the cell", "date": "2012", "authors": "Kelly EE, Giordano F, Horgan CP, Jollivet F, Raposo G, McCaffrey MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "22188167", "url": "https://glygen.org/publication/PubMed/22188167" } ] }, { "title": "Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Pusapati GV, Luchetti G, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23091056", "url": "https://glygen.org/publication/PubMed/23091056" } ] }, { "title": "Molecular insights into vesicle tethering at the Golgi by the conserved oligomeric Golgi (COG) complex and the golgin TATA element modulatory factor (TMF).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Miller VJ, Sharma P, Kudlyk TA, Frost L, Rofe AP, Watson IJ, Duden R, Lowe M, Lupashin VV, Ungar D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23239882", "url": "https://glygen.org/publication/PubMed/23239882" } ] }, { "title": "The COG complex interacts with multiple Golgi SNAREs and enhances fusogenic assembly of SNARE complexes.", "journal": "Journal of cell science", "date": "2013", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23378023", "url": "https://glygen.org/publication/PubMed/23378023" } ] }, { "title": "COG complexes form spatial landmarks for distinct SNARE complexes.", "journal": "Nature communications", "date": "2013", "authors": "Willett R, Kudlyk T, Pokrovskaya I, Schonherr R, Ungar D, Duden R, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23462996", "url": "https://glygen.org/publication/PubMed/23462996" } ] }, { "title": "The Golgi puppet master: COG complex at center stage of membrane trafficking interactions.", "journal": "Histochemistry and cell biology", "date": "2013", "authors": "Willett R, Ungar D, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23839779", "url": "https://glygen.org/publication/PubMed/23839779" } ] }, { "title": "Rab41 is a novel regulator of Golgi apparatus organization that is needed for ER-to-Golgi trafficking and cell growth.", "journal": "PloS one", "date": "2013", "authors": "Liu S, Hunt L, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23936529", "url": "https://glygen.org/publication/PubMed/23936529" } ] }, { "title": "Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Malaby AW, van den Berg B, Lambright DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23940353", "url": "https://glygen.org/publication/PubMed/23940353" } ] }, { "title": "Identification of a region within the placental alkaline phosphatase mRNA that mediates p180-dependent targeting to the endoplasmic reticulum.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Cui XA, Zhang Y, Hong SJ, Palazzo AF", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" } ], "reference": [ { "type": "PubMed", "id": "24019514", "url": "https://glygen.org/publication/PubMed/24019514" } ] }, { "title": "Tethering the assembly of SNARE complexes.", "journal": "Trends in cell biology", "date": "2014", "authors": "Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "24119662", "url": "https://glygen.org/publication/PubMed/24119662" } ] }, { "title": "How Rab proteins determine Golgi structure.", "journal": "International review of cell and molecular biology", "date": "2015", "authors": "Liu S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "25708460", "url": "https://glygen.org/publication/PubMed/25708460" } ] }, { "title": "Functional significance of calcium binding to tissue-nonspecific alkaline phosphatase.", "journal": "PloS one", "date": "2015", "authors": "Hoylaerts MF, Van Kerckhoven S, Kiffer-Moreira T, Sheen C, Narisawa S, Millan JL", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "25775211", "url": "https://glygen.org/publication/PubMed/25775211" } ] }, { "title": "Cloning, sequencing, and chromosomal localization of human term placental alkaline phosphatase cDNA.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Kam W, Clauser E, Kim YS, Kan YW, Rutter WJ", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "3001717", "url": "https://glygen.org/publication/PubMed/3001717" } ] }, { "title": "Nucleotide sequence of the human placental alkaline phosphatase gene. Evolution of the 5' flanking region by deletion/substitution.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Knoll B J, Rothblum K N, Longley M", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "3042787", "url": "https://glygen.org/publication/PubMed/3042787" } ] }, { "title": "Aspartic acid-484 of nascent placental alkaline phosphatase condenses with a phosphatidylinositol glycan to become the carboxyl terminus of the mature enzyme.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Micanovic R, Bailey C A, Brink L, Gerber L, Pan Y C, Hulmes J D, Udenfriend S", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "3422741", "url": "https://glygen.org/publication/PubMed/3422741" } ] }, { "title": "Expression of different-sized placental alkaline phosphatase mRNAs in placenta and choriocarcinoma cells.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Ovitt C E, Strauss A W, Alpers D H, Chou J Y, Boime I", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "3459156", "url": "https://glygen.org/publication/PubMed/3459156" } ] }, { "title": "Products of two common alleles at the locus for human placental alkaline phosphatase differ by seven amino acids.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Henthorn P S, Knoll B J, Raducha M, Rothblum K N, Slaughter C, Weiss M, Lafferty M A, Fischer T, Harris H", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "3461452", "url": "https://glygen.org/publication/PubMed/3461452" } ] }, { "title": "Molecular cloning and sequence analysis of human placental alkaline phosphatase.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Mill\u00e1n J L", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "3512548", "url": "https://glygen.org/publication/PubMed/3512548" } ] }, { "title": "Alkaline Phosphatase is an Independent Risk Factor for Periprosthetic Fractures in Total Joint Arthroplasty.", "journal": "Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews", "date": "2023-02-01", "authors": "Lung Brandon E, Kim Matthew, McLellan Maddison, Callan Kylie, Wang Edward D, McMaster William, Yang Steven, So David H", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" } ], "reference": [ { "type": "PubMed", "id": "36763725", "url": "https://glygen.org/publication/PubMed/36763725" } ] }, { "title": "Role of serum alkaline phosphatase as a potential biomarker of severity and prognosis in intracerebral hemorrhage.", "journal": "Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association", "date": "2024-01", "authors": "Wu Guangying, Li Shuhua, Luo Min, Li Xiaotian, Zhu Xinghua, Zhang Junhuai, He Qian, Yang Qian, Zhao Guojiang, Luo Shasha, Yang Zhijie", "evidence": [ { "database": "RefSeq", "id": "NP_001623", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001623" } ], "reference": [ { "type": "PubMed", "id": "37952310", "url": "https://glygen.org/publication/PubMed/37952310" } ] }, { "title": "Purification and partial sequencing of human placental alkaline phosphatase.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1983", "authors": "Ezra E, Blacher R, Udenfriend S", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "reference": [ { "type": "PubMed", "id": "6651840", "url": "https://glygen.org/publication/PubMed/6651840" } ] }, { "title": "A v-SNARE implicated in intra-Golgi transport.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Nagahama M, Orci L, Ravazzola M, Amherdt M, Lacomis L, Tempst P, Rothman JE, Sollner TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "8636227", "url": "https://glygen.org/publication/PubMed/8636227" } ] }, { "title": "A human exchange factor for ARF contains Sec7- and pleckstrin-homology domains.", "journal": "Nature", "date": "1996", "authors": "Chardin P, Paris S, Antonny B, Robineau S, Beraud-Dufour S, Jackson CL, Chabre M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "8945478", "url": "https://glygen.org/publication/PubMed/8945478" } ] }, { "title": "Bidirectional transport by distinct populations of COPI-coated vesicles.", "journal": "Cell", "date": "1997", "authors": "Orci L, Stamnes M, Ravazzola M, Amherdt M, Perrelet A, Sollner TH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9244307", "url": "https://glygen.org/publication/PubMed/9244307" } ] }, { "title": "Structure of the guanine nucleotide exchange factor Sec7 domain of human arno and analysis of the interaction with ARF GTPase.", "journal": "Cell", "date": "1998", "authors": "Mossessova E, Gulbis JM, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9476900", "url": "https://glygen.org/publication/PubMed/9476900" } ] }, { "title": "Structure of the Sec7 domain of the Arf exchange factor ARNO.", "journal": "Nature", "date": "1998", "authors": "Cherfils J, Menetrey J, Mathieu M, Le Bras G, Robineau S, Beraud-Dufour S, Antonny B, Chardin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9510256", "url": "https://glygen.org/publication/PubMed/9510256" } ] }, { "title": "Solution structure of the cytohesin-1 (B2-1) Sec7 domain and its interaction with the GTPase ADP ribosylation factor 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Betz SF, Schnuchel A, Wang H, Olejniczak ET, Meadows RP, Lipsky BP, Harris EA, Staunton DE, Fesik SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9653114", "url": "https://glygen.org/publication/PubMed/9653114" } ] }, { "title": "ARNO3, a Sec7-domain guanine nucleotide exchange factor for ADP ribosylation factor 1, is involved in the control of Golgi structure and function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Franco M, Boretto J, Robineau S, Monier S, Goud B, Chardin P, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9707577", "url": "https://glygen.org/publication/PubMed/9707577" } ] }, { "title": "Identification and characterization of golgin-84, a novel Golgi integral membrane protein with a cytoplasmic coiled-coil domain.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Bascom RA, Srinivasan S, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9915833", "url": "https://glygen.org/publication/PubMed/9915833" } ] } ], "pathway": [ { "id": "hsa:250", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:250", "resource": "KEGG Pathway" }, { "id": "R-HSA-6811438", "name": "Intra-Golgi traffic", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438", "resource": "Reactome", "description": "Intra-Golgi traffic" } ], "orthologs": [ { "uniprot_canonical_ac": "F8VPQ6-1", "protein_name": "Alkaline phosphatase", "gene_name": "Alpi", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLLVSMLLLVGTAMVVS", "length": 554 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P09923-1", "protein_name": "Intestinal-type alkaline phosphatase", "gene_name": "ALPI", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP", "length": 528 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P10696-1", "protein_name": "Alkaline phosphatase, germ cell type", "gene_name": "ALPG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP", "length": 532 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P15693-1", "protein_name": "Intestinal-type alkaline phosphatase 1", "gene_name": "Alpi", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQGDWVLLLLLGLRIHLSFGVIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQNSAITMNNVLLSLQLLVSMLLLVGTALVVS", "length": 540 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "dephosphorylation", "id": "GO:0016311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016311", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "alkaline phosphatase activity", "id": "GO:0004035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004035", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" }, { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P05187", "url": "https://www.uniprot.org/uniprot/P05187" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 144, "end_pos": 146, "annotation": "n_glycosylation_sequon" }, { "start_pos": 271, "end_pos": 273, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "15017", "name": "", "equation": "a phosphate monoester + H2O = an alcohol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P20611-1", "P51740-1", "P08289-1", "P15693-1", "P29288-1", "P20646-1", "P41498-1", "F1M8U7-1", "A0A0G2JZL2-1", "D4ADM6-1", "M0RCA8-1", "A0A8I6G7Q4-1", "Q6ZNF0-1", "Q9BZG2-1", "P13686-1", "P11117-1", "P05186-1", "P15309-1", "P09923-1", "Q9NPH0-1", "P05187-1", "P10696-1", "P24666-1", "Q8BX37-1", "D3YTS9-1", "Q8BP40-1", "Q9D358-1", "Q05117-1", "P24638-1", "P24822-1", "P24823-1", "Q8CE08-1", "P09242-1", "F8VPQ6-1", "P00635-1", "P11491-1", "P35842-1", "P40347-1", "P24031-1", "P38693-1", "P52290-1", "Q54NC3-1", "Q54P71-1", "Q54P72-1", "Q54SB4-1", "Q54TC4-1", "Q558S4-1", "Q54BS2-1", "Q54Y02-1", "Q55GW2-1", "Q55F77-1", "Q55F12-1", "P82890-1", "P82891-1", "Q24238-1", "X2JB52-1", "Q9W273-1", "Q9W274-1", "Q9VDG4-1", "Q7K3X8-1", "Q9VHD0-1", "Q9W275-1", "B7Z080-1", "Q8I0P9-1", "Q9VW00-1", "Q9VQ86-1" ], "evidence": [ { "id": "15017", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15017" } ] }, { "id": "R-HSA-8847875", "name": "ARF1:GTP binds Golgin TRIP11", "equation": "", "summary": "TRIP11, also known as GMAP210, is a cis-Golgi localized coiled coil Golgin with roles in anterograde and retrograde intra-Golgi trafficking (Infante et al, 1999; Pernet-Gallay et al, 2002). TRIP11 has an N-terminal amphipathic lipid packing sensor (ALPS) domain which binds preferentially to highly curved membranes such as those on veiscles, and a GRIP-related ARF binding (GRAB) domain at its C-terminus that binds to ARF1:GTP. This asymmetric binding allows TRIP11 to tether vesicles to the Golgi membrane. This asymmetric binding of TRIP11 is maintained in part by the fact that ARFGAP1 also contains an ALPS domain and therefore stimulates the GTPase activity of any ARF1:GTP that is present in the vesicular membrane (Drin et al, 2008; Cardenas et al, 2009; Gillingham et al, 2004).", "cellular_location": "Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P84077-1", "P05187-1" ], "evidence": [ { "id": "R-HSA-8847875", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8847875" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JZL2", "gene_name": "Akp3", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "A0A0G2JZL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZL2" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "A0A0G2JZL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZL2" } ] } ] }, { "uniprot_ac": "A0A8I6G7Q4", "gene_name": "AABR07036974.1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] } ] }, { "uniprot_ac": "B7Z080", "gene_name": "Dmel\\CG9449", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "B7Z080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7Z080" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "B7Z080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7Z080" } ] } ] }, { "uniprot_ac": "D3YTS9", "gene_name": "Acp4", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "D3YTS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YTS9" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "D3YTS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YTS9" } ] } ] }, { "uniprot_ac": "D4ADM6", "gene_name": "Alpp", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "D4ADM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADM6" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "D4ADM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADM6" } ] } ] }, { "uniprot_ac": "F1M8U7", "gene_name": "Alpg", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "F1M8U7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8U7" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "F1M8U7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8U7" } ] } ] }, { "uniprot_ac": "F8VPQ6", "gene_name": "Alpi", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "F8VPQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPQ6" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "F8VPQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPQ6" } ] } ] }, { "uniprot_ac": "M0RCA8", "gene_name": "Acp7", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "M0RCA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RCA8" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "M0RCA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RCA8" } ] } ] }, { "uniprot_ac": "P00635", "gene_name": "PHO5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P00635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00635" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P00635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00635" } ] } ] }, { "uniprot_ac": "P05186", "gene_name": "ALPL", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] }, { "ec_number": "3.9.1.1", "activity": "H2O + N-phosphocreatine = creatine + phosphate.", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] }, { "ec_number": "3.9.1.1", "activity": "", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] } ] }, { "uniprot_ac": "P05187", "gene_name": "ALPP", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P05187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05187" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P05187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05187" } ] } ] }, { "uniprot_ac": "P08289", "gene_name": "Alpl", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P08289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08289" } ] }, { "ec_number": "3.9.1.1", "activity": "H2O + N-phosphocreatine = creatine + phosphate.", "evidence": [ { "id": "P08289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08289" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P08289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08289" } ] } ] }, { "uniprot_ac": "P09242", "gene_name": "Alpl", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] }, { "ec_number": "3.9.1.1", "activity": "H2O + N-phosphocreatine = creatine + phosphate.", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] }, { "ec_number": "3.9.1.1", "activity": "", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] } ] }, { "uniprot_ac": "P09923", "gene_name": "ALPI", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923" } ] } ] }, { "uniprot_ac": "P10696", "gene_name": "ALPG", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P10696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10696" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P10696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10696" } ] } ] }, { "uniprot_ac": "P11117", "gene_name": "ACP2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P11117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11117" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P11117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11117" } ] } ] }, { "uniprot_ac": "P11491", "gene_name": "PHO8", "activity": [ { "ec_number": "3.1.7.6", "activity": "(2E,6E)-farnesyl diphosphate + H2O = (2E,6E)-farnesol + diphosphate.", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] }, { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] }, { "ec_number": "3.1.3.54", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 2-phosphate + phosphate.", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] } ] }, { "uniprot_ac": "P13686", "gene_name": "ACP5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P13686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13686" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P13686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13686" } ] } ] }, { "uniprot_ac": "P15309", "gene_name": "ACP3", "activity": [ { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] } ] }, { "uniprot_ac": "P15693", "gene_name": "Alpi", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P15693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15693" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P15693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15693" } ] } ] }, { "uniprot_ac": "P20611", "gene_name": "Acp2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P20611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20611" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P20611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20611" } ] } ] }, { "uniprot_ac": "P20646", "gene_name": "Acp3", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] } ] }, { "uniprot_ac": "P24031", "gene_name": "PHO3", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24031", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24031" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P24031", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24031" } ] } ] }, { "uniprot_ac": "P24638", "gene_name": "Acp2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24638" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P24638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24638" } ] } ] }, { "uniprot_ac": "P24666", "gene_name": "ACP1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] } ] }, { "uniprot_ac": "P24822", "gene_name": "Iap", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24822" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P24822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24822" } ] } ] }, { "uniprot_ac": "P24823", "gene_name": "Alpg", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24823" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P24823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24823" } ] } ] }, { "uniprot_ac": "P29288", "gene_name": "Acp5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P29288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29288" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P29288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29288" } ] } ] }, { "uniprot_ac": "P35842", "gene_name": "PHO11", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P35842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35842" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P35842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35842" } ] } ] }, { "uniprot_ac": "P38693", "gene_name": "PHO12", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P38693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38693" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P38693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38693" } ] } ] }, { "uniprot_ac": "P40347", "gene_name": "LTP1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P40347", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40347" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P40347", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40347" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P40347", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40347" } ] } ] }, { "uniprot_ac": "P41498", "gene_name": "Acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] } ] }, { "uniprot_ac": "P51740", "gene_name": "", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P51740", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51740" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P51740", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51740" } ] } ] }, { "uniprot_ac": "P52290", "gene_name": "DIA3", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P52290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52290" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P52290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52290" } ] } ] }, { "uniprot_ac": "P82890", "gene_name": "primo-1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] } ] }, { "uniprot_ac": "P82891", "gene_name": "primo-2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] } ] }, { "uniprot_ac": "P84077", "gene_name": "ARF1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] } ] }, { "uniprot_ac": "Q05117", "gene_name": "Acp5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q05117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05117" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q05117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05117" } ] } ] }, { "uniprot_ac": "Q24238", "gene_name": "Alp4", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q24238", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24238" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q24238", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24238" } ] } ] }, { "uniprot_ac": "Q54BS2", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54BS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BS2" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54BS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BS2" } ] } ] }, { "uniprot_ac": "Q54NC3", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54NC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NC3" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54NC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NC3" } ] } ] }, { "uniprot_ac": "Q54P71", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54P71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P71" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54P71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P71" } ] } ] }, { "uniprot_ac": "Q54P72", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54P72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P72" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54P72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P72" } ] } ] }, { "uniprot_ac": "Q54SB4", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54SB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SB4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54SB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SB4" } ] } ] }, { "uniprot_ac": "Q54TC4", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54TC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54TC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC4" } ] } ] }, { "uniprot_ac": "Q54Y02", "gene_name": "alp", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54Y02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y02" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q54Y02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y02" } ] } ] }, { "uniprot_ac": "Q558S4", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q558S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q558S4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q558S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q558S4" } ] } ] }, { "uniprot_ac": "Q55F12", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q55F12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F12" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q55F12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F12" } ] } ] }, { "uniprot_ac": "Q55F77", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q55F77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F77" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q55F77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F77" } ] } ] }, { "uniprot_ac": "Q55GW2", "gene_name": "acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q55GW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GW2" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q55GW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GW2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q55GW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GW2" } ] } ] }, { "uniprot_ac": "Q6ZNF0", "gene_name": "ACP7", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q6ZNF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNF0" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q6ZNF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNF0" } ] } ] }, { "uniprot_ac": "Q7K3X8", "gene_name": "Alp6", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q7K3X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3X8" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q7K3X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3X8" } ] } ] }, { "uniprot_ac": "Q8BP40", "gene_name": "Acp6", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8BP40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BP40" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8BP40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BP40" } ] } ] }, { "uniprot_ac": "Q8BX37", "gene_name": "Acp7", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8BX37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BX37" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8BX37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BX37" } ] } ] }, { "uniprot_ac": "Q8CE08", "gene_name": "Acp3", "activity": [ { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] } ] }, { "uniprot_ac": "Q8I0P9", "gene_name": "Acph-1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8I0P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8I0P9" } ] } ] }, { "uniprot_ac": "Q9BZG2", "gene_name": "ACP4", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9BZG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZG2" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9BZG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZG2" } ] } ] }, { "uniprot_ac": "Q9D358", "gene_name": "Acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] } ] }, { "uniprot_ac": "Q9NPH0", "gene_name": "ACP6", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9NPH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPH0" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9NPH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPH0" } ] } ] }, { "uniprot_ac": "Q9VDG4", "gene_name": "Alp5", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9VDG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDG4" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9VDG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDG4" } ] } ] }, { "uniprot_ac": "Q9VHD0", "gene_name": "phu", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9VHD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD0" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9VHD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD0" } ] } ] }, { "uniprot_ac": "Q9VQ86", "gene_name": "Dmel\\CG15385", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9VQ86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQ86" } ] } ] }, { "uniprot_ac": "Q9VW00", "gene_name": "Dmel\\CG9451", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9VW00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW00" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9VW00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW00" } ] } ] }, { "uniprot_ac": "Q9W273", "gene_name": "Alp8", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9W273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W273" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9W273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W273" } ] } ] }, { "uniprot_ac": "Q9W274", "gene_name": "Alp2", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9W274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W274" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9W274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W274" } ] } ] }, { "uniprot_ac": "Q9W275", "gene_name": "Alp7", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9W275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W275" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9W275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W275" } ] } ] }, { "uniprot_ac": "X2JB52", "gene_name": "Dmel\\CG1637", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "X2JB52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JB52" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "X2JB52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JB52" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 144, 271 ], "o_linked_sites": [], "snv_sites": [ 144, 146, 169, 189, 209, 271, 272, 273, 319, 379 ], "glycation_sites": [], "phosphorylation_sites": [ 114, 117, 119, 273, 283, 314, 410, 415, 421 ], "sequon_annotation_sites": [ { "start_pos": 144, "end_pos": 146 }, { "start_pos": 271, "end_pos": 273 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 64 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }