{ "uniprot_canonical_ac": "P05106-1", "uniprot_ac": "P05106", "uniprot_id": "ITB3_HUMAN", "mass": { "chemical_mass": 87058.0, "monoisotopic_mass": 87058.0 }, "refseq": { "ac": "NP_000203", "name": "integrin beta-3 precursor", "summary": "The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" }, "gene_names": [ { "name": "ITGB3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05106", "id": "P05106" }, { "name": "BDPLT16; BDPLT2; BDPLT24; CD61; GP3A; GPIIIa; GT; GT2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203", "id": "NP_000203" }, { "name": "GP3A", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05106", "id": "P05106" }, { "name": "ITGB3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203", "id": "NP_000203" }, { "name": "integrin beta 3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05106", "id": "P05106" } ], "protein_names": [ { "name": "Integrin beta-3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05106" }, { "name": "GPIIIa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05106" }, { "name": "Platelet membrane glycoprotein IIIa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05106" }, { "name": "integrin beta-3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203", "id": "NP_000203" }, { "name": "platelet membrane glycoprotein IIIa; integrin beta 3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); integrin beta chain, beta 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203", "id": "NP_000203" } ], "function": [ { "annotation": "(Microbial infection) Acts as a receptor for Hantaan virus.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "9618541", "url": "https://glygen.org/publication/PubMed/9618541" } ] }, { "annotation": "(Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "10397733", "url": "https://glygen.org/publication/PubMed/10397733" } ] }, { "annotation": "(Microbial infection) Integrin ITGA5:ITGB3 acts as a receptor for Human metapneumovirus.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "24478423", "url": "https://glygen.org/publication/PubMed/24478423" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts aP05556s a receptor for Human parechovirus 1.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "11160695", "url": "https://glygen.org/publication/PubMed/11160695" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Coxsackievirus A9.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "7519807", "url": "https://glygen.org/publication/PubMed/7519807" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Cytomegalovirus/HHV-5.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "15834425", "url": "https://glygen.org/publication/PubMed/15834425" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "18045938", "url": "https://glygen.org/publication/PubMed/18045938" } ] }, { "annotation": "(Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "23658209", "url": "https://glygen.org/publication/PubMed/23658209" } ] }, { "annotation": "A single F153Sbeta3 mutation causes constitutive integrin alphaIIbbeta3 activation in a variant form of Glanzmann thrombasthenia.", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" }, { "database": "PubMed", "id": "36884296", "url": "https://glygen.org/publication/PubMed/36884296" } ] }, { "annotation": "Effect of c.1431C > T mutation, a causative mutation of Glanzmann's thrombasthenia, on ITGB3 splicing, gene and protein expression.", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" }, { "database": "PubMed", "id": "37716584", "url": "https://glygen.org/publication/PubMed/37716584" } ] }, { "annotation": "Genetic screening of PLA1/PLA2 polymorphous marker of integrin beta 3 (ITGB3) GP IIIA gene in adolescent girls with puberty menorrhagia.", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" }, { "database": "PubMed", "id": "36937472", "url": "https://glygen.org/publication/PubMed/36937472" } ] }, { "annotation": "Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets (By similarity). ITGAV:ITGB3 binds to fractalkine (CX3CL1) and acts as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415, PubMed:24789099). ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling (PubMed:18441324). ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling (PubMed:28302677). ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:19578119). ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed:28873464). ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling (PubMed:29030430). ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGAV:ITGB3 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887). In brain, plays a role in synaptic transmission and plasticity. Involved in the regulation of the serotonin neurotransmission, is required to localize to specific compartments within the synapse the serotonin receptor SLC6A4 and for an appropriate reuptake of serotonin. Controls excitatory synaptic strength by regulating GRIA2-containing AMPAR endocytosis, which affects AMPAR abundance and composition (By similarity). ITGAV:ITGB3 act as a receptor for CD40LG (PubMed:31331973).", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#function" }, { "database": "PubMed", "id": "24789099", "url": "https://glygen.org/publication/PubMed/24789099" }, { "database": "PubMed", "id": "17635696", "url": "https://glygen.org/publication/PubMed/17635696" }, { "database": "PubMed", "id": "9195946", "url": "https://glygen.org/publication/PubMed/9195946" }, { "database": "UniProtKB", "id": "O54890", "url": "https://www.uniprot.org/uniprot/O54890#function" }, { "database": "PubMed", "id": "23125415", "url": "https://glygen.org/publication/PubMed/23125415" }, { "database": "PubMed", "id": "20682778", "url": "https://glygen.org/publication/PubMed/20682778" }, { "database": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" }, { "database": "PubMed", "id": "18441324", "url": "https://glygen.org/publication/PubMed/18441324" }, { "database": "PubMed", "id": "28873464", "url": "https://glygen.org/publication/PubMed/28873464" }, { "database": "PubMed", "id": "19578119", "url": "https://glygen.org/publication/PubMed/19578119" }, { "database": "PubMed", "id": "28302677", "url": "https://glygen.org/publication/PubMed/28302677" }, { "database": "PubMed", "id": "29030430", "url": "https://glygen.org/publication/PubMed/29030430" }, { "database": "PubMed", "id": "25398877", "url": "https://glygen.org/publication/PubMed/25398877" }, { "database": "PubMed", "id": "31331973", "url": "https://glygen.org/publication/PubMed/31331973" }, { "database": "PubMed", "id": "18635536", "url": "https://glygen.org/publication/PubMed/18635536" }, { "database": "PubMed", "id": "16322781", "url": "https://glygen.org/publication/PubMed/16322781" } ] }, { "annotation": "Integrin-alphavbeta3 is a Therapeutically Targetable Fundamental Factor in Medulloblastoma Tumorigenicity and Radioresistance.", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" }, { "database": "PubMed", "id": "38009896", "url": "https://glygen.org/publication/PubMed/38009896" } ] }, { "annotation": "Molecular basis for the recognition of 24-(S)-hydroxycholesterol by integrin alphavbeta3. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" }, { "database": "PubMed", "id": "37280310", "url": "https://glygen.org/publication/PubMed/37280310" } ] }, { "annotation": "The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" } ] } ], "disease": [ { "disease_id": "MONDO:0030996", "recommended_name": { "id": "MONDO:0030996", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030996", "name": "bleeding disorder, platelet-type, 24", "description": "" }, "synonyms": [ { "id": "MONDO:0030996", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030996", "name": "BDPLT24", "description": "" }, { "id": "MONDO:0030996", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030996", "name": "Glanzmann Thrombasthenia-Like With Macrothrombocytopenia 2", "description": "" }, { "id": "MONDO:0030996", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030996", "name": "bleeding disorder, platelet-type, 24", "description": "" }, { "id": "MONDO:0030996", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030996", "name": "bleeding disorder, platelet-type, 24, autosomal dominant", "description": "" }, { "id": "MIM:619271", "resource": "MIM", "url": "https://www.omim.org/entry/619271", "name": "Bleeding disorder, platelet-type, 24", "description": "Bleeding disorder, platelet-type, 24" } ], "evidence": [ { "id": "619271", "database": "MIM", "url": "https://www.omim.org/entry/619271" } ] }, { "disease_id": "MONDO:0031009", "recommended_name": { "id": "MONDO:0031009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0031009", "name": "Glanzmann thrombasthenia 2", "description": "" }, "synonyms": [ { "id": "MONDO:0031009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0031009", "name": "GT2", "description": "" }, { "id": "MONDO:0031009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0031009", "name": "Glanzmann thrombasthenia 2", "description": "" }, { "id": "MONDO:0031009", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0031009", "name": "bleeding disorder, platelet-type, 23", "description": "" }, { "id": "MIM:619267", "resource": "MIM", "url": "https://www.omim.org/entry/619267", "name": "Glanzmann thrombasthenia 2", "description": "Glanzmann thrombasthenia 2" } ], "evidence": [ { "id": "619267", "database": "MIM", "url": "https://www.omim.org/entry/619267" } ] } ], "snv": [ { "evidence": [ { "id": "P05106", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 102, "end_pos": 102, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "17", "chr_pos": "47283492", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D102", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P05106", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 127, "end_pos": 127, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NFS->NFC).", "chr_id": "17", "chr_pos": "47284461", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S127", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs121918445", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918445" }, { "id": "rs121918445", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918445" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 145, "end_pos": 145, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "17", "chr_pos": "47284514", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772696780", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772696780" }, { "id": "rs772696780", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772696780" }, { "id": "rs772696780", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772696780" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 268, "end_pos": 268, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDS).", "chr_id": "17", "chr_pos": "47287094", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A268", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772696780", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772696780" }, { "id": "rs772696780", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772696780" }, { "id": "rs772696780", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772696780" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 268, "end_pos": 268, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "17", "chr_pos": "47287094", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A268", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1598691502", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1598691502" }, { "id": "rs1598691502", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1598691502" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 307, "end_pos": 307, "sequence_org": "Y", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NHY->NHS).", "chr_id": "17", "chr_pos": "47287212", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y307", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs974965422", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs974965422" }, { "id": "rs974965422", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs974965422#frequency_tab" }, { "id": "rs974965422", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs974965422" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 348, "end_pos": 348, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->NYG).", "chr_id": "17", "chr_pos": "47290191", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S348", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05106", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 348, "end_pos": 348, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->NYN).", "chr_id": "17", "chr_pos": "47290192", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S348", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs150029332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150029332" }, { "id": "rs150029332", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs150029332" }, { "id": "rs150029332", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150029332" }, { "id": "rs150029332", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150029332#frequency_tab" }, { "id": "rs150029332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150029332" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 362, "end_pos": 362, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "17", "chr_pos": "47290233", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "D362", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05106", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106" } ], "glycoeffect": [], "start_pos": 386, "end_pos": 386, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "17", "chr_pos": "47290984", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R386", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs757773635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757773635" }, { "id": "rs757773635", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757773635" }, { "id": "rs757773635", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757773635#frequency_tab" }, { "id": "rs757773635", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757773635" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 397, "end_pos": 397, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "17", "chr_pos": "47291018", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N397", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781752220", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781752220" }, { "id": "rs781752220", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781752220" }, { "id": "rs781752220", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781752220" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 399, "end_pos": 399, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAP).", "chr_id": "17", "chr_pos": "47291023", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T399", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs372644002", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372644002" }, { "id": "rs372644002", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372644002#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SFS->NFS).", "chr_id": "17", "chr_pos": "47292143", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S422", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759939957", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759939957" }, { "id": "rs759939957", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759939957" }, { "id": "rs759939957", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759939957" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 478, "end_pos": 478, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "17", "chr_pos": "47292312", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N478", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762168403", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762168403" }, { "id": "rs762168403", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762168403" }, { "id": "rs762168403", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762168403#frequency_tab" }, { "id": "rs762168403", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762168403" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 551, "end_pos": 551, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "17", "chr_pos": "47292529", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D551", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141912699", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141912699" }, { "id": "rs141912699", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141912699" }, { "id": "rs141912699", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141912699#frequency_tab" }, { "id": "rs141912699", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141912699" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 578, "end_pos": 578, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DWT->NWT).", "chr_id": "17", "chr_pos": "47299349", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D578", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769897880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769897880" }, { "id": "rs769897880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769897880" }, { "id": "rs769897880", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769897880#frequency_tab" }, { "id": "rs769897880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769897880" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 585, "end_pos": 585, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "17", "chr_pos": "47299371", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N585", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769897880", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769897880" }, { "id": "rs769897880", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769897880" }, { "id": "rs769897880", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769897880#frequency_tab" }, { "id": "rs769897880", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769897880" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 585, "end_pos": 585, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->TCT).", "chr_id": "17", "chr_pos": "47299371", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N585", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1394261071", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1394261071" }, { "id": "rs1394261071", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1394261071" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 587, "end_pos": 587, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCI).", "chr_id": "17", "chr_pos": "47299377", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T587", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1405071909", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405071909" }, { "id": "rs1405071909", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1405071909#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 657, "end_pos": 657, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTC->NTS).", "chr_id": "17", "chr_pos": "47300534", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C657", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773804219", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773804219" }, { "id": "rs773804219", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773804219" }, { "id": "rs773804219", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773804219#frequency_tab" }, { "id": "rs773804219", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773804219" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 682, "end_pos": 682, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCI).", "chr_id": "17", "chr_pos": "47302751", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T682", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05106", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106" } ], "glycoeffect": [], "start_pos": 749, "end_pos": 749, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "47307581", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D749", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P05106", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106" } ], "glycoeffect": [], "start_pos": 750, "end_pos": 750, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "17", "chr_pos": "47307585", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R750", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs766423016", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766423016" }, { "id": "rs766423016", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766423016" }, { "id": "rs766423016", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766423016#frequency_tab" }, { "id": "rs766423016", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766423016" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 771, "end_pos": 771, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNP->NNS).", "chr_id": "17", "chr_pos": "47310148", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P771", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 502, "end_pos": 508, "sequence_org": "EDYRPSQ", "sequence_mut": "", "comment": "Increases ligand-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "19704023", "url": "https://glygen.org/publication/PubMed/19704023" } ] }, { "start_pos": 659, "end_pos": 659, "sequence_org": "R", "sequence_mut": "A", "comment": "Slight increase in ligand-binding activity; when associated with 698-D--K-702 del.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "19704023", "url": "https://glygen.org/publication/PubMed/19704023" } ] }, { "start_pos": 698, "end_pos": 702, "sequence_org": "DSSGK", "sequence_mut": "", "comment": "Slight increase in ligand-binding activity; when associated with A-659.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "19704023", "url": "https://glygen.org/publication/PubMed/19704023" } ] }, { "start_pos": 773, "end_pos": 773, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on cell surface location but impairs interaction with TNS3 and PEAK1.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "35687021", "url": "https://glygen.org/publication/PubMed/35687021" } ] }, { "start_pos": 785, "end_pos": 785, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on cell surface location but impairs interaction with TNS3 and PEAK1.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "35687021", "url": "https://glygen.org/publication/PubMed/35687021" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "70.99", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "56.66", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "69.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "83.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "80.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "59.24", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "71.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "57.16", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "69.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "72.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "74.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05106" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "common_name": "Human" } ], "gene": [ { "name": "ITGB3", "url": "https://www.uniprot.org/uniprot/P05106", "locus": { "chromosome": "17", "start_pos": 63870, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_481", "url": "https://www.ensembl.org/id/LRG_481" } ] } } ], "crossref": [ { "id": "ENSG00000259207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259207", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P05106", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05106", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL1907598", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1907598", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CHEMBL2093869", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2093869", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CHEMBL2111461", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2111461", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CHEMBL3883284", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3883284", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CHEMBL4106150", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4106150", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ITGB3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ITGB3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3690", "url": "https://www.ncbi.nlm.nih.gov/gene/3690", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1416", "url": "https://glyconnect.expasy.org/browser/proteins/1416", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6156", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6156", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P05106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05106*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002369", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002369", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012896", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012896", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013111", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013111", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014836", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014836", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015812", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015812", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016201", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016201", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032695", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032695", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036349", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036349", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036465", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036465", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040622", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040622", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3690", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3690", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "173470", "url": "http://www.omim.org/entry/173470", "database": "MIM", "categories": [ "Other" ] }, { "id": "619267", "url": "http://www.omim.org/entry/619267", "database": "MIM", "categories": [ "Other" ] }, { "id": "619271", "url": "http://www.omim.org/entry/619271", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P05106", "url": "https://www.nextprot.org/entry/NX_P05106", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "AKWDTTH", "url": "https://omabrowser.org/oma/group/AKWDTTH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5475862at2759", "url": "http://www.orthodb.org/?query=5475862at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10082", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10082", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10082:SF25", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10082:SF25", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1JV2", "url": "https://www.rcsb.org/structure/1JV2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KUP", "url": "https://www.rcsb.org/structure/1KUP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KUZ", "url": "https://www.rcsb.org/structure/1KUZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1L5G", "url": "https://www.rcsb.org/structure/1L5G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1M1X", "url": "https://www.rcsb.org/structure/1M1X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1M8O", "url": "https://www.rcsb.org/structure/1M8O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MIZ", "url": "https://www.rcsb.org/structure/1MIZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MK7", "url": "https://www.rcsb.org/structure/1MK7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MK9", "url": "https://www.rcsb.org/structure/1MK9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1S4X", "url": "https://www.rcsb.org/structure/1S4X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1TYE", "url": "https://www.rcsb.org/structure/1TYE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U8C", "url": "https://www.rcsb.org/structure/1U8C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2K9J", "url": "https://www.rcsb.org/structure/2K9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KNC", "url": "https://www.rcsb.org/structure/2KNC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KV9", "url": "https://www.rcsb.org/structure/2KV9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L1C", "url": "https://www.rcsb.org/structure/2L1C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L91", "url": "https://www.rcsb.org/structure/2L91", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LJD", "url": "https://www.rcsb.org/structure/2LJD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LJE", "url": "https://www.rcsb.org/structure/2LJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LJF", "url": "https://www.rcsb.org/structure/2LJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MTP", "url": "https://www.rcsb.org/structure/2MTP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N9Y", "url": "https://www.rcsb.org/structure/2N9Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Q6W", "url": "https://www.rcsb.org/structure/2Q6W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RMZ", "url": "https://www.rcsb.org/structure/2RMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RN0", "url": "https://www.rcsb.org/structure/2RN0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VC2", "url": "https://www.rcsb.org/structure/2VC2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDK", "url": "https://www.rcsb.org/structure/2VDK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDL", "url": "https://www.rcsb.org/structure/2VDL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDM", "url": "https://www.rcsb.org/structure/2VDM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDN", "url": "https://www.rcsb.org/structure/2VDN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDO", "url": "https://www.rcsb.org/structure/2VDO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDP", "url": "https://www.rcsb.org/structure/2VDP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDQ", "url": "https://www.rcsb.org/structure/2VDQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VDR", "url": "https://www.rcsb.org/structure/2VDR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FCS", "url": "https://www.rcsb.org/structure/3FCS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FCU", "url": "https://www.rcsb.org/structure/3FCU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IJE", "url": "https://www.rcsb.org/structure/3IJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NID", "url": "https://www.rcsb.org/structure/3NID", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NIF", "url": "https://www.rcsb.org/structure/3NIF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NIG", "url": "https://www.rcsb.org/structure/3NIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3T3M", "url": "https://www.rcsb.org/structure/3T3M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3T3P", "url": "https://www.rcsb.org/structure/3T3P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZDX", "url": "https://www.rcsb.org/structure/3ZDX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZDY", "url": "https://www.rcsb.org/structure/3ZDY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZDZ", "url": "https://www.rcsb.org/structure/3ZDZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZE0", "url": "https://www.rcsb.org/structure/3ZE0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZE1", "url": "https://www.rcsb.org/structure/3ZE1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZE2", "url": "https://www.rcsb.org/structure/3ZE2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4CAK", "url": "https://www.rcsb.org/structure/4CAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G1E", "url": "https://www.rcsb.org/structure/4G1E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G1M", "url": "https://www.rcsb.org/structure/4G1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MMX", "url": "https://www.rcsb.org/structure/4MMX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MMY", "url": "https://www.rcsb.org/structure/4MMY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MMZ", "url": "https://www.rcsb.org/structure/4MMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O02", "url": "https://www.rcsb.org/structure/4O02", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z7N", "url": "https://www.rcsb.org/structure/4Z7N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z7O", "url": "https://www.rcsb.org/structure/4Z7O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z7Q", "url": "https://www.rcsb.org/structure/4Z7Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HDB", "url": "https://www.rcsb.org/structure/5HDB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVQ", "url": "https://www.rcsb.org/structure/6AVQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVR", "url": "https://www.rcsb.org/structure/6AVR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVU", "url": "https://www.rcsb.org/structure/6AVU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BXB", "url": "https://www.rcsb.org/structure/6BXB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BXF", "url": "https://www.rcsb.org/structure/6BXF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BXJ", "url": "https://www.rcsb.org/structure/6BXJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CKB", "url": "https://www.rcsb.org/structure/6CKB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MK0", "url": "https://www.rcsb.org/structure/6MK0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSL", "url": "https://www.rcsb.org/structure/6MSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSU", "url": "https://www.rcsb.org/structure/6MSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NAJ", "url": "https://www.rcsb.org/structure/6NAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V4P", "url": "https://www.rcsb.org/structure/6V4P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KN0", "url": "https://www.rcsb.org/structure/7KN0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7L8P", "url": "https://www.rcsb.org/structure/7L8P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LA4", "url": "https://www.rcsb.org/structure/7LA4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TCT", "url": "https://www.rcsb.org/structure/7TCT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TD8", "url": "https://www.rcsb.org/structure/7TD8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7THO", "url": "https://www.rcsb.org/structure/7THO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TMZ", "url": "https://www.rcsb.org/structure/7TMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TPD", "url": "https://www.rcsb.org/structure/7TPD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U60", "url": "https://www.rcsb.org/structure/7U60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U9F", "url": "https://www.rcsb.org/structure/7U9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U9V", "url": "https://www.rcsb.org/structure/7U9V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UBR", "url": "https://www.rcsb.org/structure/7UBR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UCY", "url": "https://www.rcsb.org/structure/7UCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UDG", "url": "https://www.rcsb.org/structure/7UDG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UDH", "url": "https://www.rcsb.org/structure/7UDH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UE0", "url": "https://www.rcsb.org/structure/7UE0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UFH", "url": "https://www.rcsb.org/structure/7UFH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UH8", "url": "https://www.rcsb.org/structure/7UH8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UJE", "url": "https://www.rcsb.org/structure/7UJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UJK", "url": "https://www.rcsb.org/structure/7UJK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UK9", "url": "https://www.rcsb.org/structure/7UK9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UKO", "url": "https://www.rcsb.org/structure/7UKO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UKP", "url": "https://www.rcsb.org/structure/7UKP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UKT", "url": "https://www.rcsb.org/structure/7UKT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8T2U", "url": "https://www.rcsb.org/structure/8T2U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8T2V", "url": "https://www.rcsb.org/structure/8T2V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00362", "url": "http://pfam.xfam.org/family/PF00362", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07965", "url": "http://pfam.xfam.org/family/PF07965", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07974", "url": "http://pfam.xfam.org/family/PF07974", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08725", "url": "http://pfam.xfam.org/family/PF08725", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17205", "url": "http://pfam.xfam.org/family/PF17205", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18372", "url": "http://pfam.xfam.org/family/PF18372", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P05106", "url": "https://pharos.nih.gov/targets/P05106", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053450", "url": "https://proconsortium.org/app/entry/PR:000053450", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053451", "url": "https://proconsortium.org/app/entry/PR:000053451", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P05106", "url": "http://purl.obolibrary.org/obo/PR_P05106", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-354194", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354194", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6802946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802946", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6802955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802955", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P05106", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "I3L4X8", "url": "https://www.uniprot.org/uniprot/I3L4X8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4X8-1", "url": "https://www.uniprot.org/uniprot/I3L4X8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05106-1", "url": "https://www.uniprot.org/uniprot/P05106-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05106-2", "url": "https://www.uniprot.org/uniprot/P05106-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05106-3", "url": "https://www.uniprot.org/uniprot/P05106-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q16157", "url": "https://www.uniprot.org/uniprot/Q16157", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q16157-1", "url": "https://www.uniprot.org/uniprot/Q16157-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT", "length": 788, "header": "sp|P05106-1|ITB3_HUMAN Isoform 1 of Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2 CANONICAL=P05106-1" }, "isoforms": [ { "isoform_ac": "I3L4X8-1", "url": "", "sequence": { "sequence": "MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVRWAGQGLCPGASVGTQPPFFLL", "length": 443, "header": "tr|I3L4X8-1|ITB3_HUMAN Computationally mapped isoform of Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=1 CANONICAL=P05106-1" }, "locus": { "chromosome": "17", "start_pos": 47291157, "end_pos": 47253862, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000571680.1", "url": "https://www.ensembl.org/id/ENST00000571680.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000461626.1", "url": "https://www.ensembl.org/id/ENSP00000461626.1" } ] } }, { "isoform_ac": "P05106-1", "url": "", "sequence": { "sequence": "MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT", "length": 788, "header": "sp|P05106-1|ITB3_HUMAN Isoform 1 of Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2 CANONICAL=P05106-1" }, "locus": { "chromosome": "17", "start_pos": 47310201, "end_pos": 47253862, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559488.7", "url": "https://www.ensembl.org/id/ENST00000559488.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000452786.2", "url": "https://www.ensembl.org/id/ENSP00000452786.2" } ] } }, { "isoform_ac": "P05106-2", "url": "", "sequence": { "sequence": "MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTVRDGAGRFLKSLV", "length": 780, "header": "sp|P05106-2|ITB3_HUMAN Isoform 2 of Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2 CANONICAL=P05106-1" }, "locus": { "chromosome": "17", "start_pos": 47307676, "end_pos": 47253862, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696963.1", "url": "https://www.ensembl.org/id/ENST00000696963.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513002.1", "url": "https://www.ensembl.org/id/ENSP00000513002.1" } ] } }, { "isoform_ac": "P05106-3", "url": "", "sequence": { "sequence": "MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTHYAQSLRKWNQPVSIDG", "length": 784, "header": "sp|P05106-3|ITB3_HUMAN Isoform 3 of Integrin beta-3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=1 SV=2 CANONICAL=P05106-1" }, "locus": {} }, { "isoform_ac": "Q16157-1", "url": "", "sequence": { "sequence": "LKSCMGLKIGDTVRWAGQGLCPGASVGTQPPFFLL", "length": 35, "header": "tr|Q16157-1|Q16157_HUMAN Computationally mapped isoform of Integrin beta 3 OS=Homo sapiens OX=9606 GN=ITGB3 PE=2 SV=1 CANONICAL=P05106-1" }, "locus": { "chromosome": "17", "start_pos": 47291157, "end_pos": 47291053, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000573377.1", "url": "https://www.ensembl.org/id/ENST00000573377.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465586.1", "url": "https://www.ensembl.org/id/ENSP00000465586.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "P05106", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "1416", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1416" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "1416", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1416" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "P05106", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "P05106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "15378069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15378069" }, { "id": "1TYE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1TYE" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "19111664", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19111664" }, { "id": "16263699", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16263699" }, { "id": "2VC2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VC2" }, { "id": "2VDK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDK" }, { "id": "2VDL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDL" }, { "id": "2VDM", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDM" }, { "id": "2VDN", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDN" }, { "id": "2VDO", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDO" }, { "id": "2VDP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDP" }, { "id": "2VDQ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDQ" }, { "id": "2VDR", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDR" }, { "id": "3FCS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCS" }, { "id": "3FCU", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCU" }, { "id": "3NID", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NID" }, { "id": "3NIF", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NIF" }, { "id": "3NIG", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NIG" }, { "id": "3T3M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3T3M" }, { "id": "3T3P", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3T3P" }, { "id": "3ZDX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDX" }, { "id": "3ZDY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDY" }, { "id": "3ZDZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDZ" }, { "id": "3ZE0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE0" }, { "id": "3ZE1", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE1" }, { "id": "4CAK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4CAK" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4Z7Q", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4Z7Q" }, { "id": "5HDB", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5HDB" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "P05106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "id": "11546839", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11546839" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "15378069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15378069" }, { "id": "1TYE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1TYE" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "19111664", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19111664" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "2VC2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VC2" }, { "id": "2VDK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDK" }, { "id": "2VDL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDL" }, { "id": "2VDM", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDM" }, { "id": "2VDN", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDN" }, { "id": "2VDO", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDO" }, { "id": "2VDP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDP" }, { "id": "2VDQ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDQ" }, { "id": "2VDR", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDR" }, { "id": "3FCS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCS" }, { "id": "3FCU", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCU" }, { "id": "3NID", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NID" }, { "id": "3NIF", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NIF" }, { "id": "3NIG", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NIG" }, { "id": "3T3M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3T3M" }, { "id": "3T3P", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3T3P" }, { "id": "3ZDX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDX" }, { "id": "3ZDY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDY" }, { "id": "3ZDZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDZ" }, { "id": "3ZE0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE0" }, { "id": "3ZE1", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE1" }, { "id": "3ZE2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE2" }, { "id": "4CAK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4CAK" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4Z7Q", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4Z7Q" }, { "id": "5HDB", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5HDB" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "P05106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "id": "11546839", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11546839" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "15378069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15378069" }, { "id": "1TYE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1TYE" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "19111664", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19111664" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "2VC2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VC2" }, { "id": "2VDK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDK" }, { "id": "2VDL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDL" }, { "id": "2VDM", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDM" }, { "id": "2VDN", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDN" }, { "id": "2VDO", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDO" }, { "id": "2VDP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDP" }, { "id": "2VDQ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDQ" }, { "id": "2VDR", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2VDR" }, { "id": "3FCS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCS" }, { "id": "3FCU", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCU" }, { "id": "3NID", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NID" }, { "id": "3NIF", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NIF" }, { "id": "3NIG", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3NIG" }, { "id": "3T3M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3T3M" }, { "id": "3T3P", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3T3P" }, { "id": "3ZDX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDX" }, { "id": "3ZDY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDY" }, { "id": "3ZDZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZDZ" }, { "id": "3ZE0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE0" }, { "id": "3ZE1", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ZE1" }, { "id": "4CAK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4CAK" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "4Z7Q", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4Z7Q" }, { "id": "5HDB", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5HDB" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 478, "start_aa": "Asn", "end_pos": 478, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn478", "evidence": [ { "id": "P05106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "19111664", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19111664" }, { "id": "3FCS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCS" }, { "id": "4CAK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4CAK" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 585, "start_aa": "Asn", "end_pos": 585, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn585", "evidence": [ { "id": "P05106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "id": "11546839", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11546839" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "3IJE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IJE" }, { "id": "19704023", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19704023" }, { "id": "19111664", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19111664" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "3FCS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3FCS" }, { "id": "4CAK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4CAK" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "4G1M", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1M" }, { "id": "4MMX", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMX" }, { "id": "4MMY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMY" }, { "id": "4MMZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4MMZ" }, { "id": "4O02", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4O02" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 680, "start_aa": "Asn", "end_pos": 680, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn680", "evidence": [ { "id": "1416", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1416" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 680, "start_aa": "Asn", "end_pos": 680, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn680", "evidence": [ { "id": "1416", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1416" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 680, "start_aa": "Asn", "end_pos": 680, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn680", "evidence": [ { "id": "1416", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1416" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 680, "start_aa": "Asn", "end_pos": 680, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn680", "evidence": [ { "id": "P05106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "11546839", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11546839" }, { "id": "1JV2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1JV2" }, { "id": "1L5G", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1L5G" }, { "id": "1M1X", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1M1X" }, { "id": "4G1E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4G1E" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] } ], "phosphorylation": [ { "start_pos": 767, "end_pos": 767, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" } ], "site_lbl": "Thr767" }, { "start_pos": 767, "end_pos": 767, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "site_lbl": "Thr767" }, { "start_pos": 773, "end_pos": 773, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "11723131", "url": "https://glygen.org/publication/PubMed/11723131" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "PubMed", "id": "15699036", "url": "https://glygen.org/publication/PubMed/15699036" }, { "database": "PubMed", "id": "18398066", "url": "https://glygen.org/publication/PubMed/18398066" } ], "site_lbl": "Tyr773" }, { "start_pos": 773, "end_pos": 773, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "PubMed", "id": "19141530", "url": "https://glygen.org/publication/PubMed/19141530" }, { "database": "IntAct", "id": "P05106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05106*" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "12791772", "url": "https://glygen.org/publication/PubMed/12791772" }, { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "PubMed", "id": "8631894", "url": "https://glygen.org/publication/PubMed/8631894" }, { "database": "PubMed", "id": "27145276", "url": "https://glygen.org/publication/PubMed/27145276" } ], "site_lbl": "Tyr773" }, { "start_pos": 777, "end_pos": 777, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" } ], "site_lbl": "Thr777" }, { "start_pos": 778, "end_pos": 778, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "P05106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05106*" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "33436498", "url": "https://glygen.org/publication/PubMed/33436498" } ], "site_lbl": "Ser778" }, { "start_pos": 779, "end_pos": 779, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Thr779" }, { "start_pos": 779, "end_pos": 779, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Thr779" }, { "start_pos": 779, "end_pos": 779, "kinase_uniprot_canonical_ac": "Q15118-1", "kinase_gene_name": "PDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Thr779" }, { "start_pos": 779, "end_pos": 779, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PDPK1 and PKB/AKT1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "PRO", "id": "P05106", "url": "http://purl.obolibrary.org/obo/P05106" } ], "site_lbl": "Thr779" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "11723131", "url": "https://glygen.org/publication/PubMed/11723131" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "PubMed", "id": "8631894", "url": "https://glygen.org/publication/PubMed/8631894" } ], "site_lbl": "Tyr785" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "8631894", "url": "https://glygen.org/publication/PubMed/8631894" } ], "site_lbl": "Tyr785" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "8631894", "url": "https://glygen.org/publication/PubMed/8631894" }, { "database": "IntAct", "id": "P05106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05106*" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "33436498", "url": "https://glygen.org/publication/PubMed/33436498" }, { "database": "phospho.ELM", "id": "P05106", "url": "http://phospho.elm.eu.org/byAccession/P05106.html" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "PubMed", "id": "27145276", "url": "https://glygen.org/publication/PubMed/27145276" } ], "site_lbl": "Tyr785" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "The integrin alpha v beta 6 binds and activates latent TGF beta 1: a mechanism for regulating pulmonary inflammation and fibrosis.", "journal": "Cell", "date": "1999", "authors": "Munger JS, Huang X, Kawakatsu H, Griffiths MJ, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C, Matthay MA, Rifkin DB, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10025398", "url": "https://glygen.org/publication/PubMed/10025398" } ] }, { "title": "Vascular endothelial growth factor receptor KDR tyrosine kinase activity is increased by autophosphorylation of two activation loop tyrosine residues.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kendall RL, Rutledge RZ, Mao X, Tebben AJ, Hungate RW, Thomas KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10037737", "url": "https://glygen.org/publication/PubMed/10037737" } ] }, { "title": "Multisite autophosphorylation of p21-activated protein kinase gamma-PAK as a function of activation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gatti A, Huang Z, Tuazon PT, Traugh JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10075701", "url": "https://glygen.org/publication/PubMed/10075701" } ] }, { "title": "Carboxy-terminal conversion of profibrillin to fibrillin at a basic site by PACE/furin-like activity required for incorporation in the matrix.", "journal": "Journal of cell science", "date": "1999", "authors": "Raghunath M, Putnam EA, Ritty T, Hamstra D, Park ES, Tschodrich-Rotter M, Peters R, Rehemtulla A, Milewicz DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "10198291", "url": "https://glygen.org/publication/PubMed/10198291" } ] }, { "title": "Regulation of actin dynamics by stress-activated protein kinase 2 (SAPK2)-dependent phosphorylation of heat-shock protein of 27 kDa (Hsp27).", "journal": "Biochemical Society symposium", "date": "1999", "authors": "Landry J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10207622", "url": "https://glygen.org/publication/PubMed/10207622" } ] }, { "title": "The integrin alpha9beta1 mediates adhesion to activated endothelial cells and transendothelial neutrophil migration through interaction with vascular cell adhesion molecule-1.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Taooka Y, Chen J, Yednock T, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10209034", "url": "https://glygen.org/publication/PubMed/10209034" } ] }, { "title": "Embryonic death of Mek1-deficient mice reveals a role for this kinase in angiogenesis in the labyrinthine region of the placenta.", "journal": "Current biology : CB", "date": "1999", "authors": "Giroux S, Tremblay M, Bernard D, Cardin-Girard JF, Aubry S, Larouche L, Rousseau S, Huot J, Landry J, Jeannotte L, Charron J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "10209122", "url": "https://glygen.org/publication/PubMed/10209122" } ] }, { "title": "Homozygous Cys542-->Arg substitution in GPIIIa in a Swiss patient with type I Glanzmann's thrombasthenia.", "journal": "British journal of haematology", "date": "1999", "authors": "Ruan J, Schmugge M, Clemetson KJ, Cazes E, Combrie R, Bourre F, Nurden AT", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "10233432", "url": "https://glygen.org/publication/PubMed/10233432" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Differential association of cytoplasmic signalling molecules SHP-1, SHP-2, SHIP and phospholipase C-gamma1 with PECAM-1/CD31.", "journal": "FEBS letters", "date": "1999", "authors": "Pumphrey NJ, Taylor V, Freeman S, Douglas MR, Bradfield PF, Young SP, Lord JM, Wakelam MJ, Bird IN, Salmon M, Buckley CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "10350061", "url": "https://glygen.org/publication/PubMed/10350061" } ] }, { "title": "Alpha 2 beta 1 integrin mediates dermal fibroblast attachment to type VII collagen via a 158-amino-acid segment of the NC1 domain.", "journal": "Experimental cell research", "date": "1999", "authors": "Chen M, O'Toole EA, Li YY, Woodley DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10366422", "url": "https://glygen.org/publication/PubMed/10366422" } ] }, { "title": "Characterization of single-nucleotide polymorphisms in coding regions of human genes.", "journal": "Nature genetics", "date": "1999", "authors": "Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "10391209", "url": "https://glygen.org/publication/PubMed/10391209" } ] }, { "title": "Tyrosine phosphorylation of Vav stimulates IL-6 production in mast cells by a Rac/c-Jun N-terminal kinase-dependent pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Song JS, Haleem-Smith H, Arudchandran R, Gomez J, Scott PM, Mill JF, Tan TH, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10395673", "url": "https://glygen.org/publication/PubMed/10395673" } ] }, { "title": "The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor.", "journal": "Blood", "date": "1999-07-15", "authors": "Barillari G, Sgadari C, Fiorelli V, Samaniego F, Colombini S, Manzari V, Modesti A, Nair B C, Cafaro A, St\u00fcrzl M, Ensoli B", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "10397733", "url": "https://glygen.org/publication/PubMed/10397733" } ] }, { "title": "Kinase suppressor of Ras forms a multiprotein signaling complex and modulates MEK localization.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Stewart S, Sundaram M, Zhang Y, Lee J, Han M, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "10409742", "url": "https://glygen.org/publication/PubMed/10409742" } ] }, { "title": "Ultrastructural distribution of 36-kD microfibril-associated glycoprotein (MAGP-36) in human and bovine tissues.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1999", "authors": "Toyoshima T, Yamashita K, Furuichi H, Shishibori T, Itano T, Kobayashi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10424889", "url": "https://glygen.org/publication/PubMed/10424889" } ] }, { "title": "CD31 (PECAM-1) exists as a dimer and is heavily N-glycosylated.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Newton JP, Hunter AP, Simmons DL, Buckley CD, Harvey DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "10425179", "url": "https://glygen.org/publication/PubMed/10425179" } ] }, { "title": "The leukocyte integrin alpha D beta 2 binds VCAM-1: evidence for a binding interface between I domain and VCAM-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Van der Vieren M, Crowe DT, Hoekstra D, Vazeux R, Hoffman PA, Grayson MH, Bochner BS, Gallatin WM, Staunton DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10438935", "url": "https://glygen.org/publication/PubMed/10438935" } ] }, { "title": "Integrin signaling.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Giancotti FG, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "10446041", "url": "https://glygen.org/publication/PubMed/10446041" } ] }, { "title": "Characteristics of fibrinogen binding to the domain of CD11c, an alpha subunit of p150,95.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10543983", "url": "https://glygen.org/publication/PubMed/10543983" } ] }, { "title": "Tropoelastin binding to fibulins, nidogen-2 and other extracellular matrix proteins.", "journal": "FEBS letters", "date": "1999", "authors": "Sasaki T, Gohring W, Miosge N, Abrams WR, Rosenbloom J, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10544250", "url": "https://glygen.org/publication/PubMed/10544250" } ] }, { "title": "The integrin alpha(9)beta(1) binds to a novel recognition sequence (SVVYGLR) in the thrombin-cleaved amino-terminal fragment of osteopontin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yokosaki Y, Matsuura N, Sasaki T, Murakami I, Schneider H, Higashiyama S, Saitoh Y, Yamakido M, Taooka Y, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10593924", "url": "https://glygen.org/publication/PubMed/10593924" } ] }, { "title": "Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.", "journal": "Thrombosis and haemostasis", "date": "1999", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10605720", "url": "https://glygen.org/publication/PubMed/10605720" } ] }, { "title": "Homophilic NCAM interactions interfere with L1 stimulated neurite outgrowth.", "journal": "FEBS letters", "date": "1999", "authors": "Kristiansen LV, Marques FA, Soroka V, Ronn LC, Kiselyov V, Pedersen N, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10611478", "url": "https://glygen.org/publication/PubMed/10611478" } ] }, { "title": "Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.", "journal": "Experimental cell research", "date": "2000", "authors": "Byzova TV, Kim W, Midura RJ, Plow EF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10640428", "url": "https://glygen.org/publication/PubMed/10640428" } ] }, { "title": "Role of the latent transforming growth factor beta binding protein 1 in fibrillin-containing microfibrils in bone cells in vitro and in vivo.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2000", "authors": "Dallas SL, Keene DR, Bruder SP, Saharinen J, Sakai LY, Mundy GR, Bonewald LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10646116", "url": "https://glygen.org/publication/PubMed/10646116" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "A regulated interaction between alpha5beta1 integrin and osteopontin.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Barry ST, Ludbrook SB, Murrison E, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10673366", "url": "https://glygen.org/publication/PubMed/10673366" } ] }, { "title": "Phosphatidylinositol 3-kinase signaling mediates angiogenesis and expression of vascular endothelial growth factor in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Jiang BH, Zheng JZ, Aoki M, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10677529", "url": "https://glygen.org/publication/PubMed/10677529" } ] }, { "title": "VRAP is an adaptor protein that binds KDR, a receptor for vascular endothelial cell growth factor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Wu LW, Mayo LD, Dunbar JD, Kessler KM, Ozes ON, Warren RS, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10692392", "url": "https://glygen.org/publication/PubMed/10692392" } ] }, { "title": "Distinct recognition of collagen subtypes by alpha(1)beta(1) and alpha(2)beta(1) integrins. Alpha(1)beta(1) mediates cell adhesion to type XIII collagen.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nykvist P, Tu H, Ivaska J, Kapyla J, Pihlajaniemi T, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10713152", "url": "https://glygen.org/publication/PubMed/10713152" } ] }, { "title": "beta-arrestin-dependent endocytosis of proteinase-activated receptor 2 is required for intracellular targeting of activated ERK1/2.", "journal": "The Journal of cell biology", "date": "2000", "authors": "DeFea KA, Zalevsky J, Thoma MS, Dery O, Mullins RD, Bunnett NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "10725339", "url": "https://glygen.org/publication/PubMed/10725339" } ] }, { "title": "Vascular endothelial growth factor (VEGF)-driven actin-based motility is mediated by VEGFR2 and requires concerted activation of stress-activated protein kinase 2 (SAPK2/p38) and geldanamycin-sensitive phosphorylation of focal adhesion kinase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Rousseau S, Houle F, Kotanides H, Witte L, Waltenberger J, Landry J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10744763", "url": "https://glygen.org/publication/PubMed/10744763" } ] }, { "title": "The Shc-related adaptor protein, Sck, forms a complex with the vascular-endothelial-growth-factor receptor KDR in transfected cells.", "journal": "The Biochemical journal", "date": "2000", "authors": "Warner AJ, Lopez-Dee J, Knight EL, Feramisco JR, Prigent SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "10749680", "url": "https://glygen.org/publication/PubMed/10749680" } ] }, { "title": "Crk activation of JNK via C3G and R-Ras.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Mochizuki N, Ohba Y, Kobayashi S, Otsuka N, Graybiel AM, Tanaka S, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708" } ], "reference": [ { "type": "PubMed", "id": "10777559", "url": "https://glygen.org/publication/PubMed/10777559" } ] }, { "title": "A MAP kinase-signaling pathway mediates neurite outgrowth on L1 and requires Src-dependent endocytosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2000", "authors": "Schmid RS, Pruitt WM, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10818153", "url": "https://glygen.org/publication/PubMed/10818153" } ] }, { "title": "Collagen, convulxin, and thrombin stimulate aggregation-independent tyrosine phosphorylation of CD31 in platelets. Evidence for the involvement of Src family kinases.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cicmil M, Thomas JM, Sage T, Barry FA, Leduc M, Bon C, Gibbins JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "10858437", "url": "https://glygen.org/publication/PubMed/10858437" } ] }, { "title": "Identification of B-KSR1, a novel brain-specific isoform of KSR1 that functions in neuronal signaling.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Muller J, Cacace AM, Lyons WE, McGill CB, Morrison DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "10891492", "url": "https://glygen.org/publication/PubMed/10891492" } ] }, { "title": "Threonine phosphorylation of the beta 3 integrin cytoplasmic tail, at a site recognized by PDK1 and Akt/PKB in vitro, regulates Shc binding.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kirk RI, Sanderson MR, Lerea KM", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" }, { "database": "iPTMnet", "id": "P05106-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106-1" } ], "reference": [ { "type": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" } ] }, { "title": "Specific sequence motif of 8-Cys repeats of TGF-beta binding proteins, LTBPs, creates a hydrophobic interaction surface for binding of small latent TGF-beta.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Saharinen J, Keski-Oja J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10930463", "url": "https://glygen.org/publication/PubMed/10930463" } ] }, { "title": "Fibrillin-rich microfibrils of the extracellular matrix: ultrastructure and assembly.", "journal": "Micron (Oxford, England : 1993)", "date": "2001", "authors": "Sherratt MJ, Wess TJ, Baldock C, Ashworth J, Purslow PP, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "10936461", "url": "https://glygen.org/publication/PubMed/10936461" } ] }, { "title": "Identification of shc as the primary protein binding to the tyrosine-phosphorylated beta 3 subunit of alpha IIbbeta 3 during outside-in integrin platelet signaling.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cowan KJ, Law DA, Phillips DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "10964917", "url": "https://glygen.org/publication/PubMed/10964917" } ] }, { "title": "Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Chandrasekaran L, He CZ, Al-Barazi H, Krutzsch HC, Iruela-Arispe ML, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10982388", "url": "https://glygen.org/publication/PubMed/10982388" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2001", "authors": "Souchelnytskyi S, Ronnstrand L, Heldin CH, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11100470", "url": "https://glygen.org/publication/PubMed/11100470" } ] }, { "title": "Evidence that furin is an authentic transforming growth factor-beta1-converting enzyme.", "journal": "The American journal of pathology", "date": "2001", "authors": "Dubois CM, Blanchette F, Laprise MH, Leduc R, Grondin F, Seidah NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11141505", "url": "https://glygen.org/publication/PubMed/11141505" } ] }, { "title": "Interaction of endostatin with integrins implicated in angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rehn M, Veikkola T, Kukk-Valdre E, Nakamura H, Ilmonen M, Lombardo C, Pihlajaniemi T, Alitalo K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11158588", "url": "https://glygen.org/publication/PubMed/11158588" } ] }, { "title": "Entry of human parechovirus 1.", "journal": "Journal of virology", "date": "2001-02", "authors": "Joki-Korpela P, Marjom\u00e4ki V, Krogerus C, Heino J, Hyypi\u00e4 T", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "11160695", "url": "https://glygen.org/publication/PubMed/11160695" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Active Ras induces heterodimerization of cRaf and BRaf.", "journal": "Cancer research", "date": "2001", "authors": "Weber CK, Slupsky JR, Kalmes HA, Rapp UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "11325826", "url": "https://glygen.org/publication/PubMed/11325826" } ] }, { "title": "Processing of immunosuppressive pro-TGF-beta 1,2 by human glioblastoma cells involves cytoplasmic and secreted furin-like proteases.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Leitlein J, Aulwurm S, Waltereit R, Naumann U, Wagenknecht B, Garten W, Weller M, Platten M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11390472", "url": "https://glygen.org/publication/PubMed/11390472" } ] }, { "title": "Biochemical signals and biological responses elicited by the focal adhesion kinase.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Schaller MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "11476890", "url": "https://glygen.org/publication/PubMed/11476890" } ] }, { "title": "Protein interaction studies of MAGP-1 with tropoelastin and fibrillin-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Jensen SA, Reinhardt DP, Gibson MA, Weiss AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "11481325", "url": "https://glygen.org/publication/PubMed/11481325" } ] }, { "title": "alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.", "journal": "Developmental biology", "date": "2001", "authors": "Tiger CF, Fougerousse F, Grundstrom G, Velling T, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11518510", "url": "https://glygen.org/publication/PubMed/11518510" } ] }, { "title": "Crystal structure of the extracellular segment of integrin alpha Vbeta3.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Xiong JP, Stehle T, Diefenbach B, Zhang R, Dunker R, Scott DL, Joachimiak A, Goodman SL, Arnaout MA", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "11546839", "url": "https://glygen.org/publication/PubMed/11546839" } ] }, { "title": "Selective binding of collagen subtypes by integrin alpha 1I, alpha 2I, and alpha 10I domains.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tulla M, Pentikainen OT, Viitasalo T, Kapyla J, Impola U, Nykvist P, Nissinen L, Johnson MS, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11572855", "url": "https://glygen.org/publication/PubMed/11572855" } ] }, { "title": "A point mutation in the cysteine-rich domain of glycoprotein (GP) IIIa results in the expression of a GPIIb-IIIa (alphaIIbbeta3) integrin receptor locked in a high-affinity state and a Glanzmann thrombasthenia-like phenotype.", "journal": "Blood", "date": "2001", "authors": "Ruiz C, Liu CY, Sun QH, Sigaud-Fiks M, Fressinaud E, Muller JY, Nurden P, Nurden AT, Newman PJ, Valentin N", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "11588040", "url": "https://glygen.org/publication/PubMed/11588040" } ] }, { "title": "Multiple stimuli induce tyrosine phosphorylation of the Crk-binding sites of paxillin.", "journal": "The Biochemical journal", "date": "2001", "authors": "Schaller MD, Schaefer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11695992", "url": "https://glygen.org/publication/PubMed/11695992" } ] }, { "title": "Src mediates stimulation by vascular endothelial growth factor of the phosphorylation of focal adhesion kinase at tyrosine 861, and migration and anti-apoptosis in endothelial cells.", "journal": "The Biochemical journal", "date": "2001", "authors": "Abu-Ghazaleh R, Kabir J, Jia H, Lobo M, Zachary I", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "11696015", "url": "https://glygen.org/publication/PubMed/11696015" } ] }, { "title": "Distinct glycoprotein Ib/V/IX and integrin alpha IIbbeta 3-dependent calcium signals cooperatively regulate platelet adhesion under flow.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nesbitt WS, Kulkarni S, Giuliano S, Goncalves I, Dopheide SM, Yap CL, Harper IS, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11713259", "url": "https://glygen.org/publication/PubMed/11713259" } ] }, { "title": "Phosphorylation of beta3 integrin controls ligand binding strength.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Datta A, Huber F, Boettiger D", "evidence": [ { "database": "iPTMnet", "id": "P05106-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106-1" } ], "reference": [ { "type": "PubMed", "id": "11723131", "url": "https://glygen.org/publication/PubMed/11723131" } ] }, { "title": "Identification of Sef, a novel modulator of FGF signalling.", "journal": "Nature cell biology", "date": "2002", "authors": "Tsang M, Friesel R, Kudoh T, Dawid IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "11802164", "url": "https://glygen.org/publication/PubMed/11802164" } ] }, { "title": "Sef is a feedback-induced antagonist of Ras/MAPK-mediated FGF signalling.", "journal": "Nature cell biology", "date": "2002", "authors": "Furthauer M, Lin W, Ang SL, Thisse B, Thisse C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "11802165", "url": "https://glygen.org/publication/PubMed/11802165" } ] }, { "title": "Different splice variants of filamin-B affect myogenesis, subcellular distribution, and determine binding to integrin (beta) subunits.", "journal": "J. Cell Biol.", "date": "2002", "authors": "van der Flier A, Kuikman I, Kramer D, Geerts D, Kreft M, Takafuta T, Shapiro SS, Sonnenberg A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "11807098", "url": "https://glygen.org/publication/PubMed/11807098" } ] }, { "title": "A novel 196Leu to Pro substitution in the beta3 subunit of the alphaIIbbeta3 integrin in a patient with a variant form of Glanzmann thrombasthenia.", "journal": "Platelets", "date": "2002", "authors": "Nurden AT, Ruan J, Pasquet JM, Gauthier B, Combrie R, Kunicki T, Nurden P", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "11897046", "url": "https://glygen.org/publication/PubMed/11897046" } ] }, { "title": "Coordinate interactions of Csk, Src, and Syk kinases with [alpha]IIb[beta]3 initiate integrin signaling to the cytoskeleton.", "journal": "J. Cell Biol.", "date": "2002", "authors": "Obergfell A, Eto K, Mocsai A, Buensuceso C, Moores SL, Brugge JS, Lowell CA, Shattil SJ", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "11940607", "url": "https://glygen.org/publication/PubMed/11940607" } ] }, { "title": "The integrin alpha(v)beta8 mediates epithelial homeostasis through MT1-MMP-dependent activation of TGF-beta1.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mu D, Cambier S, Fjellbirkeland L, Baron JL, Munger JS, Kawakatsu H, Sheppard D, Broaddus VC, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "11970960", "url": "https://glygen.org/publication/PubMed/11970960" } ] }, { "title": "Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Li Z, Calzada MJ, Sipes JM, Cashel JA, Krutzsch HC, Annis DS, Mosher DF, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11980922", "url": "https://glygen.org/publication/PubMed/11980922" } ] }, { "title": "The structural basis of localization and signaling by the focal adhesion targeting domain.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Arold ST, Hoellerer MK, Noble ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-354194", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354194" } ], "reference": [ { "type": "PubMed", "id": "12005431", "url": "https://glygen.org/publication/PubMed/12005431" } ] }, { "title": "A new platelet polymorphism Duv(a+), localized within the RGD binding domain of glycoprotein IIIa, is associated with neonatal thrombocytopenia.", "journal": "Blood", "date": "2002", "authors": "Jallu V, Meunier M, Brement M, Kaplan C", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "12036875", "url": "https://glygen.org/publication/PubMed/12036875" } ] }, { "title": "Mutations of the BRAF gene in human cancer.", "journal": "Nature", "date": "2002", "authors": "Davies H, Bignell GR, Cox C, Stephens P, Edkins S, Clegg S, Teague J, Woffendin H, Garnett MJ, Bottomley W, Davis N, Dicks E, Ewing R, Floyd Y, Gray K, Hall S, Hawes R, Hughes J, Kosmidou V, Menzies A, Mould C, Parker A, Stevens C, Watt S, Hooper S, Wilson R, Jayatilake H, Gusterson BA, Cooper C, Shipley J, Hargrave D, Pritchard-Jones K, Maitland N, Chenevix-Trench G, Riggins GJ, Bigner DD, Palmieri G, Cossu A, Flanagan A, Nicholson A, Ho JW, Leung SY, Yuen ST, Weber BL, Seigler HF, Darrow TL, Paterson H, Marais R, Marshall CJ, Wooster R, Stratton MR, Futreal PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "12068308", "url": "https://glygen.org/publication/PubMed/12068308" } ] }, { "title": "Glanzmann's thrombasthenia: identification of 19 new mutations in 30 patients.", "journal": "Thrombosis and haemostasis", "date": "2002", "authors": "D'Andrea G, Colaizzo D, Vecchione G, Grandone E, Di Minno G, Margaglione M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "12083483", "url": "https://glygen.org/publication/PubMed/12083483" } ] }, { "title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.", "journal": "Nature cell biology", "date": "2002", "authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12134158", "url": "https://glygen.org/publication/PubMed/12134158" } ] }, { "title": "Sck is expressed in endothelial cells and participates in vascular endothelial growth factor-induced signaling.", "journal": "Oncogene", "date": "2002", "authors": "Ratcliffe KE, Tao Q, Yavuz B, Stoletov KV, Spring SC, Terman BI", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12214271", "url": "https://glygen.org/publication/PubMed/12214271" } ] }, { "title": "Cdc42/Rac1-mediated activation primes PAK2 for superactivation by tyrosine phosphorylation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Renkema GH, Pulkkinen K, Saksela K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12215529", "url": "https://glygen.org/publication/PubMed/12215529" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Two new beta3 integrin mutations in Indian patients with Glanzmann thrombasthenia: localization of mutations affecting cysteine residues in integrin beta3.", "journal": "Thrombosis and haemostasis", "date": "2002", "authors": "Nair S, Li J, Mitchell WB, Mohanty D, Coller BS, French DL", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "12353082", "url": "https://glygen.org/publication/PubMed/12353082" } ] }, { "title": "The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.", "journal": "The Biochemical journal", "date": "2003", "authors": "Ludbrook SB, Barry ST, Delves CJ, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12358597", "url": "https://glygen.org/publication/PubMed/12358597" } ] }, { "title": "Alternative splicing controls the mechanisms of FAK autophosphorylation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Toutant M, Costa A, Studler JM, Kadare G, Carnaud M, Girault JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12391143", "url": "https://glygen.org/publication/PubMed/12391143" } ] }, { "title": "Integrin alpha8beta1 mediates adhesion to LAP-TGFbeta1.", "journal": "Journal of cell science", "date": "2002", "authors": "Lu M, Munger JS, Steadele M, Busald C, Tellier M, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12415008", "url": "https://glygen.org/publication/PubMed/12415008" } ] }, { "title": "Latent transforming growth factor beta-binding protein 1 interacts with fibrillin and is a microfibril-associated protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Isogai Z, Ono RN, Ushiro S, Keene DR, Chen Y, Mazzieri R, Charbonneau NL, Reinhardt DP, Rifkin DB, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12429738", "url": "https://glygen.org/publication/PubMed/12429738" } ] }, { "title": "Cis and trans interactions of L1 with neuropilin-1 control axonal responses to semaphorin 3A.", "journal": "The EMBO journal", "date": "2002", "authors": "Castellani V, De Angelis E, Kenwrick S, Rougon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "12456642", "url": "https://glygen.org/publication/PubMed/12456642" } ] }, { "title": "The Shb adaptor protein causes Src-dependent cell spreading and activation of focal adhesion kinase in murine brain endothelial cells.", "journal": "Cellular signalling", "date": "2003", "authors": "Holmqvist K, Cross M, Riley D, Welsh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12464388", "url": "https://glygen.org/publication/PubMed/12464388" } ] }, { "title": "The stability of the G protein-coupled receptor-beta-arrestin interaction determines the mechanism and functional consequence of ERK activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tohgo A, Choy EW, Gesty-Palmer D, Pierce KL, Laporte S, Oakley RH, Caron MG, Lefkowitz RJ, Luttrell LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "12473660", "url": "https://glygen.org/publication/PubMed/12473660" } ] }, { "title": "Localization of the MP1-MAPK scaffold complex to endosomes is mediated by p14 and required for signal transduction.", "journal": "Developmental cell", "date": "2002", "authors": "Teis D, Wunderlich W, Huber LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "12479806", "url": "https://glygen.org/publication/PubMed/12479806" } ] }, { "title": "Novel role of gp91(phox)-containing NAD(P)H oxidase in vascular endothelial growth factor-induced signaling and angiogenesis.", "journal": "Circulation research", "date": "2002", "authors": "Ushio-Fukai M, Tang Y, Fukai T, Dikalov SI, Ma Y, Fujimoto M, Quinn MT, Pagano PJ, Johnson C, Alexander RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12480817", "url": "https://glygen.org/publication/PubMed/12480817" } ] }, { "title": "Making sense of latent TGFbeta activation.", "journal": "Journal of cell science", "date": "2003", "authors": "Annes JP, Munger JS, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "12482908", "url": "https://glygen.org/publication/PubMed/12482908" } ] }, { "title": "alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang WM, Kapyla J, Puranen JS, Knight CG, Tiger CF, Pentikainen OT, Johnson MS, Farndale RW, Heino J, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12496264", "url": "https://glygen.org/publication/PubMed/12496264" } ] }, { "title": "Bidirectional integrin alphaIIbbeta3 signalling regulating platelet adhesion under flow: contribution of protein kinase C.", "journal": "The Biochemical journal", "date": "2003", "authors": "Giuliano S, Nesbitt WS, Rooney M, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708" } ], "reference": [ { "type": "PubMed", "id": "12585966", "url": "https://glygen.org/publication/PubMed/12585966" } ] }, { "title": "Focal adhesion kinase: the first ten years.", "journal": "Journal of cell science", "date": "2003", "authors": "Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708" } ], "reference": [ { "type": "PubMed", "id": "12640026", "url": "https://glygen.org/publication/PubMed/12640026" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Sudhakar A, Sugimoto H, Yang C, Lively J, Zeisberg M, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12682293", "url": "https://glygen.org/publication/PubMed/12682293" } ] }, { "title": "CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Lin Cristiane G, Leu Shr-Jeng, Chen Ningyu, Tebeau Christopher M, Lin Shao-Xia, Yeung Cho-Yau, Lau Lester F", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "12695522", "url": "https://glygen.org/publication/PubMed/12695522" } ] }, { "title": "Tyrosine phosphorylation of the beta3-subunit of the alphaVbeta3 integrin is required for embrane association of the tyrosine phosphatase SHP-2 and its further recruitment to the insulin-like growth factor I receptor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003-09", "authors": "Ling Yan, Maile Laura A, Clemmons David R", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "12791772", "url": "https://glygen.org/publication/PubMed/12791772" } ] }, { "title": "Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" } ] }, { "title": "VEGF guides angiogenic sprouting utilizing endothelial tip cell filopodia.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Gerhardt H, Golding M, Fruttiger M, Ruhrberg C, Lundkvist A, Abramsson A, Jeltsch M, Mitchell C, Alitalo K, Shima D, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12810700", "url": "https://glygen.org/publication/PubMed/12810700" } ] }, { "title": "Integrin alphavbeta3, requirement for VEGFR2-mediated activation of SAPK2/p38 and for Hsp90-dependent phosphorylation of focal adhesion kinase in endothelial cells activated by VEGF.", "journal": "Cell stress & chaperones", "date": "2003", "authors": "Masson-Gadais B, Houle F, Laferriere J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "12820653", "url": "https://glygen.org/publication/PubMed/12820653" } ] }, { "title": "Mek2 is dispensable for mouse growth and development.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Belanger LF, Roy S, Tremblay M, Brott B, Steff AM, Mourad W, Hugo P, Erikson R, Charron J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "12832465", "url": "https://glygen.org/publication/PubMed/12832465" } ] }, { "title": "Syndecan-4 as a molecule involved in defense mechanisms.", "journal": "Glycoconjugate journal", "date": "2002", "authors": "Ishiguro K, Kojima T, Muramatsu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "12975610", "url": "https://glygen.org/publication/PubMed/12975610" } ] }, { "title": "TGF beta signals through a heteromeric protein kinase receptor complex.", "journal": "Cell", "date": "1992", "authors": "Wrana JL, Attisano L, Carcamo J, Zentella A, Doody J, Laiho M, Wang XF, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "1333888", "url": "https://glygen.org/publication/PubMed/1333888" } ] }, { "title": "A spontaneous mutation of integrin alpha IIb beta 3 (platelet glycoprotein IIb-IIIa) helps define a ligand binding site.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bajt ML, Ginsberg MH, Frelinger AL 3rd, Berndt MC, Loftus JC", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "1371279", "url": "https://glygen.org/publication/PubMed/1371279" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "The gene organization of the human beta 7 subunit, the common beta subunit of the leukocyte integrins HML-1 and LPAM-1.", "journal": "Int. Immunol.", "date": "1992", "authors": "Jiang W M, Jenkins D, Yuan Q, Leung E, Choo K H, Watson J D, Krissansen G W", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "1382574", "url": "https://glygen.org/publication/PubMed/1382574" } ] }, { "title": "Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Balbona K, Tran H, Godyna S, Ingham KC, Strickland DK, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1400330", "url": "https://glygen.org/publication/PubMed/1400330" } ] }, { "title": "An amino acid polymorphism within the RGD binding domain of platelet membrane glycoprotein IIIa is responsible for the formation of the Pena/Penb alloantigen system.", "journal": "The Journal of clinical investigation", "date": "1992", "authors": "Wang R, Furihata K, McFarland JG, Friedman K, Aster RH, Newman PJ", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "1430225", "url": "https://glygen.org/publication/PubMed/1430225" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Ser-752-->Pro mutation in the cytoplasmic domain of integrin beta 3 subunit and defective activation of platelet integrin alpha IIb beta 3 (glycoprotein IIb-IIIa) in a variant of Glanzmann thrombasthenia.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Chen YP, Djaffar I, Pidard D, Steiner B, Cieutat AM, Caen JP, Rosa JP", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "1438206", "url": "https://glygen.org/publication/PubMed/1438206" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Phosphorylation-dependent paxillin-ERK association mediates hepatocyte growth factor-stimulated epithelial morphogenesis.", "journal": "Molecular cell", "date": "2003", "authors": "Ishibe S, Joly D, Zhu X, Cantley LG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "14636584", "url": "https://glygen.org/publication/PubMed/14636584" } ] }, { "title": "Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover.", "journal": "Cell communication & adhesion", "date": "2003", "authors": "Wilkins-Port CE, Sanderson RD, Tominna-Sebald E, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14681059", "url": "https://glygen.org/publication/PubMed/14681059" } ] }, { "title": "EMILIN-1 deficiency induces elastogenesis and vascular cell defects.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zanetti M, Braghetta P, Sabatelli P, Mura I, Doliana R, Colombatti A, Volpin D, Bonaldo P, Bressan GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "14701737", "url": "https://glygen.org/publication/PubMed/14701737" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Activation of EGF receptor kinase by L1-mediated homophilic cell interactions.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Islam R, Kristiansen LV, Romani S, Garcia-Alonso L, Hortsch M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "14718570", "url": "https://glygen.org/publication/PubMed/14718570" } ] }, { "title": "Phosphorylation of tyrosine 1214 on VEGFR2 is required for VEGF-induced activation of Cdc42 upstream of SAPK2/p38.", "journal": "Oncogene", "date": "2004", "authors": "Lamalice L, Houle F, Jourdan G, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "14724572", "url": "https://glygen.org/publication/PubMed/14724572" } ] }, { "title": "Integrin activation.", "journal": "Journal of cell science", "date": "2004", "authors": "Calderwood DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "14754902", "url": "https://glygen.org/publication/PubMed/14754902" } ] }, { "title": "IQGAP1 binds ERK2 and modulates its activity.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Roy M, Li Z, Sacks DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "14970219", "url": "https://glygen.org/publication/PubMed/14970219" } ] }, { "title": "Syndecan-2 regulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen L, Klass C, Woods A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14976204", "url": "https://glygen.org/publication/PubMed/14976204" } ] }, { "title": "The adaptor protein shb binds to tyrosine 1175 in vascular endothelial growth factor (VEGF) receptor-2 and regulates VEGF-dependent cellular migration.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Holmqvist K, Cross MJ, Rolny C, Hagerkvist R, Rahimi N, Matsumoto T, Claesson-Welsh L, Welsh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15026417", "url": "https://glygen.org/publication/PubMed/15026417" } ] }, { "title": "Mechanism of activation of the RAF-ERK signaling pathway by oncogenic mutations of B-RAF.", "journal": "Cell", "date": "2004", "authors": "Wan PT, Garnett MJ, Roe SM, Lee S, Niculescu-Duvaz D, Good VM, Jones CM, Marshall CJ, Springer CJ, Barford D, Marais R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "15035987", "url": "https://glygen.org/publication/PubMed/15035987" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Modular construction of a signaling scaffold: MORG1 interacts with components of the ERK cascade and links ERK signaling to specific agonists.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Vomastek T, Schaeffer HJ, Tarcsafalvi A, Smolkin ME, Bissonette EA, Weber MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "15118098", "url": "https://glygen.org/publication/PubMed/15118098" } ] }, { "title": "Myosin-X provides a motor-based link between integrins and the cytoskeleton.", "journal": "Nat. Cell Biol.", "date": "2004", "authors": "Zhang Hongquan, Berg Jonathan S, Li Zhilun, Wang Yunling, L\u00e5ng Pernilla, Sousa Aurea D, Bhaskar Aparna, Cheney Richard E, Str\u00f6mblad Staffan", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15156152", "url": "https://glygen.org/publication/PubMed/15156152" } ] }, { "title": "Structural basis for integrin alphaIIbbeta3 clustering.", "journal": "Biochemical Society transactions", "date": "2004", "authors": "Li R, Bennett JS, Degrado WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "15157149", "url": "https://glygen.org/publication/PubMed/15157149" } ] }, { "title": "Sef is a spatial regulator for Ras/MAP kinase signaling.", "journal": "Developmental cell", "date": "2004", "authors": "Torii S, Kusakabe M, Yamamoto T, Maekawa M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "15239952", "url": "https://glygen.org/publication/PubMed/15239952" } ] }, { "title": "Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bix G, Fu J, Gonzalez EM, Macro L, Barker A, Campbell S, Zutter MM, Santoro SA, Kim JK, Hook M, Reed CC, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15240572", "url": "https://glygen.org/publication/PubMed/15240572" } ] }, { "title": "Regulation of vascular endothelial growth factor receptor 2-mediated phosphorylation of focal adhesion kinase by heat shock protein 90 and Src kinase activities.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Le Boeuf F, Houle F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15247219", "url": "https://glygen.org/publication/PubMed/15247219" } ] }, { "title": "Sef: a MEK/ERK catcher on the Golgi.", "journal": "Molecular cell", "date": "2004", "authors": "Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "15260967", "url": "https://glygen.org/publication/PubMed/15260967" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Activation of Rac1 by paxillin-Crk-DOCK180 signaling complex is antagonized by Rap1 in migrating NBT-II cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Valles AM, Beuvin M, Boyer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15308668", "url": "https://glygen.org/publication/PubMed/15308668" } ] }, { "title": "Functional assessment of alphaEbeta7/E-cadherin interactions in the steady state postnatal thymus.", "journal": "Clinical & developmental immunology", "date": "2004", "authors": "Prockop SE, Petrie HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15330449", "url": "https://glygen.org/publication/PubMed/15330449" } ] }, { "title": "CalDAG-GEFI integrates signaling for platelet aggregation and thrombus formation.", "journal": "Nature medicine", "date": "2004", "authors": "Crittenden JR, Bergmeier W, Zhang Y, Piffath CL, Liang Y, Wagner DD, Housman DE, Graybiel AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "15334074", "url": "https://glygen.org/publication/PubMed/15334074" } ] }, { "title": "Galectin-3 is induced in rheumatoid arthritis synovial fibroblasts after adhesion to cartilage oligomeric matrix protein.", "journal": "Annals of the rheumatic diseases", "date": "2005", "authors": "Neidhart M, Zaucke F, von Knoch R, Jungel A, Michel BA, Gay RE, Gay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15345499", "url": "https://glygen.org/publication/PubMed/15345499" } ] }, { "title": "Structural basis of heteromeric smad protein assembly in TGF-beta signaling.", "journal": "Molecular cell", "date": "2004", "authors": "Chacko BM, Qin BY, Tiwari A, Shi G, Lam S, Hayward LJ, De Caestecker M, Lin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "15350224", "url": "https://glygen.org/publication/PubMed/15350224" } ] }, { "title": "Structural basis for allostery in integrins and binding to fibrinogen-mimetic therapeutics.", "journal": "Nature", "date": "2004-11-04", "authors": "Xiao Tsan, Takagi Junichi, Coller Barry S, Wang Jia-Huai, Springer Timothy A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15378069", "url": "https://glygen.org/publication/PubMed/15378069" } ] }, { "title": "The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kapyla J, Jaalinoja J, Tulla M, Ylostalo J, Nissinen L, Viitasalo T, Vehvilainen P, Marjomaki V, Nykvist P, Saamanen AM, Farndale RW, Birk DE, Ala-Kokko L, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15383545", "url": "https://glygen.org/publication/PubMed/15383545" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "A role for the thiol isomerase protein ERP5 in platelet function.", "journal": "Blood", "date": "2005", "authors": "Jordan PA, Stevens JM, Hubbard GP, Barrett NE, Sage T, Authi KS, Gibbins JM", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15466936", "url": "https://glygen.org/publication/PubMed/15466936" } ] }, { "title": "RIAM, an Ena/VASP and Profilin ligand, interacts with Rap1-GTP and mediates Rap1-induced adhesion.", "journal": "Developmental cell", "date": "2004", "authors": "Lafuente EM, van Puijenbroek AA, Krause M, Carman CV, Freeman GJ, Berezovskaya A, Constantine E, Springer TA, Gertler FB, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "15469846", "url": "https://glygen.org/publication/PubMed/15469846" } ] }, { "title": "The syndecan-1 ectodomain regulates alphavbeta3 integrin activity in human mammary carcinoma cells.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Beauvais DM, Burbach BJ, Rapraeger AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "15479743", "url": "https://glygen.org/publication/PubMed/15479743" } ] }, { "title": "The RAF proteins take centre stage.", "journal": "Nature reviews. Molecular cell biology", "date": "2004", "authors": "Wellbrock C, Karasarides M, Marais R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "15520807", "url": "https://glygen.org/publication/PubMed/15520807" } ] }, { "title": "Structures of human MAP kinase kinase 1 (MEK1) and MEK2 describe novel noncompetitive kinase inhibition.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Ohren JF, Chen H, Pavlovsky A, Whitehead C, Zhang E, Kuffa P, Yan C, McConnell P, Spessard C, Banotai C, Mueller WT, Delaney A, Omer C, Sebolt-Leopold J, Dudley DT, Leung IK, Flamme C, Warmus J, Kaufman M, Barrett S, Tecle H, Hasemann CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "15543157", "url": "https://glygen.org/publication/PubMed/15543157" } ] }, { "title": "MEK partner 1 (MP1): regulation of oligomerization in MAP kinase signaling.", "journal": "Journal of cellular biochemistry", "date": "2005", "authors": "Sharma C, Vomastek T, Tarcsafalvi A, Catling AD, Schaeffer HJ, Eblen ST, Weber MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "15547943", "url": "https://glygen.org/publication/PubMed/15547943" } ] }, { "title": "TGF-beta activation by traction?", "journal": "Trends in cell biology", "date": "2004", "authors": "Keski-Oja J, Koli K, von Melchner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "15564041", "url": "https://glygen.org/publication/PubMed/15564041" } ] }, { "title": "A variant thrombasthenic phenotype associated with compound heterozygosity of integrin beta3-subunit: (Met124Val)beta3 alters the subunit dimerization rendering a decreased number of constitutive active alphaIIbbeta3 receptors.", "journal": "Thrombosis and haemostasis", "date": "2004", "authors": "Gonzalez-Manchon C, Butta N, Larrucea S, Arias-Salgado EG, Alonso S, Lopez A, Parrilla R", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15583747", "url": "https://glygen.org/publication/PubMed/15583747" } ] }, { "title": "Adhesion molecule L1 stimulates neuronal migration through Vav2-Pak1 signaling.", "journal": "Neuroreport", "date": "2004", "authors": "Schmid RS, Midkiff BR, Kedar VP, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "15597056", "url": "https://glygen.org/publication/PubMed/15597056" } ] }, { "title": "Oncogenic AKAP9-BRAF fusion is a novel mechanism of MAPK pathway activation in thyroid cancer.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Ciampi R, Knauf JA, Kerler R, Gandhi M, Zhu Z, Nikiforova MN, Rabes HM, Fagin JA, Nikiforov YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "15630448", "url": "https://glygen.org/publication/PubMed/15630448" } ] }, { "title": "Double heterozygosity for a novel missense mutation of Ile304 to Asn in addition to the missense mutation His280 to Pro in the integrin beta3 gene as a cause of the absence of platelet alphaIIbbeta3 in Glanzmann's thrombasthenia.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Tanaka S, Hayashi T, Yoshimura K, Nakayama M, Fujita T, Amano T, Tani Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15634267", "url": "https://glygen.org/publication/PubMed/15634267" } ] }, { "title": "Focal adhesion kinase: in command and control of cell motility.", "journal": "Nature reviews. Molecular cell biology", "date": "2005", "authors": "Mitra SK, Hanson DA, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15688067", "url": "https://glygen.org/publication/PubMed/15688067" } ] }, { "title": "Tyrosine phosphorylation of beta3 integrin provides a binding site for Pyk2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Butler B, Blystone SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15695828", "url": "https://glygen.org/publication/PubMed/15695828" } ] }, { "title": "Beta3 tyrosine phosphorylation and alphavbeta3-mediated adhesion are required for Vav1 association and Rho activation in leukocytes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gao C, Schaefer E, Lakkis M, Blystone SD", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "15699036", "url": "https://glygen.org/publication/PubMed/15699036" } ] }, { "title": "Loss of alpha10beta1 integrin expression leads to moderate dysfunction of growth plate chondrocytes.", "journal": "Journal of cell science", "date": "2005", "authors": "Bengtsson T, Aszodi A, Nicolae C, Hunziker EB, Lundgren-Akerlund E, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15713743", "url": "https://glygen.org/publication/PubMed/15713743" } ] }, { "title": "Mutations in GPIIIa molecule as a cause for Glanzmann thrombasthenia in Indian patients.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Nair S, Ghosh K, Shetty S, Mohanty D", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15748237", "url": "https://glygen.org/publication/PubMed/15748237" } ] }, { "title": "Integrin alphavbeta3 is a coreceptor for human cytomegalovirus.", "journal": "Nature medicine", "date": "2005-05", "authors": "Wang Xin, Huang David Y, Huong Shu-Mei, Huang Eng-Shang", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "15834425", "url": "https://glygen.org/publication/PubMed/15834425" } ] }, { "title": "VLA-4-fibronectin interaction is required for the terminal differentiation of human bone marrow cells capable of spontaneous and high rate immunoglobulin secretion.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Roldan E, Garcia-Pardo A, Brieva JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "1588291", "url": "https://glygen.org/publication/PubMed/1588291" } ] }, { "title": "Canstatin acts on endothelial and tumor cells via mitochondrial damage initiated through interaction with alphavbeta3 and alphavbeta5 integrins.", "journal": "Cancer research", "date": "2005", "authors": "Magnon C, Galaup A, Mullan B, Rouffiac V, Bouquet C, Bidart JM, Griscelli F, Opolon P, Perricaudet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15899827", "url": "https://glygen.org/publication/PubMed/15899827" } ] }, { "title": "VEGF receptor-2 Y951 signaling and a role for the adapter molecule TSAd in tumor angiogenesis.", "journal": "The EMBO journal", "date": "2005", "authors": "Matsumoto T, Bohman S, Dixelius J, Berge T, Dimberg A, Magnusson P, Wang L, Wikner C, Qi JH, Wernstedt C, Wu J, Bruheim S, Mugishima H, Mukhopadhyay D, Spurkland A, Claesson-Welsh L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "15962004", "url": "https://glygen.org/publication/PubMed/15962004" } ] }, { "title": "Critical role of the fifth domain of E-cadherin for heterophilic adhesion with alpha E beta 7, but not for homophilic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Shiraishi K, Tsuzaka K, Yoshimoto K, Kumazawa C, Nozaki K, Abe T, Tsubota K, Takeuchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16002701", "url": "https://glygen.org/publication/PubMed/16002701" } ] }, { "title": "Integrins and Src: dynamic duo of adhesion signaling.", "journal": "Trends in cell biology", "date": "2005", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16005629", "url": "https://glygen.org/publication/PubMed/16005629" } ] }, { "title": "A new variant of Glanzmann's thrombasthenia (Strasbourg I). Platelets with functionally defective glycoprotein IIb-IIIa complexes and a glycoprotein IIIa 214Arg----214Trp mutation.", "journal": "The Journal of clinical investigation", "date": "1992", "authors": "Lanza F, Stierle A, Fournier D, Morales M, Andre G, Nurden AT, Cazenave JP", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "1602006", "url": "https://glygen.org/publication/PubMed/1602006" } ] }, { "title": "Multi-step fibrinogen binding to the integrin (alpha)IIb(beta)3 detected using force spectroscopy.", "journal": "Biophysical journal", "date": "2005", "authors": "Litvinov RI, Bennett JS, Weisel JW, Shuman H", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16040750", "url": "https://glygen.org/publication/PubMed/16040750" } ] }, { "title": "Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16051604", "url": "https://glygen.org/publication/PubMed/16051604" } ] }, { "title": "Multiple roles of Rap1 in hematopoietic cells: complementary versus antagonistic functions.", "journal": "Blood", "date": "2005", "authors": "Stork PJ, Dillon TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16076873", "url": "https://glygen.org/publication/PubMed/16076873" } ] }, { "title": "PTP-1B is an essential positive regulator of platelet integrin signaling.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Arias-Salgado EG, Haj F, Dubois C, Moran B, Kasirer-Friede A, Furie BC, Furie B, Neel BG, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16115959", "url": "https://glygen.org/publication/PubMed/16115959" } ] }, { "title": "IQGAP1 is a scaffold for mitogen-activated protein kinase signaling.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Roy M, Li Z, Sacks DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "16135787", "url": "https://glygen.org/publication/PubMed/16135787" } ] }, { "title": "Human alpha1 type IV collagen NC1 domain exhibits distinct antiangiogenic activity mediated by alpha1beta1 integrin.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Sudhakar A, Nyberg P, Keshamouni VG, Mannam AP, Li J, Sugimoto H, Cosgrove D, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16151532", "url": "https://glygen.org/publication/PubMed/16151532" } ] }, { "title": "Epithelial membrane protein-2 regulates surface expression of alphavbeta3 integrin in the endometrium.", "journal": "Dev. Biol.", "date": "2005", "authors": "Wadehra M, Forbes A, Pushkarna N, Goodglick L, Gordon LK, Williams CJ, Braun J", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "16216233", "url": "https://glygen.org/publication/PubMed/16216233" } ] }, { "title": "Integrin alphaDbeta2, an adhesion receptor up-regulated on macrophage foam cells, exhibits multiligand-binding properties.", "journal": "Blood", "date": "2006", "authors": "Yakubenko VP, Yadav SP, Ugarova TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16239428", "url": "https://glygen.org/publication/PubMed/16239428" } ] }, { "title": "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.", "journal": "Molecular & cellular proteomics : MCP", "date": "2006", "authors": "Lewandrowski U, Moebius J, Walter U, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "16263699", "url": "https://glygen.org/publication/PubMed/16263699" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Structure and function of the platelet integrin alphaIIbbeta3.", "journal": "The Journal of clinical investigation", "date": "2005-12", "authors": "Bennett Joel S", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "16322781", "url": "https://glygen.org/publication/PubMed/16322781" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Signal transduction by VEGF receptors in regulation of angiogenesis and lymphangiogenesis.", "journal": "Experimental cell research", "date": "2006", "authors": "Shibuya M, Claesson-Welsh L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "16336962", "url": "https://glygen.org/publication/PubMed/16336962" } ] }, { "title": "Wild-type and mutant B-RAF activate C-RAF through distinct mechanisms involving heterodimerization.", "journal": "Molecular cell", "date": "2005", "authors": "Garnett MJ, Rana S, Paterson H, Barford D, Marais R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "16364920", "url": "https://glygen.org/publication/PubMed/16364920" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Regulation and role of Raf-1/B-Raf heterodimerization.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Rushworth LK, Hindley AD, O'Neill E, Kolch W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "16508002", "url": "https://glygen.org/publication/PubMed/16508002" } ] }, { "title": "p130Cas: a versatile scaffold in signaling networks.", "journal": "Trends in cell biology", "date": "2006", "authors": "Defilippi P, Di Stefano P, Cabodi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708" } ], "reference": [ { "type": "PubMed", "id": "16581250", "url": "https://glygen.org/publication/PubMed/16581250" } ] }, { "title": "Functional analysis of the regulatory requirements of B-Raf and the B-Raf(V600E) oncoprotein.", "journal": "Oncogene", "date": "2006", "authors": "Brummer T, Martin P, Herzog S, Misawa Y, Daly RJ, Reth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "16702958", "url": "https://glygen.org/publication/PubMed/16702958" } ] }, { "title": "Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Borza CM, Pozzi A, Borza DB, Pedchenko V, Hellmark T, Hudson BG, Zent R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16731529", "url": "https://glygen.org/publication/PubMed/16731529" } ] }, { "title": "Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eble JA, Kassner A, Niland S, Morgelin M, Grifka J, Grassel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16754661", "url": "https://glygen.org/publication/PubMed/16754661" } ] }, { "title": "Rap1 regulation of RIAM and cell adhesion.", "journal": "Methods in enzymology", "date": "2006", "authors": "Lafuente E, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16757337", "url": "https://glygen.org/publication/PubMed/16757337" } ] }, { "title": "Phosphorylation of focal adhesion kinase (FAK) on Ser732 is induced by rho-dependent kinase and is essential for proline-rich tyrosine kinase-2-mediated phosphorylation of FAK on Tyr407 in response to vascular endothelial growth factor.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Le Boeuf F, Houle F, Sussman M, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "16760434", "url": "https://glygen.org/publication/PubMed/16760434" } ] }, { "title": "Distinct functions for ERKs?", "journal": "Journal of biology", "date": "2006", "authors": "Lloyd AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "16879721", "url": "https://glygen.org/publication/PubMed/16879721" } ] }, { "title": "Tropoelastin massively associates during coacervation to form quantized protein spheres.", "journal": "Biochemistry", "date": "2006", "authors": "Clarke AW, Arnspang EC, Mithieux SM, Korkmaz E, Braet F, Weiss AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "16906757", "url": "https://glygen.org/publication/PubMed/16906757" } ] }, { "title": "Integrin-regulated FAK-Src signaling in normal and cancer cells.", "journal": "Current opinion in cell biology", "date": "2006", "authors": "Mitra SK, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "16919435", "url": "https://glygen.org/publication/PubMed/16919435" } ] }, { "title": "The synergy site of fibronectin is required for strong interaction with the platelet integrin alphaIIbbeta3.", "journal": "Annals of biomedical engineering", "date": "2006", "authors": "Chada D, Mather T, Nollert MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16933105", "url": "https://glygen.org/publication/PubMed/16933105" } ] }, { "title": "Laminin alpha1 chain LG4 module promotes cell attachment through syndecans and cell spreading through integrin alpha2beta1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hozumi K, Suzuki N, Nielsen PK, Nomizu M, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "16945929", "url": "https://glygen.org/publication/PubMed/16945929" } ] }, { "title": "Phosphorylation of Tyr1214 within VEGFR-2 triggers the recruitment of Nck and activation of Fyn leading to SAPK2/p38 activation and endothelial cell migration in response to VEGF.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lamalice L, Houle F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "16966330", "url": "https://glygen.org/publication/PubMed/16966330" } ] }, { "title": "Proteolytically processed soluble tumor endothelial marker (TEM) 5 mediates endothelial cell survival during angiogenesis by linking integrin alpha(v)beta3 to glycosaminoglycans.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Vallon M, Essler M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "16982628", "url": "https://glygen.org/publication/PubMed/16982628" } ] }, { "title": "In melanoma, RAS mutations are accompanied by switching signaling from BRAF to CRAF and disrupted cyclic AMP signaling.", "journal": "Cancer research", "date": "2006", "authors": "Dumaz N, Hayward R, Martin J, Ogilvie L, Hedley D, Curtin JA, Bastian BC, Springer C, Marais R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "17018604", "url": "https://glygen.org/publication/PubMed/17018604" } ] }, { "title": "Integrin signaling is critical for pathological angiogenesis.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Mahabeleshwar GH, Feng W, Phillips DR, Byzova TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17030947", "url": "https://glygen.org/publication/PubMed/17030947" } ] }, { "title": "Tissue vitronectin in normal adult human dermis is non-covalently bound to elastic tissue.", "journal": "The Journal of investigative dermatology", "date": "1991", "authors": "Hintner H, Dahlback K, Dahlback B, Pepys MB, Breathnach SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1708799", "url": "https://glygen.org/publication/PubMed/1708799" } ] }, { "title": "Demonstration of a genetic therapeutic index for tumors expressing oncogenic BRAF by the kinase inhibitor SB-590885.", "journal": "Cancer research", "date": "2006", "authors": "King AJ, Patrick DR, Batorsky RS, Ho ML, Do HT, Zhang SY, Kumar R, Rusnak DW, Takle AK, Wilson DM, Hugger E, Wang L, Karreth F, Lougheed JC, Lee J, Chau D, Stout TJ, May EW, Rominger CM, Schaber MD, Luo L, Lakdawala AS, Adams JL, Contractor RG, Smalley KS, Herlyn M, Morrissey MM, Tuveson DA, Huang PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "17145850", "url": "https://glygen.org/publication/PubMed/17145850" } ] }, { "title": "p14-MP1-MEK1 signaling regulates endosomal traffic and cellular proliferation during tissue homeostasis.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Teis D, Taub N, Kurzbauer R, Hilber D, de Araujo ME, Erlacher M, Offterdinger M, Villunger A, Geley S, Bohn G, Klein C, Hess MW, Huber LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "17178906", "url": "https://glygen.org/publication/PubMed/17178906" } ] }, { "title": "Leading-edge research: PtdIns(3,4,5)P3 and directed migration.", "journal": "Nature cell biology", "date": "2007", "authors": "Franca-Koh J, Kamimura Y, Devreotes PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17199126", "url": "https://glygen.org/publication/PubMed/17199126" } ] }, { "title": "Structural basis of integrin activation by talin.", "journal": "Cell", "date": "2007", "authors": "Wegener KL, Partridge AW, Han J, Pickford AR, Liddington RC, Ginsberg MH, Campbell ID", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "17218263", "url": "https://glygen.org/publication/PubMed/17218263" } ] }, { "title": "CSK: a protein-tyrosine kinase involved in regulation of src family kinases.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Okada M, Nada S, Yamanashi Y, Yamamoto T, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "1722201", "url": "https://glygen.org/publication/PubMed/1722201" } ] }, { "title": "The NOX family of ROS-generating NADPH oxidases: physiology and pathophysiology.", "journal": "Physiological reviews", "date": "2007", "authors": "Bedard K, Krause KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17237347", "url": "https://glygen.org/publication/PubMed/17237347" } ] }, { "title": "Serine phosphorylation by casein kinase II controls endocytic L1 trafficking and axon growth.", "journal": "Journal of neuroscience research", "date": "2007", "authors": "Nakata A, Kamiguchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "17253643", "url": "https://glygen.org/publication/PubMed/17253643" } ] }, { "title": "Structure of a VEGF-VEGF receptor complex determined by electron microscopy.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Ruch C, Skiniotis G, Steinmetz MO, Walz T, Ballmer-Hofer K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17293873", "url": "https://glygen.org/publication/PubMed/17293873" } ] }, { "title": "The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Ogawa T, Tsubota Y, Hashimoto J, Kariya Y, Miyazaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "17314405", "url": "https://glygen.org/publication/PubMed/17314405" } ] }, { "title": "A comparative analysis of the fibulin protein family. Biochemical characterization, binding interactions, and tissue localization.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kobayashi N, Kostka G, Garbe JH, Keene DR, Bachinger HP, Hanisch FG, Markova D, Tsuda T, Timpl R, Chu ML, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "17324935", "url": "https://glygen.org/publication/PubMed/17324935" } ] }, { "title": "Critical residues of alphaX I-domain recognizing fibrinogen central domain.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Lee JH, Choi J, Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17339034", "url": "https://glygen.org/publication/PubMed/17339034" } ] }, { "title": "KSR and CNK: two scaffolds regulating RAS-mediated RAF activation.", "journal": "Oncogene", "date": "2007", "authors": "Claperon A, Therrien M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "17496912", "url": "https://glygen.org/publication/PubMed/17496912" } ] }, { "title": "IQGAP1 modulates activation of B-Raf.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Ren JG, Li Z, Sacks DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "17563371", "url": "https://glygen.org/publication/PubMed/17563371" } ] }, { "title": "Crystallographic structure of the human leukocyte antigen DRA, DRB3*0101: models of a directional alloimmune response and autoimmunity.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Parry CS, Gorski J, Stern LJ", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "17583734", "url": "https://glygen.org/publication/PubMed/17583734" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "Germline gain-of-function mutations in RAF1 cause Noonan syndrome.", "journal": "Nature genetics", "date": "2007", "authors": "Razzaque MA, Nishizawa T, Komoike Y, Yagi H, Furutani M, Amo R, Kamisago M, Momma K, Katayama H, Nakagawa M, Fujiwara Y, Matsushima M, Mizuno K, Tokuyama M, Hirota H, Muneuchi J, Higashinakagawa T, Matsuoka R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "17603482", "url": "https://glygen.org/publication/PubMed/17603482" } ] }, { "title": "Gain-of-function RAF1 mutations cause Noonan and LEOPARD syndromes with hypertrophic cardiomyopathy.", "journal": "Nature genetics", "date": "2007", "authors": "Pandit B, Sarkozy A, Pennacchio LA, Carta C, Oishi K, Martinelli S, Pogna EA, Schackwitz W, Ustaszewska A, Landstrom A, Bos JM, Ommen SR, Esposito G, Lepri F, Faul C, Mundel P, Lopez Siguero JP, Tenconi R, Selicorni A, Rossi C, Mazzanti L, Torrente I, Marino B, Digilio MC, Zampino G, Ackerman MJ, Dallapiccola B, Tartaglia M, Gelb BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "17603483", "url": "https://glygen.org/publication/PubMed/17603483" } ] }, { "title": "Platelet integrins and immunoreceptors.", "journal": "Immunological reviews", "date": "2007", "authors": "Kasirer-Friede A, Kahn ML, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "17624957", "url": "https://glygen.org/publication/PubMed/17624957" } ] }, { "title": "Platelet integrin alpha(IIb)beta(3): activation mechanisms.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2007-07", "authors": "Ma Y-Q, Qin J, Plow E F", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "17635696", "url": "https://glygen.org/publication/PubMed/17635696" } ] }, { "title": "VEGF-induced Rac1 activation in endothelial cells is regulated by the guanine nucleotide exchange factor Vav2.", "journal": "Experimental cell research", "date": "2007", "authors": "Garrett TA, Van Buul JD, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "17686471", "url": "https://glygen.org/publication/PubMed/17686471" } ] }, { "title": "Involvement of alpha(v)beta3 integrins in osteoclast function.", "journal": "Journal of bone and mineral metabolism", "date": "2007", "authors": "Nakamura I, Duong LT, Rodan SB, Rodan GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17968485", "url": "https://glygen.org/publication/PubMed/17968485" } ] }, { "title": "Integrin alphaVbeta3 Binds to the RGD motif of glycoprotein B of Kaposi's sarcoma-associated herpesvirus and functions as an RGD-dependent entry receptor.", "journal": "Journal of virology", "date": "2008-02", "authors": "Garrigues H Jacques, Rubinchikova Yelena E, Dipersio C Michael, Rose Timothy M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "18045938", "url": "https://glygen.org/publication/PubMed/18045938" } ] }, { "title": "A nonsynonymous SNP in the ITGB3 gene disrupts the conserved membrane-proximal cytoplasmic salt bridge in the alphaIIbbeta3 integrin and cosegregates dominantly with abnormal proplatelet formation and macrothrombocytopenia.", "journal": "Blood", "date": "2008", "authors": "Ghevaert C, Salsmann A, Watkins NA, Schaffner-Reckinger E, Rankin A, Garner SF, Stephens J, Smith GA, Debili N, Vainchenker W, de Groot PG, Huntington JA, Laffan M, Kieffer N, Ouwehand WH", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "18065693", "url": "https://glygen.org/publication/PubMed/18065693" } ] }, { "title": "Phosphoproteome of resting human platelets.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "iPTMnet", "id": "P05106-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106-1" } ], "reference": [ { "type": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" } ] }, { "title": "Fibronectin type III (FN3) modules of the neuronal cell adhesion molecule L1 interact directly with the fibroblast growth factor (FGF) receptor.", "journal": "Molecular and cellular neurosciences", "date": "2008", "authors": "Kulahin N, Li S, Hinsby A, Kiselyov V, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18222703", "url": "https://glygen.org/publication/PubMed/18222703" } ] }, { "title": "Discovery of a selective inhibitor of oncogenic B-Raf kinase with potent antimelanoma activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Tsai J, Lee JT, Wang W, Zhang J, Cho H, Mamo S, Bremer R, Gillette S, Kong J, Haass NK, Sproesser K, Li L, Smalley KS, Fong D, Zhu YL, Marimuthu A, Nguyen H, Lam B, Liu J, Cheung I, Rice J, Suzuki Y, Luu C, Settachatgul C, Shellooe R, Cantwell J, Kim SH, Schlessinger J, Zhang KY, West BL, Powell B, Habets G, Zhang C, Ibrahim PN, Hirth P, Artis DR, Herlyn M, Bollag G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "18287029", "url": "https://glygen.org/publication/PubMed/18287029" } ] }, { "title": "Interactions between integrin alphaIIbbeta3 and the serotonin transporter regulate serotonin transport and platelet aggregation in mice and humans.", "journal": "J. Clin. Invest.", "date": "2008", "authors": "Carneiro Ana Marin D, Cook Edwin H, Murphy Dennis L, Blakely Randy D", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "18317590", "url": "https://glygen.org/publication/PubMed/18317590" } ] }, { "title": "Targeting of bone morphogenetic protein growth factor complexes to fibrillin.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sengle G, Charbonneau NL, Ono RN, Sasaki T, Alvarez J, Keene DR, Bachinger HP, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "18339631", "url": "https://glygen.org/publication/PubMed/18339631" } ] }, { "title": "RGT, a synthetic peptide corresponding to the integrin beta 3 cytoplasmic C-terminal sequence, selectively inhibits outside-in signaling in human platelets by disrupting the interaction of integrin alpha IIb beta 3 with Src kinase.", "journal": "Blood", "date": "2008", "authors": "Su X, Mi J, Yan J, Flevaris P, Lu Y, Liu H, Ruan Z, Wang X, Kieffer N, Chen S, Du X, Xi X", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "18398066", "url": "https://glygen.org/publication/PubMed/18398066" } ] }, { "title": "Talin at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Critchley DR, Gingras AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "18434644", "url": "https://glygen.org/publication/PubMed/18434644" } ] }, { "title": "Direct binding of integrin alphavbeta3 to FGF1 plays a role in FGF1 signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mori S, Wu CY, Yamaji S, Saegusa J, Shi B, Ma Z, Kuwabara Y, Lam KS, Isseroff RR, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "18441324", "url": "https://glygen.org/publication/PubMed/18441324" } ] }, { "title": "The type I TGF-beta receptor is covalently modified and regulated by sumoylation.", "journal": "Nature cell biology", "date": "2008", "authors": "Kang JS, Saunier EF, Akhurst RJ, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "18469808", "url": "https://glygen.org/publication/PubMed/18469808" } ] }, { "title": "The RGD integrin binding site in human L1-CAM is important for nuclear signaling.", "journal": "Experimental cell research", "date": "2008", "authors": "Gast D, Riedle S, Kiefel H, Muerkoster SS, Schafer H, Schafer MK, Altevogt P", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18555990", "url": "https://glygen.org/publication/PubMed/18555990" } ] }, { "title": "Elevated CRAF as a potential mechanism of acquired resistance to BRAF inhibition in melanoma.", "journal": "Cancer research", "date": "2008", "authors": "Montagut C, Sharma SV, Shioda T, McDermott U, Ulman M, Ulkus LE, Dias-Santagata D, Stubbs H, Lee DY, Singh A, Drew L, Haber DA, Settleman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "18559533", "url": "https://glygen.org/publication/PubMed/18559533" } ] }, { "title": "The regulation of extracellular signal-regulated kinase (ERK) in mammalian cells.", "journal": "The international journal of biochemistry & cell biology", "date": "2008", "authors": "Ramos JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "18562239", "url": "https://glygen.org/publication/PubMed/18562239" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "P05106-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Saegusa J, Akakura N, Wu CY, Hoogland C, Ma Z, Lam KS, Liu FT, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "18635536", "url": "https://glygen.org/publication/PubMed/18635536" } ] }, { "title": "Tandem duplication producing a novel oncogenic BRAF fusion gene defines the majority of pilocytic astrocytomas.", "journal": "Cancer research", "date": "2008", "authors": "Jones DT, Kocialkowski S, Liu L, Pearson DM, Backlund LM, Ichimura K, Collins VP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "18974108", "url": "https://glygen.org/publication/PubMed/18974108" } ] }, { "title": "Protein scaffolds in MAP kinase signalling.", "journal": "Cellular signalling", "date": "2009", "authors": "Brown MD, Sacks DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "19091303", "url": "https://glygen.org/publication/PubMed/19091303" } ] }, { "title": "Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.", "journal": "Molecular cell", "date": "2008-12-26", "authors": "Zhu Jianghai, Luo Bing-Hao, Xiao Tsan, Zhang Chengzhong, Nishida Noritaka, Springer Timothy A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "19111664", "url": "https://glygen.org/publication/PubMed/19111664" } ] }, { "title": "Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Mikelis C, Sfaelou E, Koutsioumpa M, Kieffer N, Papadimitriou E", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "19141530", "url": "https://glygen.org/publication/PubMed/19141530" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "A Mek1-Mek2 heterodimer determines the strength and duration of the Erk signal.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Catalanotti F, Reyes G, Jesenberger V, Galabova-Kovacs G, de Matos Simoes R, Carugo O, Baccarini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "19219045", "url": "https://glygen.org/publication/PubMed/19219045" } ] }, { "title": "VEGFs and receptors involved in angiogenesis versus lymphangiogenesis.", "journal": "Current opinion in cell biology", "date": "2009", "authors": "Lohela M, Bry M, Tammela T, Alitalo K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "19230644", "url": "https://glygen.org/publication/PubMed/19230644" } ] }, { "title": "Total ERK1/2 activity regulates cell proliferation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Lefloch R, Pouyssegur J, Lenormand P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "19242111", "url": "https://glygen.org/publication/PubMed/19242111" } ] }, { "title": "Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.", "journal": "Angiogenesis", "date": "2009", "authors": "Somanath PR, Malinin NL, Byzova TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "19267251", "url": "https://glygen.org/publication/PubMed/19267251" } ] }, { "title": "ERK dimers and scaffold proteins: unexpected partners for a forgotten (cytoplasmic) task.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "19279408", "url": "https://glygen.org/publication/PubMed/19279408" } ] }, { "title": "The RASopathies: developmental syndromes of Ras/MAPK pathway dysregulation.", "journal": "Current opinion in genetics & development", "date": "2009", "authors": "Tidyman WE, Rauen KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "19467855", "url": "https://glygen.org/publication/PubMed/19467855" } ] }, { "title": "Naturally processed peptides spanning the HPA-1a polymorphism are efficiently generated and displayed from platelet glycoprotein by HLA-DRB3*0101-positive antigen-presenting cells.", "journal": "Blood", "date": "2009", "authors": "Anani Sarab Gholamreza, Moss Michael, Barker Robert N, Urbaniak Stanislaw J", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "19494351", "url": "https://glygen.org/publication/PubMed/19494351" } ] }, { "title": "Molecular interplay between endostatin, integrins, and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Moreau C, Chautard E, Jetne R, Fukai N, Ruggiero F, Humphries MJ, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "19502598", "url": "https://glygen.org/publication/PubMed/19502598" } ] }, { "title": "Separation of important new platelet glycoproteins (GPIa, GPIc, GPIc*, GPIIa and GMP-140) by F.P.L.C. Characterization by monoclonal antibodies and gas-phase sequencing.", "journal": "Biochem. J.", "date": "1991", "authors": "Catimel B, Parmentier S, Leung L L, McGregor J L", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "1953640", "url": "https://glygen.org/publication/PubMed/1953640" } ] }, { "title": "The direct binding of insulin-like growth factor-1 (IGF-1) to integrin alphavbeta3 is involved in IGF-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Saegusa J, Yamaji S, Ieguchi K, Wu CY, Lam KS, Liu FT, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "19578119", "url": "https://glygen.org/publication/PubMed/19578119" } ] }, { "title": "Crystal structure of the complete integrin alphaVbeta3 ectodomain plus an alpha/beta transmembrane fragment.", "journal": "The Journal of cell biology", "date": "2009-08-24", "authors": "Xiong Jian-Ping, Mahalingham Bhuvaneshwari, Alonso Jose Luis, Borrelli Laura Ann, Rui Xianliang, Anand Saurabh, Hyman Bradley T, Rysiok Thomas, M\u00fcller-Pompalla Dirk, Goodman Simon L, Arnaout M Amin", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106#ptm_processing" }, { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "19704023", "url": "https://glygen.org/publication/PubMed/19704023" } ] }, { "title": "Single-molecule imaging reveals transforming growth factor-beta-induced type II receptor dimerization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Zhang W, Jiang Y, Wang Q, Ma X, Xiao Z, Zuo W, Fang X, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "19720988", "url": "https://glygen.org/publication/PubMed/19720988" } ] }, { "title": "Impact of feedback phosphorylation and Raf heterodimerization on normal and mutant B-Raf signaling.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Ritt DA, Monson DM, Specht SI, Morrison DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "19933846", "url": "https://glygen.org/publication/PubMed/19933846" } ] }, { "title": "Assignment of disulphide bonds in human platelet GPIIIa. A disulphide pattern for the beta-subunits of the integrin family.", "journal": "Biochem. J.", "date": "1991", "authors": "Calvete J J, Henschen A, Gonz\u00e1lez-Rodr\u00edguez J", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2001252", "url": "https://glygen.org/publication/PubMed/2001252" } ] }, { "title": "AlphaIIbbeta3 integrin: new allelic variants in Glanzmann thrombasthenia, effects on ITGA2B and ITGB3 mRNA splicing, expression, and structure-function.", "journal": "Human mutation", "date": "2010", "authors": "Jallu V, Dusseaux M, Panzer S, Torchet MF, Hezard N, Goudemand J, de Brevern AG, Kaplan C", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "20020534", "url": "https://glygen.org/publication/PubMed/20020534" } ] }, { "title": "Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Rock MJ, Holden P, Horton WA, Cohn DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20033473", "url": "https://glygen.org/publication/PubMed/20033473" } ] }, { "title": "Molecular and clinical analysis of RAF1 in Noonan syndrome and related disorders: dephosphorylation of serine 259 as the essential mechanism for mutant activation.", "journal": "Human mutation", "date": "2010", "authors": "Kobayashi T, Aoki Y, Niihori T, Cave H, Verloes A, Okamoto N, Kawame H, Fujiwara I, Takada F, Ohata T, Sakazume S, Ando T, Nakagawa N, Lapunzina P, Meneses AG, Gillessen-Kaesbach G, Wieczorek D, Kurosawa K, Mizuno S, Ohashi H, David A, Philip N, Guliyeva A, Narumi Y, Kure S, Tsuchiya S, Matsubara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "20052757", "url": "https://glygen.org/publication/PubMed/20052757" } ] }, { "title": "Thrombospondin-induced adhesion of human platelets.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Tuszynski GP, Kowalska MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "2010551", "url": "https://glygen.org/publication/PubMed/2010551" } ] }, { "title": "RAF inhibitors prime wild-type RAF to activate the MAPK pathway and enhance growth.", "journal": "Nature", "date": "2010", "authors": "Hatzivassiliou G, Song K, Yen I, Brandhuber BJ, Anderson DJ, Alvarado R, Ludlam MJ, Stokoe D, Gloor SL, Vigers G, Morales T, Aliagas I, Liu B, Sideris S, Hoeflich KP, Jaiswal BS, Seshagiri S, Koeppen H, Belvin M, Friedman LS, Malek S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "20130576", "url": "https://glygen.org/publication/PubMed/20130576" } ] }, { "title": "Kinase-dead BRAF and oncogenic RAS cooperate to drive tumor progression through CRAF.", "journal": "Cell", "date": "2010", "authors": "Heidorn SJ, Milagre C, Whittaker S, Nourry A, Niculescu-Duvas I, Dhomen N, Hussain J, Reis-Filho JS, Springer CJ, Pritchard C, Marais R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "20141835", "url": "https://glygen.org/publication/PubMed/20141835" } ] }, { "title": "RAF inhibitors transactivate RAF dimers and ERK signalling in cells with wild-type BRAF.", "journal": "Nature", "date": "2010", "authors": "Poulikakos PI, Zhang C, Bollag G, Shokat KM, Rosen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "20179705", "url": "https://glygen.org/publication/PubMed/20179705" } ] }, { "title": "Rearrangements of the RAF kinase pathway in prostate cancer, gastric cancer and melanoma.", "journal": "Nature medicine", "date": "2010", "authors": "Palanisamy N, Ateeq B, Kalyana-Sundaram S, Pflueger D, Ramnarayanan K, Shankar S, Han B, Cao Q, Cao X, Suleman K, Kumar-Sinha C, Dhanasekaran SM, Chen YB, Esgueva R, Banerjee S, LaFargue CJ, Siddiqui J, Demichelis F, Moeller P, Bismar TA, Kuefer R, Fullen DR, Johnson TM, Greenson JK, Giordano TJ, Tan P, Tomlins SA, Varambally S, Rubin MA, Maher CA, Chinnaiyan AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "20526349", "url": "https://glygen.org/publication/PubMed/20526349" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Monomeric type I and type III transforming growth factor-beta receptors and their dimerization revealed by single-molecule imaging.", "journal": "Cell research", "date": "2010", "authors": "Zhang W, Yuan J, Yang Y, Xu L, Wang Q, Zuo W, Fang X, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "20625381", "url": "https://glygen.org/publication/PubMed/20625381" } ] }, { "title": "Phosphorylation of Ser 21 in Fyn regulates its kinase activity, focal adhesion targeting, and is required for cell migration.", "journal": "Journal of cellular physiology", "date": "2011", "authors": "Yeo MG, Oh HJ, Cho HS, Chun JS, Marcantonio EE, Song WK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "20658524", "url": "https://glygen.org/publication/PubMed/20658524" } ] }, { "title": "Direct binding of the EGF-like domain of neuregulin-1 to integrins ({alpha}v{beta}3 and {alpha}6{beta}4) is involved in neuregulin-1/ErbB signaling.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ieguchi K, Fujita M, Ma Z, Davari P, Taniguchi Y, Sekiguchi K, Wang B, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "20682778", "url": "https://glygen.org/publication/PubMed/20682778" } ] }, { "title": "Tyrosine phosphorylation of integrin beta3 regulates kindlin-2 binding and integrin activation.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Bledzka Kamila, Bialkowska Katarzyna, Nie Huiqin, Qin Jun, Byzova Tatiana, Wu Chuanyue, Plow Edward F, Ma Yan-Qing", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "20702409", "url": "https://glygen.org/publication/PubMed/20702409" } ] }, { "title": "Lumican inhibits cell migration through alpha2beta1 integrin.", "journal": "Experimental cell research", "date": "2010", "authors": "Zeltz C, Brezillon S, Kapyla J, Eble JA, Bobichon H, Terryn C, Perreau C, Franz CM, Heino J, Maquart FX, Wegrowski Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20705068", "url": "https://glygen.org/publication/PubMed/20705068" } ] }, { "title": "Inhibition of mutated, activated BRAF in metastatic melanoma.", "journal": "The New England journal of medicine", "date": "2010", "authors": "Flaherty KT, Puzanov I, Kim KB, Ribas A, McArthur GA, Sosman JA, O'Dwyer PJ, Lee RJ, Grippo JF, Nolop K, Chapman PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "20818844", "url": "https://glygen.org/publication/PubMed/20818844" } ] }, { "title": "Regulation of Ras localization by acylation enables a mode of intracellular signal propagation.", "journal": "Science signaling", "date": "2010", "authors": "Lorentzen A, Kinkhabwala A, Rocks O, Vartak N, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "20858867", "url": "https://glygen.org/publication/PubMed/20858867" } ] }, { "title": "Melanomas acquire resistance to B-RAF(V600E) inhibition by RTK or N-RAS upregulation.", "journal": "Nature", "date": "2010", "authors": "Nazarian R, Shi H, Wang Q, Kong X, Koya RC, Lee H, Chen Z, Lee MK, Attar N, Sazegar H, Chodon T, Nelson SF, McArthur G, Sosman JA, Ribas A, Lo RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "21107323", "url": "https://glygen.org/publication/PubMed/21107323" } ] }, { "title": "Oncogenic FAM131B-BRAF fusion resulting from 7q34 deletion comprises an alternative mechanism of MAPK pathway activation in pilocytic astrocytoma.", "journal": "Acta neuropathologica", "date": "2011", "authors": "Cin H, Meyer C, Herr R, Janzarik WG, Lambert S, Jones DT, Jacob K, Benner A, Witt H, Remke M, Bender S, Falkenstein F, Van Anh TN, Olbrich H, von Deimling A, Pekrun A, Kulozik AE, Gnekow A, Scheurlen W, Witt O, Omran H, Jabado N, Collins VP, Brummer T, Marschalek R, Lichter P, Korshunov A, Pfister SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "21424530", "url": "https://glygen.org/publication/PubMed/21424530" } ] }, { "title": "Crystal structure of a coiled-coil domain from human ROCK I.", "journal": "PloS one", "date": "2011", "authors": "Tu D, Li Y, Song HK, Toms AV, Gould CJ, Ficarro SB, Marto JA, Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "21445309", "url": "https://glygen.org/publication/PubMed/21445309" } ] }, { "title": "Characterization of the human platelet glycoprotein IIIa gene. Comparison with the fibronectin receptor beta-subunit gene.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Lanza F, Kieffer N, Phillips D R, Fitzgerald L A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2145280", "url": "https://glygen.org/publication/PubMed/2145280" } ] }, { "title": "c-Raf, but not B-Raf, is essential for development of K-Ras oncogene-driven non-small cell lung carcinoma.", "journal": "Cancer cell", "date": "2011", "authors": "Blasco RB, Francoz S, Santamaria D, Canamero M, Dubus P, Charron J, Baccarini M, Barbacid M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "21514245", "url": "https://glygen.org/publication/PubMed/21514245" } ] }, { "title": "Improved survival with vemurafenib in melanoma with BRAF V600E mutation.", "journal": "The New England journal of medicine", "date": "2011", "authors": "Chapman PB, Hauschild A, Robert C, Haanen JB, Ascierto P, Larkin J, Dummer R, Garbe C, Testori A, Maio M, Hogg D, Lorigan P, Lebbe C, Jouary T, Schadendorf D, Ribas A, O'Day SJ, Sosman JA, Kirkwood JM, Eggermont AM, Dreno B, Nolop K, Li J, Nelson B, Hou J, Lee RJ, Flaherty KT, McArthur GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "21639808", "url": "https://glygen.org/publication/PubMed/21639808" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Mouse and human lung fibroblasts regulate dendritic cell trafficking, airway inflammation, and fibrosis through integrin alphavbeta8-mediated activation of TGF-beta.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Kitamura H, Cambier S, Somanath S, Barker T, Minagawa S, Markovics J, Goodsell A, Publicover J, Reichardt L, Jablons D, Wolters P, Hill A, Marks JD, Lou J, Pittet JF, Gauldie J, Baron JL, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "21646718", "url": "https://glygen.org/publication/PubMed/21646718" } ] }, { "title": "Raf family kinases: old dogs have learned new tricks.", "journal": "Genes & cancer", "date": "2011", "authors": "Matallanas D, Birtwistle M, Romano D, Zebisch A, Rauch J, von Kriegsheim A, Kolch W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "21779496", "url": "https://glygen.org/publication/PubMed/21779496" } ] }, { "title": "Spectrum of mutations in Noonan syndrome and their correlation with phenotypes.", "journal": "The Journal of pediatrics", "date": "2011", "authors": "Lee BH, Kim JM, Jin HY, Kim GH, Choi JH, Yoo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "21784453", "url": "https://glygen.org/publication/PubMed/21784453" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "RAS oncogenes: weaving a tumorigenic web.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Pylayeva-Gupta Y, Grabocka E, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "21993244", "url": "https://glygen.org/publication/PubMed/21993244" } ] }, { "title": "C-Raf is required for the initiation of lung cancer by K-Ras(G12D).", "journal": "Cancer discovery", "date": "2011", "authors": "Karreth FA, Frese KK, DeNicola GM, Baccarini M, Tuveson DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "22043453", "url": "https://glygen.org/publication/PubMed/22043453" } ] }, { "title": "RAF inhibitor resistance is mediated by dimerization of aberrantly spliced BRAF(V600E).", "journal": "Nature", "date": "2011", "authors": "Poulikakos PI, Persaud Y, Janakiraman M, Kong X, Ng C, Moriceau G, Shi H, Atefi M, Titz B, Gabay MT, Salton M, Dahlman KB, Tadi M, Wargo JA, Flaherty KT, Kelley MC, Misteli T, Chapman PB, Sosman JA, Graeber TG, Ribas A, Lo RS, Rosen N, Solit DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "22113612", "url": "https://glygen.org/publication/PubMed/22113612" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "MEK1/2 dual-specificity protein kinases: structure and regulation.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "22177953", "url": "https://glygen.org/publication/PubMed/22177953" } ] }, { "title": "Mechanism of RAF isoform switching induced by oncogenic RAS in melanoma.", "journal": "Small GTPases", "date": "2011", "authors": "Dumaz N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "22292133", "url": "https://glygen.org/publication/PubMed/22292133" } ] }, { "title": "Axl is essential for VEGF-A-dependent activation of PI3K/Akt.", "journal": "The EMBO journal", "date": "2012", "authors": "Ruan GX, Kazlauskas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "22327215", "url": "https://glygen.org/publication/PubMed/22327215" } ] }, { "title": "Survival in BRAF V600-mutant advanced melanoma treated with vemurafenib.", "journal": "The New England journal of medicine", "date": "2012", "authors": "Sosman JA, Kim KB, Schuchter L, Gonzalez R, Pavlick AC, Weber JS, McArthur GA, Hutson TE, Moschos SJ, Flaherty KT, Hersey P, Kefford R, Lawrence D, Puzanov I, Lewis KD, Amaravadi RK, Chmielowski B, Lawrence HJ, Shyr Y, Ye F, Li J, Nolop KB, Lee RJ, Joe AK, Ribas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "22356324", "url": "https://glygen.org/publication/PubMed/22356324" } ] }, { "title": "Melanoma whole-exome sequencing identifies (V600E)B-RAF amplification-mediated acquired B-RAF inhibitor resistance.", "journal": "Nature communications", "date": "2012", "authors": "Shi H, Moriceau G, Kong X, Lee MK, Lee H, Koya RC, Ng C, Chodon T, Scolyer RA, Dahlman KB, Sosman JA, Kefford RF, Long GV, Nelson SF, Ribas A, Lo RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "22395615", "url": "https://glygen.org/publication/PubMed/22395615" } ] }, { "title": "DICAM inhibits osteoclast differentiation through attenuation of the integrin alphaVbeta3 pathway.", "journal": "J. Bone Miner. Res.", "date": "2012", "authors": "Jung YK, Han SW, Kim GW, Jeong JH, Kim HJ, Choi JY", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "22492581", "url": "https://glygen.org/publication/PubMed/22492581" } ] }, { "title": "Distinct requirement for an intact dimer interface in wild-type, V600E and kinase-dead B-Raf signalling.", "journal": "The EMBO journal", "date": "2012", "authors": "Roring M, Herr R, Fiala GJ, Heilmann K, Braun S, Eisenhardt AE, Halbach S, Capper D, von Deimling A, Schamel WW, Saunders DN, Brummer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "22510884", "url": "https://glygen.org/publication/PubMed/22510884" } ] }, { "title": "Tetrastatin, the NC1 domain of the alpha4(IV) collagen chain: a novel potent anti-tumor matrikine.", "journal": "PloS one", "date": "2012", "authors": "Brassart-Pasco S, Senechal K, Thevenard J, Ramont L, Devy J, Di Stefano L, Dupont-Deshorgue A, Brezillon S, Feru J, Jazeron JF, Diebold MD, Ricard-Blum S, Maquart FX, Monboisse JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22539938", "url": "https://glygen.org/publication/PubMed/22539938" } ] }, { "title": "ERK1/2 MAP kinases: structure, function, and regulation.", "journal": "Pharmacological research", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "22569528", "url": "https://glygen.org/publication/PubMed/22569528" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "VEGFR2 induces c-Src signaling and vascular permeability in vivo via the adaptor protein TSAd.", "journal": "The Journal of experimental medicine", "date": "2012", "authors": "Sun Z, Li X, Massena S, Kutschera S, Padhan N, Gualandi L, Sundvold-Gjerstad V, Gustafsson K, Choy WW, Zang G, Quach M, Jansson L, Phillipson M, Abid MR, Spurkland A, Claesson-Welsh L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "22689825", "url": "https://glygen.org/publication/PubMed/22689825" } ] }, { "title": "A novel SND1-BRAF fusion confers resistance to c-Met inhibitor PF-04217903 in GTL16 cells through [corrected] MAPK activation.", "journal": "PloS one", "date": "2012", "authors": "Lee NV, Lira ME, Pavlicek A, Ye J, Buckman D, Bagrodia S, Srinivasa SP, Zhao Y, Aparicio S, Rejto PA, Christensen JG, Ching KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "22745804", "url": "https://glygen.org/publication/PubMed/22745804" } ] }, { "title": "Increased BRAF heterodimerization is the common pathogenic mechanism for noonan syndrome-associated RAF1 mutants.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Wu X, Yin J, Simpson J, Kim KH, Gu S, Hong JH, Bayliss P, Backx PH, Neel BG, Araki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "22826437", "url": "https://glygen.org/publication/PubMed/22826437" } ] }, { "title": "Target-derived matricryptins organize cerebellar synapse formation through alpha3beta1 integrins.", "journal": "Cell reports", "date": "2012", "authors": "Su J, Stenbjorn RS, Gorse K, Su K, Hauser KF, Ricard-Blum S, Pihlajaniemi T, Fox MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22884367", "url": "https://glygen.org/publication/PubMed/22884367" } ] }, { "title": "The neural cell adhesion molecule N-CAM enhances L1-dependent cell-cell interactions.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Kadmon G, Kowitz A, Altevogt P, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "2295682", "url": "https://glygen.org/publication/PubMed/2295682" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Integrins alphavbeta3 and alpha4beta1 act as coreceptors for fractalkine, and the integrin-binding defective mutant of fractalkine is an antagonist of CX3CR1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012", "authors": "Fujita M, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "23125415", "url": "https://glygen.org/publication/PubMed/23125415" } ] }, { "title": "Elucidating distinct roles for NF1 in melanomagenesis.", "journal": "Cancer discovery", "date": "2013", "authors": "Maertens O, Johnson B, Hollstein P, Frederick DT, Cooper ZA, Messiaen L, Bronson RT, McMahon M, Granter S, Flaherty K, Wargo JA, Marais R, Cichowski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "23171796", "url": "https://glygen.org/publication/PubMed/23171796" } ] }, { "title": "VEGFA and tumour angiogenesis.", "journal": "Journal of internal medicine", "date": "2013", "authors": "Claesson-Welsh L, Welsh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "23216836", "url": "https://glygen.org/publication/PubMed/23216836" } ] }, { "title": "A genome-scale RNA interference screen implicates NF1 loss in resistance to RAF inhibition.", "journal": "Cancer discovery", "date": "2013", "authors": "Whittaker SR, Theurillat JP, Van Allen E, Wagle N, Hsiao J, Cowley GS, Schadendorf D, Root DE, Garraway LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "23288408", "url": "https://glygen.org/publication/PubMed/23288408" } ] }, { "title": "c-Cbl-mediated neddylation antagonizes ubiquitination and degradation of the TGF-beta type II receptor.", "journal": "Molecular cell", "date": "2013", "authors": "Zuo W, Huang F, Chiang YJ, Li M, Du J, Ding Y, Zhang T, Lee HW, Jeong LS, Chen Y, Deng H, Feng XH, Luo S, Gao C, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "23290524", "url": "https://glygen.org/publication/PubMed/23290524" } ] }, { "title": "Effects of Raf dimerization and its inhibition on normal and disease-associated Raf signaling.", "journal": "Molecular cell", "date": "2013", "authors": "Freeman AK, Ritt DA, Morrison DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "23352452", "url": "https://glygen.org/publication/PubMed/23352452" } ] }, { "title": "Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Willis CD, Poluzzi C, Mongiat M, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "23374253", "url": "https://glygen.org/publication/PubMed/23374253" } ] }, { "title": "The genomic organization of platelet glycoprotein IIIa.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Zimrin A B, Gidwitz S, Lord S, Schwartz E, Bennett J S, White G C, Poncz M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2341395", "url": "https://glygen.org/publication/PubMed/2341395" } ] }, { "title": "Selective requirement of PI3K/PDK1 signaling for Kras oncogene-driven pancreatic cell plasticity and cancer.", "journal": "Cancer cell", "date": "2013", "authors": "Eser S, Reiff N, Messer M, Seidler B, Gottschalk K, Dobler M, Hieber M, Arbeiter A, Klein S, Kong B, Michalski CW, Schlitter AM, Esposito I, Kind AJ, Rad L, Schnieke AE, Baccarini M, Alessi DR, Rad R, Schmid RM, Schneider G, Saur D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "23453624", "url": "https://glygen.org/publication/PubMed/23453624" } ] }, { "title": "GPIIb and GPIIIa amino acid sequences deduced from human megakaryocyte cDNAs.", "journal": "Mol. Biol. Rep.", "date": "1990", "authors": "Frachet P, Uzan G, Thevenon D, Denarier E, Prandini M H, Marguerie G", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2345548", "url": "https://glygen.org/publication/PubMed/2345548" } ] }, { "title": "Whole-genome sequencing identifies genetic alterations in pediatric low-grade gliomas.", "journal": "Nature genetics", "date": "2013", "authors": "Zhang J, Wu G, Miller CP, Tatevossian RG, Dalton JD, Tang B, Orisme W, Punchihewa C, Parker M, Qaddoumi I, Boop FA, Lu C, Kandoth C, Ding L, Lee R, Huether R, Chen X, Hedlund E, Nagahawatte P, Rusch M, Boggs K, Cheng J, Becksfort J, Ma J, Song G, Li Y, Wei L, Wang J, Shurtleff S, Easton J, Zhao D, Fulton RS, Fulton LL, Dooling DJ, Vadodaria B, Mulder HL, Tang C, Ochoa K, Mullighan CG, Gajjar A, Kriwacki R, Sheer D, Gilbertson RJ, Mardis ER, Wilson RK, Downing JR, Baker SJ, Ellison DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "23583981", "url": "https://glygen.org/publication/PubMed/23583981" } ] }, { "title": "Discovery of a novel ERK inhibitor with activity in models of acquired resistance to BRAF and MEK inhibitors.", "journal": "Cancer discovery", "date": "2013", "authors": "Morris EJ, Jha S, Restaino CR, Dayananth P, Zhu H, Cooper A, Carr D, Deng Y, Jin W, Black S, Long B, Liu J, Dinunzio E, Windsor W, Zhang R, Zhao S, Angagaw MH, Pinheiro EM, Desai J, Xiao L, Shipps G, Hruza A, Wang J, Kelly J, Paliwal S, Gao X, Babu BS, Zhu L, Daublain P, Zhang L, Lutterbach BA, Pelletier MR, Philippar U, Siliphaivanh P, Witter D, Kirschmeier P, Bishop WR, Hicklin D, Gilliland DG, Jayaraman L, Zawel L, Fawell S, Samatar AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "23614898", "url": "https://glygen.org/publication/PubMed/23614898" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "Integrins modulate the infection efficiency of West Nile virus into cells.", "journal": "The Journal of general virology", "date": "2013-08", "authors": "Schmidt Katja, Keller Markus, Bader Bernhard L, Koryt\u00e1\u0159 Tom\u00e1\u0161, Finke Stefan, Ziegler Ute, Groschup Martin H", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "23658209", "url": "https://glygen.org/publication/PubMed/23658209" } ] }, { "title": "Enhanced inhibition of ERK signaling by a novel allosteric MEK inhibitor, CH5126766, that suppresses feedback reactivation of RAF activity.", "journal": "Cancer research", "date": "2013", "authors": "Ishii N, Harada N, Joseph EW, Ohara K, Miura T, Sakamoto H, Matsuda Y, Tomii Y, Tachibana-Kondo Y, Iikura H, Aoki T, Shimma N, Arisawa M, Sowa Y, Poulikakos PI, Rosen N, Aoki Y, Sakai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "23667175", "url": "https://glygen.org/publication/PubMed/23667175" } ] }, { "title": "RAF inhibitors activate the MAPK pathway by relieving inhibitory autophosphorylation.", "journal": "Cancer cell", "date": "2013", "authors": "Holderfield M, Merritt H, Chan J, Wallroth M, Tandeske L, Zhai H, Tellew J, Hardy S, Hekmat-Nejad M, Stuart DD, McCormick F, Nagel TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802955" } ], "reference": [ { "type": "PubMed", "id": "23680146", "url": "https://glygen.org/publication/PubMed/23680146" } ] }, { "title": "The RASopathies.", "journal": "Annual review of genomics and human genetics", "date": "2013", "authors": "Rauen KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "23875798", "url": "https://glygen.org/publication/PubMed/23875798" } ] }, { "title": "A beta 3 integrin mutation abolishes ligand binding and alters divalent cation-dependent conformation.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Loftus JC, O'Toole TE, Plow EF, Glass A, Frelinger AL 3rd, Ginsberg MH", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2392682", "url": "https://glygen.org/publication/PubMed/2392682" } ] }, { "title": "Mechanism of MEK inhibition determines efficacy in mutant KRAS- versus BRAF-driven cancers.", "journal": "Nature", "date": "2013", "authors": "Hatzivassiliou G, Haling JR, Chen H, Song K, Price S, Heald R, Hewitt JF, Zak M, Peck A, Orr C, Merchant M, Hoeflich KP, Chan J, Luoh SM, Anderson DJ, Ludlam MJ, Wiesmann C, Ultsch M, Friedman LS, Malek S, Belvin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "23934108", "url": "https://glygen.org/publication/PubMed/23934108" } ] }, { "title": "Mitogen-activated protein kinases in innate immunity.", "journal": "Nature reviews. Immunology", "date": "2013", "authors": "Arthur JS, Ley SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "23954936", "url": "https://glygen.org/publication/PubMed/23954936" } ] }, { "title": "MEK in cancer and cancer therapy.", "journal": "Pharmacology & therapeutics", "date": "2014", "authors": "Neuzillet C, Tijeras-Raballand A, de Mestier L, Cros J, Faivre S, Raymond E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "24121058", "url": "https://glygen.org/publication/PubMed/24121058" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "Identification of kinase fusion oncogenes in post-Chernobyl radiation-induced thyroid cancers.", "journal": "The Journal of clinical investigation", "date": "2013", "authors": "Ricarte-Filho JC, Li S, Garcia-Rendueles ME, Montero-Conde C, Voza F, Knauf JA, Heguy A, Viale A, Bogdanova T, Thomas GA, Mason CE, Fagin JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "24135138", "url": "https://glygen.org/publication/PubMed/24135138" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "Tumor adaptation and resistance to RAF inhibitors.", "journal": "Nature medicine", "date": "2013", "authors": "Lito P, Rosen N, Solit DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "24202393", "url": "https://glygen.org/publication/PubMed/24202393" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "BRAF fusions define a distinct molecular subset of melanomas with potential sensitivity to MEK inhibition.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2013", "authors": "Hutchinson KE, Lipson D, Stephens PJ, Otto G, Lehmann BD, Lyle PL, Vnencak-Jones CL, Ross JS, Pietenpol JA, Sosman JA, Puzanov I, Miller VA, Pao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "24345920", "url": "https://glygen.org/publication/PubMed/24345920" } ] }, { "title": "Roles of the putative integrin-binding motif of the human metapneumovirus fusion (f) protein in cell-cell fusion, viral infectivity, and pathogenesis.", "journal": "Journal of virology", "date": "2014-04", "authors": "Wei Yongwei, Zhang Yu, Cai Hui, Mirza Anne M, Iorio Ronald M, Peeples Mark E, Niewiesk Stefan, Li Jianrong", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "24478423", "url": "https://glygen.org/publication/PubMed/24478423" } ] }, { "title": "Structure of platelet glycoprotein IIIa. A common subunit for two different membrane receptors.", "journal": "J. Clin. Invest.", "date": "1988", "authors": "Zimrin A B, Eisman R, Vilaire G, Schwartz E, Bennett J S, Poncz M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2452834", "url": "https://glygen.org/publication/PubMed/2452834" } ] }, { "title": "Dragging ras back in the ring.", "journal": "Cancer cell", "date": "2014", "authors": "Stephen AG, Esposito D, Bagni RK, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9649948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948" } ], "reference": [ { "type": "PubMed", "id": "24651010", "url": "https://glygen.org/publication/PubMed/24651010" } ] }, { "title": "Disruption of CRAF-mediated MEK activation is required for effective MEK inhibition in KRAS mutant tumors.", "journal": "Cancer cell", "date": "2014", "authors": "Lito P, Saborowski A, Yue J, Solomon M, Joseph E, Gadal S, Saborowski M, Kastenhuber E, Fellmann C, Ohara K, Morikami K, Miura T, Lukacs C, Ishii N, Lowe S, Rosen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "24746704", "url": "https://glygen.org/publication/PubMed/24746704" } ] }, { "title": "The chemokine fractalkine can activate integrins without CX3CR1 through direct binding to a ligand-binding site distinct from the classical RGD-binding site.", "journal": "PloS one", "date": "2014", "authors": "Fujita M, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "24789099", "url": "https://glygen.org/publication/PubMed/24789099" } ] }, { "title": "`RAF` neighborhood: protein-protein interaction in the Raf/Mek/Erk pathway.", "journal": "FEBS letters", "date": "2014", "authors": "Cseh B, Doma E, Baccarini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "24937142", "url": "https://glygen.org/publication/PubMed/24937142" } ] }, { "title": "Targeting RAF kinases for cancer therapy: BRAF-mutated melanoma and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Holderfield M, Deuker MM, McCormick F, McMahon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802946" } ], "reference": [ { "type": "PubMed", "id": "24957944", "url": "https://glygen.org/publication/PubMed/24957944" } ] }, { "title": "A unique inhibitor binding site in ERK1/2 is associated with slow binding kinetics.", "journal": "Nature chemical biology", "date": "2014", "authors": "Chaikuad A, Tacconi EM, Zimmer J, Liang Y, Gray NS, Tarsounas M, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "25195011", "url": "https://glygen.org/publication/PubMed/25195011" } ] }, { "title": "The landscape of kinase fusions in cancer.", "journal": "Nature communications", "date": "2014", "authors": "Stransky N, Cerami E, Schalm S, Kim JL, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "25204415", "url": "https://glygen.org/publication/PubMed/25204415" } ] }, { "title": "Discovery of novel, dual mechanism ERK inhibitors by affinity selection screening of an inactive kinase.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Deng Y, Shipps GW Jr, Cooper A, English JM, Annis DA, Carr D, Nan Y, Wang T, Zhu HY, Chuang CC, Dayananth P, Hruza AW, Xiao L, Jin W, Kirschmeier P, Windsor WT, Samatar AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "25313996", "url": "https://glygen.org/publication/PubMed/25313996" } ] }, { "title": "Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins alphavbeta3, alpha4beta1, and alpha5beta1.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Fujita M, Zhu K, Fujita CK, Zhao M, Lam KS, Kurth MJ, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "25398877", "url": "https://glygen.org/publication/PubMed/25398877" } ] }, { "title": "Targeting RAS-ERK signalling in cancer: promises and challenges.", "journal": "Nature reviews. Drug discovery", "date": "2014", "authors": "Samatar AA, Poulikakos PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802946" } ], "reference": [ { "type": "PubMed", "id": "25435214", "url": "https://glygen.org/publication/PubMed/25435214" } ] }, { "title": "The human platelet alloantigens, PlA1 and PlA2, are associated with a leucine33/proline33 amino acid polymorphism in membrane glycoprotein IIIa, and are distinguishable by DNA typing.", "journal": "The Journal of clinical investigation", "date": "1989", "authors": "Newman PJ, Derbes RS, Aster RH", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2565345", "url": "https://glygen.org/publication/PubMed/2565345" } ] }, { "title": "Regulation of RAF protein kinases in ERK signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2015", "authors": "Lavoie H, Therrien M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948" } ], "reference": [ { "type": "PubMed", "id": "25907612", "url": "https://glygen.org/publication/PubMed/25907612" } ] }, { "title": "Exome sequencing identifies recurrent mutations in NF1 and RASopathy genes in sun-exposed melanomas.", "journal": "Nature genetics", "date": "2015", "authors": "Krauthammer M, Kong Y, Bacchiocchi A, Evans P, Pornputtapong N, Wu C, McCusker JP, Ma S, Cheng E, Straub R, Serin M, Bosenberg M, Ariyan S, Narayan D, Sznol M, Kluger HM, Mane S, Schlessinger J, Lifton RP, Halaban R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9656223", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223" } ], "reference": [ { "type": "PubMed", "id": "26214590", "url": "https://glygen.org/publication/PubMed/26214590" } ] }, { "title": "Sulfatide interacts with and activates integrin \u03b1V\u03b23 in human hepatocellular carcinoma cells.", "journal": "Oncotarget", "date": "2016-06-14", "authors": "Wang Rong, Qi Bing, Dong Yi Wei, Cai Qian Qian, Deng Nian Hui, Chen Qi, Li Chao, Jin Yu Tong, Wu Xing Zhong", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "27145276", "url": "https://glygen.org/publication/PubMed/27145276" } ] }, { "title": "Discovery of (S)-1-(1-(4-Chloro-3-fluorophenyl)-2-hydroxyethyl)-4-(2-((1-methyl-1H-pyrazol-5-y l)amino)pyrimidin-4-yl)pyridin-2(1H)-one (GDC-0994), an Extracellular Signal-Regulated Kinase 1/2 (ERK1/2) Inhibitor in Early Clinical Development.", "journal": "Journal of medicinal chemistry", "date": "2016", "authors": "Blake JF, Burkard M, Chan J, Chen H, Chou KJ, Diaz D, Dudley DA, Gaudino JJ, Gould SE, Grina J, Hunsaker T, Liu L, Martinson M, Moreno D, Mueller L, Orr C, Pacheco P, Qin A, Rasor K, Ren L, Robarge K, Shahidi-Latham S, Stults J, Sullivan F, Wang W, Yin J, Zhou A, Belvin M, Merchant M, Moffat J, Schwarz JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "27227380", "url": "https://glygen.org/publication/PubMed/27227380" } ] }, { "title": "An alternative cytoplasmic domain of the integrin beta 3 subunit.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "van Kuppevelt T H, Languino L R, Gailit J O, Suzuki S, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "2787511", "url": "https://glygen.org/publication/PubMed/2787511" } ] }, { "title": "The CD9, CD81, and CD151 EC2 domains bind to the classical RGD-binding site of integrin alphavbeta3.", "journal": "Biochem. J.", "date": "2017", "authors": "Yu J, Lee CY, Changou CA, Cedano-Prieto DM, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "27993971", "url": "https://glygen.org/publication/PubMed/27993971" } ] }, { "title": "The integrin-binding defective FGF2 mutants potently suppress FGF2 signalling and angiogenesis.", "journal": "Bioscience reports", "date": "2017", "authors": "Mori S, Hatori N, Kawaguchi N, Hamada Y, Shih TC, Wu CY, Lam KS, Matsuura N, Yamamoto H, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "28302677", "url": "https://glygen.org/publication/PubMed/28302677" } ] }, { "title": "Direct integrin binding to insulin-like growth factor-2 through the C-domain is required for insulin-like growth factor receptor type 1 (IGF1R) signaling.", "journal": "PloS one", "date": "2017", "authors": "Cedano Prieto DM, Cheng Y, Chang CC, Yu J, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "28873464", "url": "https://glygen.org/publication/PubMed/28873464" } ] }, { "title": "Targeting the MAPK Signaling Pathway in Cancer: Promising Preclinical Activity with the Novel Selective ERK1/2 Inhibitor BVD-523 (Ulixertinib).", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Germann UA, Furey BF, Markland W, Hoover RR, Aronov AM, Roix JJ, Hale M, Boucher DM, Sorrell DA, Martinez-Botella G, Fitzgibbon M, Shapiro P, Wick MJ, Samadani R, Meshaw K, Groover A, DeCrescenzo G, Namchuk M, Emery CM, Saha S, Welsch DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "28939558", "url": "https://glygen.org/publication/PubMed/28939558" } ] }, { "title": "Direct binding to integrins and loss of disulfide linkage in interleukin-1beta (IL-1beta) are involved in the agonistic action of IL-1beta.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Takada YK, Yu J, Fujita M, Saegusa J, Wu CY, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "29030430", "url": "https://glygen.org/publication/PubMed/29030430" } ] }, { "title": "Molecular characterization of Glanzmann's thrombasthenia in Iran: identification of three novel mutations.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "2017", "authors": "Kazemi A, Abolghasemi H, Kazemzadeh S, Vahidi R, Faranoush M, Farsinejad A, Ala F", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "29084015", "url": "https://glygen.org/publication/PubMed/29084015" } ] }, { "title": "Stromal cell-derived factor-1 (CXCL12) activates integrins by direct binding to an allosteric ligand-binding site (site 2) of integrins without CXCR4.", "journal": "Biochem. J.", "date": "2018", "authors": "Fujita M, Davari P, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "29301984", "url": "https://glygen.org/publication/PubMed/29301984" } ] }, { "title": "A novel heterozygous ITGB3 p.T720del inducing spontaneous activation of integrin alphaIIbbeta3 in autosomal dominant macrothrombocytopenia with aggregation dysfunction.", "journal": "Annals of hematology", "date": "2018", "authors": "Miyashita N, Onozawa M, Hayasaka K, Yamada T, Migita O, Hata K, Okada K, Goto H, Nakagawa M, Hashimoto D, Kahata K, Kondo T, Kunishima S, Teshima T", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "29380037", "url": "https://glygen.org/publication/PubMed/29380037" } ] }, { "title": "Development of MK-8353, an orally administered ERK1/2 inhibitor, in patients with advanced solid tumors.", "journal": "JCI insight", "date": "2018", "authors": "Moschos SJ, Sullivan RJ, Hwu WJ, Ramanathan RK, Adjei AA, Fong PC, Shapira-Frommer R, Tawbi HA, Rubino J, Rush TS 3rd, Zhang D, Miselis NR, Samatar AA, Chun P, Rubin EH, Schiller J, Long BJ, Dayananth P, Carr D, Kirschmeier P, Bishop WR, Deng Y, Cooper A, Shipps GW, Moreno BH, Robert L, Ribas A, Flaherty KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "29467321", "url": "https://glygen.org/publication/PubMed/29467321" } ] }, { "title": "Cell surface proteoglycan binds mouse mammary epithelial cells to fibronectin and behaves as a receptor for interstitial matrix.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Saunders S, Bernfield M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "2963012", "url": "https://glygen.org/publication/PubMed/2963012" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P05106", "url": "" }, { "database": "GlyConnect", "id": "1416", "url": "https://glyconnect.expasy.org/browser/proteins/1416" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1416", "url": "https://glyconnect.expasy.org/browser/proteins/1416" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "MK-8353: Discovery of an Orally Bioavailable Dual Mechanism ERK Inhibitor for Oncology.", "journal": "ACS medicinal chemistry letters", "date": "2018", "authors": "Boga SB, Deng Y, Zhu L, Nan Y, Cooper AB, Shipps GW Jr, Doll R, Shih NY, Zhu H, Sun R, Wang T, Paliwal S, Tsui HC, Gao X, Yao X, Desai J, Wang J, Alhassan AB, Kelly J, Patel M, Muppalla K, Gudipati S, Zhang LK, Buevich A, Hesk D, Carr D, Dayananth P, Black S, Mei H, Cox K, Sherborne B, Hruza AW, Xiao L, Jin W, Long B, Liu G, Taylor SA, Kirschmeier P, Windsor WT, Bishop R, Samatar AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "30034615", "url": "https://glygen.org/publication/PubMed/30034615" } ] }, { "title": "Targeting ERK1/2 protein-serine/threonine kinases in human cancers.", "journal": "Pharmacological research", "date": "2019", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "30794926", "url": "https://glygen.org/publication/PubMed/30794926" } ] }, { "title": "Integrin Binding to the Trimeric Interface of CD40L Plays a Critical Role in CD40/CD40L Signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2019", "authors": "Takada YK, Yu J, Shimoda M, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "31331973", "url": "https://glygen.org/publication/PubMed/31331973" } ] }, { "title": "Cloning of glycoprotein IIIa cDNA from human erythroleukemia cells and localization of the gene to chromosome 17.", "journal": "Blood", "date": "1988", "authors": "Rosa J P, Bray P F, Gayet O, Johnston G I, Cook R G, Jackson K W, Shuman M A, McEver R P", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "3165296", "url": "https://glygen.org/publication/PubMed/3165296" } ] }, { "title": "Insulin-stimulated microtubule-associated protein kinase is phosphorylated on tyrosine and threonine in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Ray LB, Sturgill TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "3287375", "url": "https://glygen.org/publication/PubMed/3287375" } ] }, { "title": "Cytoplasmic short linear motifs in ACE2 and integrin beta3 link SARS-CoV-2 host cell receptors to mediators of endocytosis and autophagy.", "journal": "Science signaling", "date": "2021", "authors": "Kliche J, Kuss H, Ali M, Ivarsson Y", "evidence": [ { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "33436498", "url": "https://glygen.org/publication/PubMed/33436498" } ] }, { "title": "Protein sequence of endothelial glycoprotein IIIa derived from a cDNA clone. Identity with platelet glycoprotein IIIa and similarity to 'integrin'.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Fitzgerald L A, Steiner B, Rall S C, Lo S S, Phillips D R", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "3494014", "url": "https://glygen.org/publication/PubMed/3494014" } ] }, { "title": "PEAK1 Y635 phosphorylation regulates cell migration through association with Tensin3 and integrins.", "journal": "The Journal of cell biology", "date": "2022", "authors": "Zuidema A, Atherton P, Kreft M, Hoekman L, Bleijerveld OB, Nagaraj N, Chen N, Fassler R, Sonnenberg A", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "35687021", "url": "https://glygen.org/publication/PubMed/35687021" } ] }, { "title": "A single F153S\u03b23 mutation causes constitutive integrin \u03b1IIb\u03b23 activation in a variant form of Glanzmann thrombasthenia.", "journal": "Blood advances", "date": "2023-07-11", "authors": "Koukouritaki Sevasti B, Thinn Aye Myat M, Ashworth Katrina J, Fang Juan, Slater Haley S, Du Lily M, Nguyen Huong Thi Thu, Pillois Xavier, Nurden Alan T, Ng Christopher J, Di Paola Jorge, Zhu Jieqing, Wilcox David A", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" } ], "reference": [ { "type": "PubMed", "id": "36884296", "url": "https://glygen.org/publication/PubMed/36884296" } ] }, { "title": "Genetic screening of PLA1/PLA2 polymorphous marker of integrin beta 3 (ITGB3) GP IIIA gene in adolescent girls with puberty menorrhagia.", "journal": "Journal of medicine and life", "date": "2023-02", "authors": "Tsysar Yuliia Vasylivna, Andriiets Oksana Anatolievna, Dubyk Liudmyla Vasylivna, Dyak Kristina Viktorivna, Radu Raluca Mihaela", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" } ], "reference": [ { "type": "PubMed", "id": "36937472", "url": "https://glygen.org/publication/PubMed/36937472" } ] }, { "title": "Molecular basis for the recognition of 24-(S)-hydroxycholesterol by integrin \u03b1v\u03b23.", "journal": "Scientific reports", "date": "2023-06-06", "authors": "Gc Jeevan B, Chen Justin, Pokharel Swechha M, Mohanty Indira, Mariasoosai Charles, Obi Peter, Panipinto Paul, Bandyopadhyay Smarajit, Bose Santanu, Natesan Senthil", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" } ], "reference": [ { "type": "PubMed", "id": "37280310", "url": "https://glygen.org/publication/PubMed/37280310" } ] }, { "title": "Effect of c.1431C\u00a0>\u00a0T mutation, a causative mutation of Glanzmann's thrombasthenia, on ITGB3 splicing, gene and protein expression.", "journal": "Gene", "date": "2023-12-20", "authors": "Wang Dayan, Lai Panjian, Lu Qiaochun, El-Magd Mohammed A, Li Xiaobing", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" } ], "reference": [ { "type": "PubMed", "id": "37716584", "url": "https://glygen.org/publication/PubMed/37716584" } ] }, { "title": "Integrin-\u03b1v\u03b23 is a Therapeutically Targetable Fundamental Factor in Medulloblastoma Tumorigenicity and Radioresistance.", "journal": "Cancer research communications", "date": "2023-12-07", "authors": "Echavidre William, Durivault J\u00e9r\u00f4me, Gotorbe C\u00e9lia, Blanchard Thays, Pagnuzzi Marina, Vial Val\u00e9rie, Raes Florian, Broisat Alexis, Villeneuve R\u00e9my, Amblard R\u00e9gis, Garnier Nicolas, Ortholan C\u00e9cile, Faraggi Marc, Serrano Benjamin, Picco Vincent, Montemagno Christopher", "evidence": [ { "database": "RefSeq", "id": "NP_000203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000203" } ], "reference": [ { "type": "PubMed", "id": "38009896", "url": "https://glygen.org/publication/PubMed/38009896" } ] }, { "title": "Purification and partial amino acid sequence of human platelet membrane glycoproteins IIb and IIIa.", "journal": "Blood", "date": "1987", "authors": "Hiraiwa A, Matsukage A, Shiku H, Takahashi T, Naito K, Yamada K", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "3801670", "url": "https://glygen.org/publication/PubMed/3801670" } ] }, { "title": "Lysyl oxidase: preparation and role in elastin biosynthesis.", "journal": "Methods in enzymology", "date": "1982", "authors": "Kagan HM, Sullivan KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "6123066", "url": "https://glygen.org/publication/PubMed/6123066" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Binding of mouse and human fibulin-2 to extracellular matrix ligands.", "journal": "Journal of molecular biology", "date": "1995", "authors": "Sasaki T, Gohring W, Pan TC, Chu ML, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7500359", "url": "https://glygen.org/publication/PubMed/7500359" } ] }, { "title": "Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.", "journal": "Blood", "date": "1993", "authors": "Denis C, Williams JA, Lu X, Meyer D, Baruch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7505120", "url": "https://glygen.org/publication/PubMed/7505120" } ] }, { "title": "Autophosphorylation of the focal adhesion kinase, pp125FAK, directs SH2-dependent binding of pp60src.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Schaller MD, Hildebrand JD, Shannon JD, Fox JW, Vines RR, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "7509446", "url": "https://glygen.org/publication/PubMed/7509446" } ] }, { "title": "Syk activation by the Src-family tyrosine kinase in the B cell receptor signaling.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Kurosaki T, Takata M, Yamanashi Y, Inazu T, Taniguchi T, Yamamoto T, Yamamura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "7513017", "url": "https://glygen.org/publication/PubMed/7513017" } ] }, { "title": "Entry of coxsackievirus A9 into host cells: specific interactions with alpha v beta 3 integrin, the vitronectin receptor.", "journal": "Virology", "date": "1994-09", "authors": "Roivainen M, Piirainen L, Hovi T, Virtanen I, Riikonen T, Heino J, Hyypi\u00e4 T", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "7519807", "url": "https://glygen.org/publication/PubMed/7519807" } ] }, { "title": "Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Nishimura SL, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7525578", "url": "https://glygen.org/publication/PubMed/7525578" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "The association of human fibulin-1 with elastic fibers: an immunohistological, ultrastructural, and RNA study.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1995", "authors": "Roark EF, Keene DR, Haudenschild CC, Godyna S, Little CD, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7534784", "url": "https://glygen.org/publication/PubMed/7534784" } ] }, { "title": "The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.", "journal": "Neuron", "date": "1995", "authors": "Varnum-Finney B, Venstrom K, Muller U, Kypta R, Backus C, Chiquet M, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7541634", "url": "https://glygen.org/publication/PubMed/7541634" } ] }, { "title": "CD31/PECAM-1 is a ligand for alpha v beta 3 integrin involved in adhesion of leukocytes to endothelium.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Piali L, Hammel P, Uherek C, Bachmann F, Gisler RH, Dunon D, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7542249", "url": "https://glygen.org/publication/PubMed/7542249" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "A proline-rich sequence unique to MEK1 and MEK2 is required for raf binding and regulates MEK function.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Catling AD, Schaeffer HJ, Reuter CW, Reddy GR, Weber MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "7565670", "url": "https://glygen.org/publication/PubMed/7565670" } ] }, { "title": "Conditionally oncogenic forms of the A-Raf and B-Raf protein kinases display different biological and biochemical properties in NIH 3T3 cells.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Pritchard CA, Samuels ML, Bosch E, McMahon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "7565795", "url": "https://glygen.org/publication/PubMed/7565795" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "The transforming growth factor beta receptors types I, II, and III form hetero-oligomeric complexes in the presence of ligand.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Moustakas A, Lin HY, Henis YI, Plamondon J, O'Connor-McCourt MD, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "7693660", "url": "https://glygen.org/publication/PubMed/7693660" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Amino acid 489 is encoded by a mutational `hot spot` on the beta 3 integrin chain: the CA/TU human platelet alloantigen system.", "journal": "Blood", "date": "1993", "authors": "Wang R, McFarland JG, Kekomaki R, Newman PJ", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "7694683", "url": "https://glygen.org/publication/PubMed/7694683" } ] }, { "title": "B-Raf protein isoforms interact with and phosphorylate Mek-1 on serine residues 218 and 222.", "journal": "Oncogene", "date": "1995", "authors": "Papin C, Eychene A, Brunet A, Pages G, Pouyssegur J, Calothy G, Barnier JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "7731720", "url": "https://glygen.org/publication/PubMed/7731720" } ] }, { "title": "Processing of transforming growth factor beta 1 precursor by human furin convertase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Dubois CM, Laprise MH, Blanchette F, Gentry LE, Leduc R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "7737999", "url": "https://glygen.org/publication/PubMed/7737999" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "Inherited diseases of platelet glycoproteins: considerations for rapid molecular characterization.", "journal": "Thromb. Haemost.", "date": "1994", "authors": "Bray P F", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "7878622", "url": "https://glygen.org/publication/PubMed/7878622" } ] }, { "title": "Overexpression of mitogen-activated protein kinase kinase (MAPKK) and its mutants in NIH 3T3 cells. Evidence that MAPKK involvement in cellular proliferation is regulated by phosphorylation of serine residues in its kinase subdomains VII and VIII.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Seger R, Seger D, Reszka AA, Munar ES, Eldar-Finkelman H, Dobrowolska G, Jensen AM, Campbell JS, Fischer EH, Krebs EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "7929275", "url": "https://glygen.org/publication/PubMed/7929275" } ] }, { "title": "The mitogen-activated protein kinase cascade is activated by B-Raf in response to nerve growth factor through interaction with p21ras.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Jaiswal RK, Moodie SA, Wolfman A, Landreth GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "7935411", "url": "https://glygen.org/publication/PubMed/7935411" } ] }, { "title": "Integrin-mediated signal transduction linked to Ras pathway by GRB2 binding to focal adhesion kinase.", "journal": "Nature", "date": "1994", "authors": "Schlaepfer DD, Hanks SK, Hunter T, van der Geer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-354194", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354194" } ], "reference": [ { "type": "PubMed", "id": "7997267", "url": "https://glygen.org/publication/PubMed/7997267" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Mechanism of activation of the TGF-beta receptor.", "journal": "Nature", "date": "1994", "authors": "Wrana JL, Attisano L, Wieser R, Ventura F, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8047140", "url": "https://glygen.org/publication/PubMed/8047140" } ] }, { "title": "Cytoplasmic localization of the mitogen-activated protein kinase activator MEK.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Zheng CF, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "8051079", "url": "https://glygen.org/publication/PubMed/8051079" } ] }, { "title": "Single point mutation in human glycoprotein IIIa is associated with a new platelet-specific alloantigen (Mo) involved in neonatal alloimmune thrombocytopenia.", "journal": "Blood", "date": "1993", "authors": "Kuijpers RW, Simsek S, Faber NM, Goldschmeding R, van Wermerkerken RK, von dem Borne AE", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "8093349", "url": "https://glygen.org/publication/PubMed/8093349" } ] }, { "title": "Platelet adhesion to collagen types I through VIII under conditions of stasis and flow is mediated by GPIa/IIa (alpha 2 beta 1-integrin).", "journal": "Blood", "date": "1994", "authors": "Saelman EU, Nieuwenhuis HK, Hese KM, de Groot PG, Heijnen HF, Sage EH, Williams S, McKeown L, Gralnick HR, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8118028", "url": "https://glygen.org/publication/PubMed/8118028" } ] }, { "title": "A point mutation leads to an unpaired cysteine residue and a molecular weight polymorphism of a functional platelet beta 3 integrin subunit. The Sra alloantigen system of GPIIIa.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Santoso S, Kalb R, Kroll H, Walka M, Kiefel V, Mueller-Eckhardt C, Newman PJ", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "8132570", "url": "https://glygen.org/publication/PubMed/8132570" } ] }, { "title": "Identification of the sites in MAP kinase kinase-1 phosphorylated by p74raf-1.", "journal": "The EMBO journal", "date": "1994", "authors": "Alessi DR, Saito Y, Campbell DG, Cohen P, Sithanandam G, Rapp U, Ashworth A, Marshall CJ, Cowley S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "8157000", "url": "https://glygen.org/publication/PubMed/8157000" } ] }, { "title": "A new alternative transcript encodes a 60 kDa truncated form of integrin beta 3.", "journal": "Biochem. J.", "date": "1994", "authors": "Djaffar I, Chen Y P, Creminon C, Maclouf J, Cieutat A M, Gayet O, Rosa J P", "evidence": [ { "database": "UniProtKB", "id": "Q16157", "url": "https://www.uniprot.org/uniprot/Q16157" } ], "reference": [ { "type": "PubMed", "id": "8198553", "url": "https://glygen.org/publication/PubMed/8198553" } ] }, { "title": "Cloning of a TGF beta type I receptor that forms a heteromeric complex with the TGF beta type II receptor.", "journal": "Cell", "date": "1993", "authors": "Franzen P, ten Dijke P, Ichijo H, Yamashita H, Schulz P, Heldin CH, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8242743", "url": "https://glygen.org/publication/PubMed/8242743" } ] }, { "title": "Isolation and characterization of a TATA-less promoter for the human beta 3 integrin gene.", "journal": "Blood", "date": "1994", "authors": "Villa-Garcia M, Li L, Riely G, Bray P F", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "8298129", "url": "https://glygen.org/publication/PubMed/8298129" } ] }, { "title": "Interaction of type IV collagen with the isolated integrins alpha 1 beta 1 and alpha 2 beta 1.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Kern A, Eble J, Golbik R, Kuhn K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8344274", "url": "https://glygen.org/publication/PubMed/8344274" } ] }, { "title": "Cloning and characterization of two distinct human extracellular signal-regulated kinase activator kinases, MEK1 and MEK2.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Zheng CF, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8388392", "url": "https://glygen.org/publication/PubMed/8388392" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "The fourth immunoglobulin-like domain of NCAM contains a carbohydrate recognition domain for oligomannosidic glycans implicated in association with L1 and neurite outgrowth.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Horstkorte R, Schachner M, Magyar JP, Vorherr T, Schmitz B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8509458", "url": "https://glygen.org/publication/PubMed/8509458" } ] }, { "title": "Receptor-ligand interaction between CD44 and osteopontin (Eta-1).", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber GF, Ashkar S, Glimcher MJ, Cantor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8560266", "url": "https://glygen.org/publication/PubMed/8560266" } ] }, { "title": "Casein kinase II phosphorylates the neural cell adhesion molecule L1.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Wong EV, Schaefer AW, Landreth G, Lemmon V", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8592152", "url": "https://glygen.org/publication/PubMed/8592152" } ] }, { "title": "Stimulation of fibroblast growth factor receptor-1 occupancy and signaling by cell surface-associated syndecans and glypican.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Steinfeld R, Van Den Berghe H, David G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "8609172", "url": "https://glygen.org/publication/PubMed/8609172" } ] }, { "title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "8617235", "url": "https://glygen.org/publication/PubMed/8617235" } ] }, { "title": "Cell adhesion and integrin binding to recombinant human fibrillin-1.", "journal": "FEBS letters", "date": "1996", "authors": "Pfaff M, Reinhardt DP, Sakai LY, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "8617364", "url": "https://glygen.org/publication/PubMed/8617364" } ] }, { "title": "Direct binding of C-terminal region of p130Cas to SH2 and SH3 domains of Src kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Nakamoto T, Sakai R, Ozawa K, Yazaki Y, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708" } ], "reference": [ { "type": "PubMed", "id": "8621540", "url": "https://glygen.org/publication/PubMed/8621540" } ] }, { "title": "Outside-in integrin signal transduction. Alpha IIb beta 3-(GP IIb IIIa) tyrosine phosphorylation induced by platelet aggregation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Law DA, Nannizzi-Alaimo L, Phillips DR", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" } ], "reference": [ { "type": "PubMed", "id": "8631894", "url": "https://glygen.org/publication/PubMed/8631894" } ] }, { "title": "Introduction of p130cas signaling complex formation upon integrin-mediated cell adhesion: a role for Src family kinases.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Vuori K, Hirai H, Aizawa S, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-372708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708" } ], "reference": [ { "type": "PubMed", "id": "8649368", "url": "https://glygen.org/publication/PubMed/8649368" } ] }, { "title": "Not all Shc's roads lead to Ras.", "journal": "Trends in biochemical sciences", "date": "1996", "authors": "Bonfini L, Migliaccio E, Pelicci G, Lanfrancone L, Pelicci PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "8755247", "url": "https://glygen.org/publication/PubMed/8755247" } ] }, { "title": "A Cys374Tyr homozygous mutation of platelet glycoprotein IIIa (beta 3) in a Chinese patient with Glanzmann's thrombasthenia.", "journal": "Blood", "date": "1996", "authors": "Grimaldi CM, Chen F, Scudder LE, Coller BS, French DL", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "8781422", "url": "https://glygen.org/publication/PubMed/8781422" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Identification of alpha v beta 3 as a heterotypic ligand for CD31/PECAM-1.", "journal": "Journal of cell science", "date": "1996", "authors": "Buckley CD, Doyonnas R, Newton JP, Blystone SD, Brown EJ, Watt SM, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8838667", "url": "https://glygen.org/publication/PubMed/8838667" } ] }, { "title": "Osteopontin N-terminal domain contains a cryptic adhesive sequence recognized by alpha9beta1 integrin.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Smith LL, Cheung HK, Ling LE, Chen J, Sheppard D, Pytela R, Giachelli CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8910476", "url": "https://glygen.org/publication/PubMed/8910476" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Phosphorylation of Ser165 in TGF-beta type I receptor modulates TGF-beta1-induced cellular responses.", "journal": "The EMBO journal", "date": "1996", "authors": "Souchelnytskyi S, ten Dijke P, Miyazono K, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8947046", "url": "https://glygen.org/publication/PubMed/8947046" } ] }, { "title": "MADR2 is a substrate of the TGFbeta receptor and its phosphorylation is required for nuclear accumulation and signaling.", "journal": "Cell", "date": "1996", "authors": "Macias-Silva M, Abdollah S, Hoodless PA, Pirone R, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8980228", "url": "https://glygen.org/publication/PubMed/8980228" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "Differential regulation of Raf-1, A-Raf, and B-Raf by oncogenic ras and tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Marais R, Light Y, Paterson HF, Mason CS, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "9020159", "url": "https://glygen.org/publication/PubMed/9020159" } ] }, { "title": "The protein-tyrosine phosphatase SHP-2 binds platelet/endothelial cell adhesion molecule-1 (PECAM-1) and forms a distinct signaling complex during platelet aggregation. Evidence for a mechanistic link between PECAM-1- and integrin-mediated cellular signaling.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Jackson DE, Ward CM, Wang R, Newman PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "9054388", "url": "https://glygen.org/publication/PubMed/9054388" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Multimerization of the cytoplasmic domain of syndecan-4 is required for its ability to activate protein kinase C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Oh ES, Woods A, Couchman JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "9115237", "url": "https://glygen.org/publication/PubMed/9115237" } ] }, { "title": "Vascular endothelial growth factor stimulates tyrosine phosphorylation and recruitment to new focal adhesions of focal adhesion kinase and paxillin in endothelial cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Abedi H, Zachary I", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9182576", "url": "https://glygen.org/publication/PubMed/9182576" } ] }, { "title": "Cloning and characterization of a novel integrin beta3 subunit.", "journal": "The Journal of biological chemistry", "date": "1997-06-27", "authors": "Kumar C S, James I E, Wong A, Mwangi V, Feild J A, Nuthulaganti P, Connor J R, Eichman C, Ali F, Hwang S M, Rieman D J, Drake F H, Gowen M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "9195946", "url": "https://glygen.org/publication/PubMed/9195946" } ] }, { "title": "Hematologically important mutations: Glanzmann thrombasthenia.", "journal": "Blood cells, molecules & diseases", "date": "1997", "authors": "French DL, Coller BS", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "9215749", "url": "https://glygen.org/publication/PubMed/9215749" } ] }, { "title": "Mechanism of TGFbeta receptor inhibition by FKBP12.", "journal": "The EMBO journal", "date": "1997", "authors": "Chen YG, Liu F, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9233797", "url": "https://glygen.org/publication/PubMed/9233797" } ] }, { "title": "The alpha v beta 3 integrin `vitronectin receptor`.", "journal": "The international journal of biochemistry & cell biology", "date": "1997", "authors": "Horton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9251239", "url": "https://glygen.org/publication/PubMed/9251239" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "Residues on both faces of the first immunoglobulin fold contribute to homophilic binding sites of PECAM-1/CD31.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Newton JP, Buckley CD, Jones EY, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "9252369", "url": "https://glygen.org/publication/PubMed/9252369" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.", "journal": "The EMBO journal", "date": "1997", "authors": "Nakao A, Imamura T, Souchelnytskyi S, Kawabata M, Ishisaki A, Oeda E, Tamaki K, Hanai J, Heldin CH, Miyazono K, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9311995", "url": "https://glygen.org/publication/PubMed/9311995" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "Phosphorylation of Ser465 and Ser467 in the C terminus of Smad2 mediates interaction with Smad4 and is required for transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Souchelnytskyi S, Tamaki K, Engstrom U, Wernstedt C, ten Dijke P, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9346966", "url": "https://glygen.org/publication/PubMed/9346966" } ] }, { "title": "Regulation of the pp72syk protein tyrosine kinase by platelet integrin alpha IIb beta 3.", "journal": "The EMBO journal", "date": "1997", "authors": "Gao J, Zoller KE, Ginsberg MH, Brugge JS, Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-354192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192" } ], "reference": [ { "type": "PubMed", "id": "9351824", "url": "https://glygen.org/publication/PubMed/9351824" } ] }, { "title": "A Leu117-->Trp mutation within the RGD-peptide cross-linking region of beta3 results in Glanzmann thrombasthenia by preventing alphaIIb beta3 export to the platelet surface.", "journal": "Blood", "date": "1997", "authors": "Basani RB, Brown DL, Vilaire G, Bennett JS, Poncz M", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "9376589", "url": "https://glygen.org/publication/PubMed/9376589" } ] }, { "title": "p38 MAP kinase activation by vascular endothelial growth factor mediates actin reorganization and cell migration in human endothelial cells.", "journal": "Oncogene", "date": "1997", "authors": "Rousseau S, Houle F, Landry J, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9393975", "url": "https://glygen.org/publication/PubMed/9393975" } ] }, { "title": "A single immunoglobulin-like domain of the human neural cell adhesion molecule L1 supports adhesion by multiple vascular and platelet integrins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Felding-Habermann B, Silletti S, Mei F, Siu CH, Yip PM, Brooks PC, Cheresh DA, O'Toole TE, Ginsberg MH, Montgomery AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "9396761", "url": "https://glygen.org/publication/PubMed/9396761" } ] }, { "title": "Interactions of FLT-1 and KDR with phospholipase C gamma: identification of the phosphotyrosine binding sites.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Cunningham SA, Arrate MP, Brock TA, Waxham MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9398617", "url": "https://glygen.org/publication/PubMed/9398617" } ] }, { "title": "The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.", "journal": "Journal of cell science", "date": "1998", "authors": "Memmo LM, McKeown-Longo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9443892", "url": "https://glygen.org/publication/PubMed/9443892" } ] }, { "title": "CAS/Crk coupling serves as a `molecular switch` for induction of cell migration.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Klemke RL, Leng J, Molander R, Brooks PC, Vuori K, Cheresh DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420097", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097" } ], "reference": [ { "type": "PubMed", "id": "9472046", "url": "https://glygen.org/publication/PubMed/9472046" } ] }, { "title": "Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Yokosaki Y, Matsuura N, Higashiyama S, Murakami I, Obara M, Yamakido M, Shigeto N, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9565552", "url": "https://glygen.org/publication/PubMed/9565552" } ] }, { "title": "Multiple Grb2-mediated integrin-stimulated signaling pathways to ERK2/mitogen-activated protein kinase: summation of both c-Src- and focal adhesion kinase-initiated tyrosine phosphorylation events.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Schlaepfer DD, Jones KC, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-354194", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354194" } ], "reference": [ { "type": "PubMed", "id": "9566877", "url": "https://glygen.org/publication/PubMed/9566877" } ] }, { "title": "beta3 Integrins mediate the cellular entry of hantaviruses that cause respiratory failure.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998-06-09", "authors": "Gavrilovskaya I N, Shepley M, Shaw R, Ginsberg M H, Mackow E R", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "9618541", "url": "https://glygen.org/publication/PubMed/9618541" } ] }, { "title": "A Ser162-->Leu mutation within glycoprotein (GP) IIIa (integrin beta3) results in an unstable alphaIIbbeta3 complex that retains partial function in a novel form of type II Glanzmann thrombasthenia.", "journal": "Thrombosis and haemostasis", "date": "1998", "authors": "Jackson DE, White MM, Jennings LK, Newman PJ", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "9684783", "url": "https://glygen.org/publication/PubMed/9684783" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Interactions between growth factors and integrins: latent forms of transforming growth factor-beta are ligands for the integrin alphavbeta1.", "journal": "Molecular biology of the cell", "date": "1998", "authors": "Munger JS, Harpel JG, Giancotti FG, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "9725916", "url": "https://glygen.org/publication/PubMed/9725916" } ] }, { "title": "MP1: a MEK binding partner that enhances enzymatic activation of the MAP kinase cascade.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Schaeffer HJ, Catling AD, Eblen ST, Collier LS, Krauss A, Weber MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "9733512", "url": "https://glygen.org/publication/PubMed/9733512" } ] }, { "title": "Recruitment and activation of SHP-1 protein-tyrosine phosphatase by human platelet endothelial cell adhesion molecule-1 (PECAM-1). Identification of immunoreceptor tyrosine-based inhibitory motif-like binding motifs and substrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Hua CT, Gamble JR, Vadas MA, Jackson DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-210990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990" } ], "reference": [ { "type": "PubMed", "id": "9774457", "url": "https://glygen.org/publication/PubMed/9774457" } ] }, { "title": "Three novel integrin beta3 subunit missense mutations (H280P, C560F, and G579S) in thrombasthenia, including one (H280P) prevalent in Japanese patients.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Ambo H, Kamata T, Handa M, Taki M, Kuwajima M, Kawai Y, Oda A, Murata M, Takada Y, Watanabe K, Ikeda Y", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "reference": [ { "type": "PubMed", "id": "9790984", "url": "https://glygen.org/publication/PubMed/9790984" } ] }, { "title": "Effect of the interaction between fibronectin and VLA-4 on the proliferation of human B cells, especially a novel human B-cell line, OPM-3.", "journal": "British journal of haematology", "date": "1998", "authors": "Yoshida H, Nishiura T, Karasuno T, Matsumura I, Ishikawa J, Yoshimura M, Yokota T, Okajima Y, Ogawa M, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9858236", "url": "https://glygen.org/publication/PubMed/9858236" } ] }, { "title": "Identification of constitutive and ras-inducible phosphorylation sites of KSR: implications for 14-3-3 binding, mitogen-activated protein kinase binding, and KSR overexpression.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Cacace AM, Michaud NR, Therrien M, Mathes K, Copeland T, Rubin GM, Morrison DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5674135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135" } ], "reference": [ { "type": "PubMed", "id": "9858547", "url": "https://glygen.org/publication/PubMed/9858547" } ] }, { "title": "SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.", "journal": "Cell", "date": "1998", "authors": "Tsukazaki T, Chiang TA, Davison AF, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9865696", "url": "https://glygen.org/publication/PubMed/9865696" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:3690", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3690", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-1566948", "name": "Elastic fibre formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948", "resource": "Reactome", "description": "Elastic fibre formation" }, { "id": "R-HSA-210990", "name": "PECAM1 interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210990", "resource": "Reactome", "description": "PECAM1 interactions" }, { "id": "R-HSA-2129379", "name": "Molecules associated with elastic fibres", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "resource": "Reactome", "description": "Molecules associated with elastic fibres" }, { "id": "R-HSA-216083", "name": "Integrin cell surface interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "resource": "Reactome", "description": "Integrin cell surface interactions" }, { "id": "R-HSA-2173789", "name": "TGF-beta receptor signaling activates SMADs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789", "resource": "Reactome", "description": "TGF-beta receptor signaling activates SMADs" }, { "id": "R-HSA-3000170", "name": "Syndecan interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "resource": "Reactome", "description": "Syndecan interactions" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-354192", "name": "Integrin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354192", "resource": "Reactome", "description": "Integrin signaling" }, { "id": "R-HSA-354194", "name": "GRB2:SOS provides linkage to MAPK signaling for Integrins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-354194", "resource": "Reactome", "description": "GRB2:SOS provides linkage to MAPK signaling for Integrins" }, { "id": "R-HSA-372708", "name": "p130Cas linkage to MAPK signaling for integrins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-372708", "resource": "Reactome", "description": "p130Cas linkage to MAPK signaling for integrins" }, { "id": "R-HSA-4420097", "name": "VEGFA-VEGFR2 Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420097", "resource": "Reactome", "description": "VEGFA-VEGFR2 Pathway" }, { "id": "R-HSA-445144", "name": "Signal transduction by L1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "resource": "Reactome", "description": "Signal transduction by L1" }, { "id": "R-HSA-5674135", "name": "MAP2K and MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5674135", "resource": "Reactome", "description": "MAP2K and MAPK activation" }, { "id": "R-HSA-6802946", "name": "Signaling by moderate kinase activity BRAF mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802946", "resource": "Reactome", "description": "Signaling by moderate kinase activity BRAF mutants" }, { "id": "R-HSA-6802948", "name": "Signaling by high-kinase activity BRAF mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802948", "resource": "Reactome", "description": "Signaling by high-kinase activity BRAF mutants" }, { "id": "R-HSA-6802952", "name": "Signaling by BRAF and RAF1 fusions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952", "resource": "Reactome", "description": "Signaling by BRAF and RAF1 fusions" }, { "id": "R-HSA-6802955", "name": "Paradoxical activation of RAF signaling by kinase inactive BRAF", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802955", "resource": "Reactome", "description": "Paradoxical activation of RAF signaling by kinase inactive BRAF" }, { "id": "R-HSA-9649948", "name": "Signaling downstream of RAS mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9649948", "resource": "Reactome", "description": "Signaling downstream of RAS mutants" }, { "id": "R-HSA-9656223", "name": "Signaling by RAF1 mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9656223", "resource": "Reactome", "description": "Signaling by RAF1 mutants" } ], "orthologs": [ { "uniprot_canonical_ac": "O54890-1", "protein_name": "Integrin beta-3", "gene_name": "Itgb3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRAQWPGQLWAALLALGALAGVVVGESNICTTRGVNSCQQCLAVSPVCAWCSDETLSQGSPRCNLKENLLKDNCAPESIEFPVSEAQILEARPLSSKGSGSSAQITQVSPQRIALRLRPDDSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMYISPPQAIKNPCYNMKNACLPMFGYKHVLTLTDQVSRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGHCHIGTDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSDDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEQSFTIKPVGFKDSLTVQVTFDCDCACQAFAQPSSPRCNNGNGTFECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLCSGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSFKKECVECKKFNRGTLHEENTCSRYCRDDIEQVKELTDTGKNAVNCTYKNEDDCVVRFQYYEDTSGRAVLYVVEEPECPKGPDILVVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT", "length": 787 }, "evidence": [ { "id": "45921799", "url": "http://www.informatics.jax.org/homology/45921799", "database": "MGI" }, { "id": "P05106", "url": "https://omabrowser.org/oma/group/P05106/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8R2H2-1", "protein_name": "Integrin beta-3", "gene_name": "Itgb3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRTRRPGQLWATLLALGALAGVVVGESNICTTRGVNSCQQCLAVSPVCAWCSDESLPQNSPRCNLKKNLLKDKCSPESIEFPVSEAQILEALPLSSKGSGDSAQITQVSPQRIALRLRPDDSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMFISPPQAIKNPCYTMKSTCLPMFGYKHVLTLTDQVTRFNDEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGRCHIGPDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSDDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQQKEQSFTIKPVGFKDSLTVQVTFDCDCDCQAFAQPLSPRCNNGNGTFECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLCSGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSFKKDCVECKKFNRGKLHEENNCNRFCRDDIELVKELTDTGKNAVNCTYKNEDDCVVRFQYYEDSSGRAVLYVVEEPECPKGPDILVVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT", "length": 787 }, "evidence": [ { "id": "45921799", "url": "http://www.informatics.jax.org/homology/45921799", "database": "MGI" }, { "id": "P05106", "url": "https://omabrowser.org/oma/group/P05106/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 65, "go_terms": [ { "name": "positive regulation of glomerular mesangial cell proliferation", "id": "GO:0072126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072126", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of bone resorption", "id": "GO:0045124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045124", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell-substrate junction assembly", "id": "GO:0007044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007044", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "tube development", "id": "GO:0035295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035295", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative regulation of lipid storage", "id": "GO:0010888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010888", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "integrin-mediated signaling pathway", "id": "GO:0007229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of actin cytoskeleton organization", "id": "GO:0032956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of T cell migration", "id": "GO:2000406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000406", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "blood coagulation", "id": "GO:0007596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell migration", "id": "GO:0010595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "smooth muscle cell migration", "id": "GO:0014909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014909", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cellular response to xenobiotic stimulus", "id": "GO:0071466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071466", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell-matrix adhesion", "id": "GO:0007160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007160", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell adhesion mediated by integrin", "id": "GO:0033627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033627", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of cell adhesion mediated by integrin", "id": "GO:0033630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033630", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of bone resorption", "id": "GO:0045780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045780", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative regulation of macrophage derived foam cell differentiation", "id": "GO:0010745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010745", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "platelet activation", "id": "GO:0030168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030168", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "activation of protein kinase activity", "id": "GO:0032147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032147", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell proliferation", "id": "GO:0001938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001938", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of osteoblast proliferation", "id": "GO:0033690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033690", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "substrate adhesion-dependent cell spreading", "id": "GO:0034446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034446", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of substrate adhesion-dependent cell spreading", "id": "GO:1900026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900026", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of extracellular matrix organization", "id": "GO:1903053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903053", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell apoptotic process", "id": "GO:2000352", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000352", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "response to activity", "id": "GO:0014823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014823", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "viral entry into host cell", "id": "GO:0046718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046718", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "apolipoprotein A-I-mediated signaling pathway", "id": "GO:0038027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038027", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "platelet aggregation", "id": "GO:0070527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070527", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "apoptotic cell clearance", "id": "GO:0043277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043277", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative chemotaxis", "id": "GO:0050919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050919", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of fibroblast migration", "id": "GO:0010763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010763", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of release of sequestered calcium ion into cytosol", "id": "GO:0051279", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051279", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell-substrate adhesion", "id": "GO:0031589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031589", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cellular response to platelet-derived growth factor stimulus", "id": "GO:0036120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036120", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "wound healing", "id": "GO:0042060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042060", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "embryo implantation", "id": "GO:0007566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007566", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of vascular endothelial growth factor receptor signaling pathway", "id": "GO:0030949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030949", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "platelet-derived growth factor receptor signaling pathway", "id": "GO:0048008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048008", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell migration", "id": "GO:0014911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014911", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "angiogenesis involved in wound healing", "id": "GO:0060055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060055", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of adenylate cyclase-inhibiting opioid receptor signaling pathway", "id": "GO:1900731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900731", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "positive regulation of cell-matrix adhesion", "id": "GO:0001954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001954", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "heterotypic cell-cell adhesion", "id": "GO:0034113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034113", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cellular response to insulin-like growth factor stimulus", "id": "GO:1990314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990314", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative regulation of low-density lipoprotein receptor activity", "id": "GO:1905598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905598", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "blood coagulation, fibrin clot formation", "id": "GO:0072378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072378", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "mesodermal cell differentiation", "id": "GO:0048333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048333", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative regulation of lipid transport", "id": "GO:0032369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032369", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "negative regulation of lipoprotein metabolic process", "id": "GO:0050748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050748", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of serotonin uptake", "id": "GO:0051611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051611", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "maintenance of postsynaptic specialization structure", "id": "GO:0098880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098880", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of postsynaptic neurotransmitter receptor internalization", "id": "GO:0099149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099149", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of trophoblast cell migration", "id": "GO:1901163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901163", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "regulation of postsynaptic neurotransmitter receptor diffusion trapping", "id": "GO:0150054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150054", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 28, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-IGF-1-IGF1R complex", "id": "GO:0035867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035867", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell-cell junction", "id": "GO:0005911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005911", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "receptor complex", "id": "GO:0043235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "postsynaptic membrane", "id": "GO:0045211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045211", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "alpha9-beta1 integrin-ADAM8 complex", "id": "GO:0071133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071133", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "ruffle membrane", "id": "GO:0032587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032587", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "lamellipodium membrane", "id": "GO:0031258", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031258", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "filopodium membrane", "id": "GO:0031527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031527", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "platelet alpha granule membrane", "id": "GO:0031092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031092", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "glycinergic synapse", "id": "GO:0098690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098690", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "microvillus membrane", "id": "GO:0031528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031528", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "integrin complex", "id": "GO:0008305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008305", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "integrin alphav-beta3 complex", "id": "GO:0034683", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034683", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-vitronectin complex", "id": "GO:0071062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071062", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-HMGB1 complex", "id": "GO:0035868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035868", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-PKCalpha complex", "id": "GO:0035866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035866", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 15, "go_terms": [ { "name": "platelet-derived growth factor receptor binding", "id": "GO:0005161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005161", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "coreceptor activity", "id": "GO:0015026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015026", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "protein kinase C binding", "id": "GO:0005080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005080", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "cell adhesion molecule binding", "id": "GO:0050839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050839", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "extracellular matrix binding", "id": "GO:0050840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050840", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "fibronectin binding", "id": "GO:0001968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001968", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "protein disulfide isomerase activity", "id": "GO:0003756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003756", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "vascular endothelial growth factor receptor 2 binding", "id": "GO:0043184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043184", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" }, { "name": "fibrinogen binding", "id": "GO:0070051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070051", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "integrin beta-3 N-glycosylated 1 (human)", "definition": "An integrin beta-3 (human) that has been N-glycosylated at the residue equivalent to Asn-125 of the amino acid sequence represented by UniProtKB:P05106-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P05106-1, Asn-125, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053450", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053450" } ] }, { "name": "integrin beta-3 N-glycosylated 2 (human)", "definition": "An integrin beta-3 (human) that has been N-glycosylated at the residue equivalent to Asn-125 of the amino acid sequence represented by UniProtKB:P05106-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P05106-1, Asn-125, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053451", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053451" } ] } ], "site_annotation": [ { "start_pos": 125, "end_pos": 127, "annotation": "n_glycosylation_sequon" }, { "start_pos": 346, "end_pos": 348, "annotation": "n_glycosylation_sequon" }, { "start_pos": 397, "end_pos": 399, "annotation": "n_glycosylation_sequon" }, { "start_pos": 478, "end_pos": 480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 585, "end_pos": 587, "annotation": "n_glycosylation_sequon" }, { "start_pos": 680, "end_pos": 682, "annotation": "n_glycosylation_sequon" }, { "start_pos": 782, "end_pos": 784, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated on tyrosine residues in response to thrombin-induced platelet aggregation. Probably involved in outside-in signaling. A peptide (AA 740-762) is capable of binding GRB2 only when both Tyr-773 and Tyr-785 are phosphorylated. Phosphorylation of Thr-779 inhibits SHC binding.", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprot/P05106" }, { "database": "PubMed", "id": "10896934", "url": "https://glygen.org/publication/PubMed/10896934" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 125, 346, 397, 478, 585, 680 ], "o_linked_sites": [], "snv_sites": [ 102, 127, 145, 268, 307, 348, 362, 386, 397, 399, 422, 478, 551, 578, 585, 587, 657, 682, 749, 750, 771 ], "glycation_sites": [], "phosphorylation_sites": [ 767, 773, 777, 778, 779, 785 ], "sequon_annotation_sites": [ { "start_pos": 125, "end_pos": 127 }, { "start_pos": 346, "end_pos": 348 }, { "start_pos": 397, "end_pos": 399 }, { "start_pos": 478, "end_pos": 480 }, { "start_pos": 585, "end_pos": 587 }, { "start_pos": 680, "end_pos": 682 }, { "start_pos": 782, "end_pos": 784 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 24 }, { "field": "total_sites", "count": 21 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 470 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }