{ "uniprot_canonical_ac": "P04908-1", "uniprot_ac": "P04908", "uniprot_id": "H2A1B_HUMAN", "mass": { "chemical_mass": 14135.0, "monoisotopic_mass": 14135.0 }, "refseq": { "ac": "NP_003504", "name": "histone H2A type 1-B/E", "summary": "Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504" }, "gene_names": [ { "name": "H2AC4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04908", "id": "P04908" }, { "name": "H2AC8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04908", "id": "P04908" }, { "name": "H2A/m; H2AC8; H2AFM; HIST1H2AB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504", "id": "NP_003504" }, { "name": "H2AC4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504", "id": "NP_003504" }, { "name": "H2AFA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04908", "id": "P04908" }, { "name": "H2AFM", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04908", "id": "P04908" }, { "name": "HIST1H2AB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04908", "id": "P04908" }, { "name": "HIST1H2AE", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04908", "id": "P04908" } ], "protein_names": [ { "name": "Histone H2A type 1-B/E", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04908" }, { "name": "H2A histone family, member M; histone 1, H2ab; histone H2A/m; histone cluster 1, H2ab; histone cluster 1 H2A family member b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504", "id": "NP_003504" }, { "name": "Histone H2A.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04908" }, { "name": "Histone H2A/a", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04908" }, { "name": "Histone H2A/m", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04908" }, { "name": "histone H2A type 1-B/E", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504", "id": "NP_003504" } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908#function" } ] }, { "annotation": "Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_003504", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504" } ] }, { "annotation": "Inhibition of HIST1H2AB suppresses the proliferation of lung adenocarcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_003504", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504" }, { "database": "PubMed", "id": "36511295", "url": "https://glygen.org/publication/PubMed/36511295" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs769954431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769954431" }, { "id": "rs769954431", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769954431" }, { "id": "rs769954431", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs769954431#frequency_tab" }, { "id": "rs769954431", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769954431" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 119, "end_pos": 119, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKT->NKT).", "chr_id": "6", "chr_pos": "26033212", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K119", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04908", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04908" }, { "id": "rs1477519801", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477519801" }, { "id": "rs1477519801", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477519801" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 41, "end_pos": 41, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "6", "chr_pos": "26217096", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S41", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs750417482", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750417482" }, { "id": "rs750417482", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750417482" }, { "id": "rs750417482", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750417482" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 71, "end_pos": 71, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).", "chr_id": "6", "chr_pos": "26033358", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A71", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04908", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04908" }, { "id": "rs563842312", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563842312" }, { "id": "rs563842312", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563842312" }, { "id": "rs1561919905", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1561919905" }, { "id": "rs1561919905", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1561919905" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 75, "end_pos": 75, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KKT->NKT).", "chr_id": "6", "chr_pos": "26217199", "ref_nt": "G", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "K75", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 2, "sequence_org": "S", "sequence_mut": "A", "comment": "Blocks the inhibition of transcription by RPS6KA5/MSK1.", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PubMed", "id": "15010469", "url": "https://glygen.org/publication/PubMed/15010469" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "57.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "51.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "79.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "64.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "69.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "57.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "74.07", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "71.04", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "87.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "62.03", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04908" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "common_name": "Human" } ], "gene": [ { "name": "H2AC4", "url": "https://www.uniprot.org/uniprot/P04908", "locus": { "chromosome": "6", "start_pos": 26033092, "end_pos": 26033618, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000278463", "url": "https://www.ensembl.org/id/ENSG00000278463" } ] } } ], "crossref": [ { "id": "ENSG00000277075", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000277075", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P04908", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04908", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00074", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00074", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "H2AC4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H2AC4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "H2AC8", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H2AC8", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3012", "url": "https://www.ncbi.nlm.nih.gov/gene/3012", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8335", "url": "https://www.ncbi.nlm.nih.gov/gene/8335", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4724", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4724", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4734", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4734", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04908", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04908*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002119", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002119", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032458", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032458", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3012", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3012", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8335", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8335", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602786", "url": "http://www.omim.org/entry/602786", "database": "MIM", "categories": [ "Other" ] }, { "id": "602795", "url": "http://www.omim.org/entry/602795", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04908", "url": "https://www.nextprot.org/entry/NX_P04908", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P04908", "url": "https://oglcnac.org/atlas/detail/P04908", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P04908", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "KXRRRTR", "url": "https://omabrowser.org/oma/group/KXRRRTR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4637469at2759", "url": "http://www.orthodb.org/?query=4637469at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23430", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23430", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23430:SF56", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23430:SF56", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2CV5", "url": "https://www.rcsb.org/structure/2CV5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RVQ", "url": "https://www.rcsb.org/structure/2RVQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A6N", "url": "https://www.rcsb.org/structure/3A6N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AFA", "url": "https://www.rcsb.org/structure/3AFA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AN2", "url": "https://www.rcsb.org/structure/3AN2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AV1", "url": "https://www.rcsb.org/structure/3AV1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AV2", "url": "https://www.rcsb.org/structure/3AV2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AYW", "url": "https://www.rcsb.org/structure/3AYW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZE", "url": "https://www.rcsb.org/structure/3AZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZF", "url": "https://www.rcsb.org/structure/3AZF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZG", "url": "https://www.rcsb.org/structure/3AZG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZH", "url": "https://www.rcsb.org/structure/3AZH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZI", "url": "https://www.rcsb.org/structure/3AZI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZJ", "url": "https://www.rcsb.org/structure/3AZJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZK", "url": "https://www.rcsb.org/structure/3AZK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZL", "url": "https://www.rcsb.org/structure/3AZL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZM", "url": "https://www.rcsb.org/structure/3AZM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZN", "url": "https://www.rcsb.org/structure/3AZN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W96", "url": "https://www.rcsb.org/structure/3W96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W97", "url": "https://www.rcsb.org/structure/3W97", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W98", "url": "https://www.rcsb.org/structure/3W98", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W99", "url": "https://www.rcsb.org/structure/3W99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WKJ", "url": "https://www.rcsb.org/structure/3WKJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WTP", "url": "https://www.rcsb.org/structure/3WTP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X1S", "url": "https://www.rcsb.org/structure/3X1S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X1V", "url": "https://www.rcsb.org/structure/3X1V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YM5", "url": "https://www.rcsb.org/structure/4YM5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YM6", "url": "https://www.rcsb.org/structure/4YM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z5T", "url": "https://www.rcsb.org/structure/4Z5T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV5", "url": "https://www.rcsb.org/structure/5AV5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV6", "url": "https://www.rcsb.org/structure/5AV6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV8", "url": "https://www.rcsb.org/structure/5AV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV9", "url": "https://www.rcsb.org/structure/5AV9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AVB", "url": "https://www.rcsb.org/structure/5AVB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AVC", "url": "https://www.rcsb.org/structure/5AVC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AY8", "url": "https://www.rcsb.org/structure/5AY8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B0Y", "url": "https://www.rcsb.org/structure/5B0Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B0Z", "url": "https://www.rcsb.org/structure/5B0Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B24", "url": "https://www.rcsb.org/structure/5B24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B2I", "url": "https://www.rcsb.org/structure/5B2I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B2J", "url": "https://www.rcsb.org/structure/5B2J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B31", "url": "https://www.rcsb.org/structure/5B31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B32", "url": "https://www.rcsb.org/structure/5B32", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B40", "url": "https://www.rcsb.org/structure/5B40", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CPI", "url": "https://www.rcsb.org/structure/5CPI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CPJ", "url": "https://www.rcsb.org/structure/5CPJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CPK", "url": "https://www.rcsb.org/structure/5CPK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GSE", "url": "https://www.rcsb.org/structure/5GSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GTC", "url": "https://www.rcsb.org/structure/5GTC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GXQ", "url": "https://www.rcsb.org/structure/5GXQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JRG", "url": "https://www.rcsb.org/structure/5JRG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X7X", "url": "https://www.rcsb.org/structure/5X7X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XF3", "url": "https://www.rcsb.org/structure/5XF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XF4", "url": "https://www.rcsb.org/structure/5XF4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XF5", "url": "https://www.rcsb.org/structure/5XF5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y0C", "url": "https://www.rcsb.org/structure/5Y0C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y0D", "url": "https://www.rcsb.org/structure/5Y0D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Z23", "url": "https://www.rcsb.org/structure/5Z23", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZBX", "url": "https://www.rcsb.org/structure/5ZBX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6A5L", "url": "https://www.rcsb.org/structure/6A5L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6A5O", "url": "https://www.rcsb.org/structure/6A5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6A5P", "url": "https://www.rcsb.org/structure/6A5P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6A5R", "url": "https://www.rcsb.org/structure/6A5R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6A5T", "url": "https://www.rcsb.org/structure/6A5T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6A5U", "url": "https://www.rcsb.org/structure/6A5U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ACL", "url": "https://www.rcsb.org/structure/6ACL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AEE", "url": "https://www.rcsb.org/structure/6AEE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BUZ", "url": "https://www.rcsb.org/structure/6BUZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6E0C", "url": "https://www.rcsb.org/structure/6E0C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6E0P", "url": "https://www.rcsb.org/structure/6E0P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HKT", "url": "https://www.rcsb.org/structure/6HKT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HTS", "url": "https://www.rcsb.org/structure/6HTS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6INQ", "url": "https://www.rcsb.org/structure/6INQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IPU", "url": "https://www.rcsb.org/structure/6IPU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IQ4", "url": "https://www.rcsb.org/structure/6IQ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IR9", "url": "https://www.rcsb.org/structure/6IR9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J4W", "url": "https://www.rcsb.org/structure/6J4W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J4X", "url": "https://www.rcsb.org/structure/6J4X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J4Y", "url": "https://www.rcsb.org/structure/6J4Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J4Z", "url": "https://www.rcsb.org/structure/6J4Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J50", "url": "https://www.rcsb.org/structure/6J50", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J51", "url": "https://www.rcsb.org/structure/6J51", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JR0", "url": "https://www.rcsb.org/structure/6JR0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JR1", "url": "https://www.rcsb.org/structure/6JR1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JXD", "url": "https://www.rcsb.org/structure/6JXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KE9", "url": "https://www.rcsb.org/structure/6KE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KXV", "url": "https://www.rcsb.org/structure/6KXV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L49", "url": "https://www.rcsb.org/structure/6L49", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L4A", "url": "https://www.rcsb.org/structure/6L4A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L9H", "url": "https://www.rcsb.org/structure/6L9H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L9Z", "url": "https://www.rcsb.org/structure/6L9Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LA2", "url": "https://www.rcsb.org/structure/6LA2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LA8", "url": "https://www.rcsb.org/structure/6LA8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LA9", "url": "https://www.rcsb.org/structure/6LA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LAB", "url": "https://www.rcsb.org/structure/6LAB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LE9", "url": "https://www.rcsb.org/structure/6LE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LER", "url": "https://www.rcsb.org/structure/6LER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M3V", "url": "https://www.rcsb.org/structure/6M3V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M44", "url": "https://www.rcsb.org/structure/6M44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O1D", "url": "https://www.rcsb.org/structure/6O1D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R8Y", "url": "https://www.rcsb.org/structure/6R8Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R8Z", "url": "https://www.rcsb.org/structure/6R8Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R90", "url": "https://www.rcsb.org/structure/6R90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R91", "url": "https://www.rcsb.org/structure/6R91", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R92", "url": "https://www.rcsb.org/structure/6R92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R93", "url": "https://www.rcsb.org/structure/6R93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R94", "url": "https://www.rcsb.org/structure/6R94", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T79", "url": "https://www.rcsb.org/structure/6T79", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T7A", "url": "https://www.rcsb.org/structure/6T7A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T7B", "url": "https://www.rcsb.org/structure/6T7B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T7C", "url": "https://www.rcsb.org/structure/6T7C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T7D", "url": "https://www.rcsb.org/structure/6T7D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T90", "url": "https://www.rcsb.org/structure/6T90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T93", "url": "https://www.rcsb.org/structure/6T93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6USJ", "url": "https://www.rcsb.org/structure/6USJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V2K", "url": "https://www.rcsb.org/structure/6V2K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V92", "url": "https://www.rcsb.org/structure/6V92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YOV", "url": "https://www.rcsb.org/structure/6YOV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BWD", "url": "https://www.rcsb.org/structure/7BWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BXT", "url": "https://www.rcsb.org/structure/7BXT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BY0", "url": "https://www.rcsb.org/structure/7BY0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7C0M", "url": "https://www.rcsb.org/structure/7C0M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CCQ", "url": "https://www.rcsb.org/structure/7CCQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CCR", "url": "https://www.rcsb.org/structure/7CCR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7COW", "url": "https://www.rcsb.org/structure/7COW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D1Z", "url": "https://www.rcsb.org/structure/7D1Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D20", "url": "https://www.rcsb.org/structure/7D20", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DBP", "url": "https://www.rcsb.org/structure/7DBP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K5X", "url": "https://www.rcsb.org/structure/7K5X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K5Y", "url": "https://www.rcsb.org/structure/7K5Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K60", "url": "https://www.rcsb.org/structure/7K60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K61", "url": "https://www.rcsb.org/structure/7K61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K63", "url": "https://www.rcsb.org/structure/7K63", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYA", "url": "https://www.rcsb.org/structure/7LYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYB", "url": "https://www.rcsb.org/structure/7LYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYC", "url": "https://www.rcsb.org/structure/7LYC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NL0", "url": "https://www.rcsb.org/structure/7NL0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PET", "url": "https://www.rcsb.org/structure/7PET", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEU", "url": "https://www.rcsb.org/structure/7PEU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEV", "url": "https://www.rcsb.org/structure/7PEV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEW", "url": "https://www.rcsb.org/structure/7PEW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEX", "url": "https://www.rcsb.org/structure/7PEX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEY", "url": "https://www.rcsb.org/structure/7PEY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEZ", "url": "https://www.rcsb.org/structure/7PEZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PF0", "url": "https://www.rcsb.org/structure/7PF0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PF2", "url": "https://www.rcsb.org/structure/7PF2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PF3", "url": "https://www.rcsb.org/structure/7PF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PF4", "url": "https://www.rcsb.org/structure/7PF4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PF5", "url": "https://www.rcsb.org/structure/7PF5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PF6", "url": "https://www.rcsb.org/structure/7PF6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFA", "url": "https://www.rcsb.org/structure/7PFA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFC", "url": "https://www.rcsb.org/structure/7PFC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFD", "url": "https://www.rcsb.org/structure/7PFD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFE", "url": "https://www.rcsb.org/structure/7PFE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFF", "url": "https://www.rcsb.org/structure/7PFF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFT", "url": "https://www.rcsb.org/structure/7PFT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFU", "url": "https://www.rcsb.org/structure/7PFU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFV", "url": "https://www.rcsb.org/structure/7PFV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFW", "url": "https://www.rcsb.org/structure/7PFW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFX", "url": "https://www.rcsb.org/structure/7PFX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SCY", "url": "https://www.rcsb.org/structure/7SCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SCZ", "url": "https://www.rcsb.org/structure/7SCZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V90", "url": "https://www.rcsb.org/structure/7V90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V96", "url": "https://www.rcsb.org/structure/7V96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V99", "url": "https://www.rcsb.org/structure/7V99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9C", "url": "https://www.rcsb.org/structure/7V9C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9J", "url": "https://www.rcsb.org/structure/7V9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9K", "url": "https://www.rcsb.org/structure/7V9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9S", "url": "https://www.rcsb.org/structure/7V9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VA4", "url": "https://www.rcsb.org/structure/7VA4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VCL", "url": "https://www.rcsb.org/structure/7VCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VZ4", "url": "https://www.rcsb.org/structure/7VZ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W9V", "url": "https://www.rcsb.org/structure/7W9V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WBV", "url": "https://www.rcsb.org/structure/7WBV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WBW", "url": "https://www.rcsb.org/structure/7WBW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WBX", "url": "https://www.rcsb.org/structure/7WBX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XCR", "url": "https://www.rcsb.org/structure/7XCR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XCT", "url": "https://www.rcsb.org/structure/7XCT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XD0", "url": "https://www.rcsb.org/structure/7XD0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XD1", "url": "https://www.rcsb.org/structure/7XD1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XSE", "url": "https://www.rcsb.org/structure/7XSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XSX", "url": "https://www.rcsb.org/structure/7XSX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XSZ", "url": "https://www.rcsb.org/structure/7XSZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XT7", "url": "https://www.rcsb.org/structure/7XT7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XTD", "url": "https://www.rcsb.org/structure/7XTD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XTI", "url": "https://www.rcsb.org/structure/7XTI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XVL", "url": "https://www.rcsb.org/structure/7XVL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XVM", "url": "https://www.rcsb.org/structure/7XVM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XX5", "url": "https://www.rcsb.org/structure/7XX5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XX6", "url": "https://www.rcsb.org/structure/7XX6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XX7", "url": "https://www.rcsb.org/structure/7XX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XZX", "url": "https://www.rcsb.org/structure/7XZX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XZY", "url": "https://www.rcsb.org/structure/7XZY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XZZ", "url": "https://www.rcsb.org/structure/7XZZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y00", "url": "https://www.rcsb.org/structure/7Y00", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y7I", "url": "https://www.rcsb.org/structure/7Y7I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZI4", "url": "https://www.rcsb.org/structure/7ZI4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8G57", "url": "https://www.rcsb.org/structure/8G57", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GRM", "url": "https://www.rcsb.org/structure/8GRM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0V", "url": "https://www.rcsb.org/structure/8H0V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0W", "url": "https://www.rcsb.org/structure/8H0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAG", "url": "https://www.rcsb.org/structure/8HAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAH", "url": "https://www.rcsb.org/structure/8HAH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAI", "url": "https://www.rcsb.org/structure/8HAI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAJ", "url": "https://www.rcsb.org/structure/8HAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAK", "url": "https://www.rcsb.org/structure/8HAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAL", "url": "https://www.rcsb.org/structure/8HAL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAM", "url": "https://www.rcsb.org/structure/8HAM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAN", "url": "https://www.rcsb.org/structure/8HAN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HE5", "url": "https://www.rcsb.org/structure/8HE5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HQY", "url": "https://www.rcsb.org/structure/8HQY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HR1", "url": "https://www.rcsb.org/structure/8HR1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8I17", "url": "https://www.rcsb.org/structure/8I17", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IEG", "url": "https://www.rcsb.org/structure/8IEG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IEJ", "url": "https://www.rcsb.org/structure/8IEJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JL9", "url": "https://www.rcsb.org/structure/8JL9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JLA", "url": "https://www.rcsb.org/structure/8JLA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JLB", "url": "https://www.rcsb.org/structure/8JLB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JLD", "url": "https://www.rcsb.org/structure/8JLD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OSJ", "url": "https://www.rcsb.org/structure/8OSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OSK", "url": "https://www.rcsb.org/structure/8OSK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OSL", "url": "https://www.rcsb.org/structure/8OSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OTS", "url": "https://www.rcsb.org/structure/8OTS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OTT", "url": "https://www.rcsb.org/structure/8OTT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00125", "url": "http://pfam.xfam.org/family/PF00125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16211", "url": "http://pfam.xfam.org/family/PF16211", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04908", "url": "https://pharos.nih.gov/targets/P04908", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P04908", "url": "http://purl.obolibrary.org/obo/PR_P04908", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-110329", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110329", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-110331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110331", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-171306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-171306", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9610379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003504", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04908-1", "url": "https://www.uniprot.org/uniprot/P04908-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130, "header": "sp|P04908-1|H2A1B_HUMAN Isoform 1 of Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2 CANONICAL=P04908-1" }, "isoforms": [ { "isoform_ac": "P04908-1", "url": "", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130, "header": "sp|P04908-1|H2A1B_HUMAN Isoform 1 of Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2 CANONICAL=P04908-1" }, "locus": { "chromosome": "6", "start_pos": 26033568, "end_pos": 26033179, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000615868.2", "url": "https://www.ensembl.org/id/ENST00000615868.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000483842.2", "url": "https://www.ensembl.org/id/ENSP00000483842.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P04908", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04908" }, { "id": "27615797", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27615797" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P04908", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908" }, { "id": "21045127", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21045127" }, { "id": "29084613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29084613" }, { "id": "21896475", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21896475" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" } ] } ], "phosphorylation": [ { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by DCAF1", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PRO", "id": "P04908", "url": "http://purl.obolibrary.org/obo/P04908" }, { "database": "PubMed", "id": "19965387", "url": "https://glygen.org/publication/PubMed/19965387" }, { "database": "PubMed", "id": "24140421", "url": "https://glygen.org/publication/PubMed/24140421" }, { "database": "PubMed", "id": "15078818", "url": "https://glygen.org/publication/PubMed/15078818" } ], "site_lbl": "Thr121" }, { "start_pos": 123, "end_pos": 123, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser123" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PRO", "id": "P04908", "url": "http://purl.obolibrary.org/obo/P04908" }, { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" }, { "database": "PubMed", "id": "15010469", "url": "https://glygen.org/publication/PubMed/15010469" }, { "database": "PubMed", "id": "11709551", "url": "https://glygen.org/publication/PubMed/11709551" } ], "site_lbl": "Ser2" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "hMSH5: a human MutS homologue that forms a novel heterodimer with hMSH4 and is expressed during spermatogenesis.", "journal": "Cancer research", "date": "1999", "authors": "Bocker T, Barusevicius A, Snowden T, Rasio D, Guerrette S, Robbins D, Schmidt C, Burczak J, Croce CM, Copeland T, Kovatich AJ, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10029069", "url": "https://glygen.org/publication/PubMed/10029069" } ] }, { "title": "p53- and ATM-dependent apoptosis induced by telomeres lacking TRF2.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Karlseder J, Broccoli D, Dai Y, Hardy S, de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "10037601", "url": "https://glygen.org/publication/PubMed/10037601" } ] }, { "title": "Identification of a new uracil-DNA glycosylase family by expression cloning using synthetic inhibitors.", "journal": "Current biology : CB", "date": "1999", "authors": "Haushalter KA, Todd Stukenberg MW, Kirschner MW, Verdine GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "10074426", "url": "https://glygen.org/publication/PubMed/10074426" } ] }, { "title": "Identification of Tcf4 residues involved in high-affinity beta-catenin binding.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Omer CA, Miller PJ, Diehl RE, Kral AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10080941", "url": "https://glygen.org/publication/PubMed/10080941" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.", "journal": "Blood", "date": "1999", "authors": "Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10233885", "url": "https://glygen.org/publication/PubMed/10233885" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is a potential retinoid target gene in acute promyelocytic leukemia treatment.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Park DJ, Chumakov AM, Vuong PT, Chih DY, Gombart AF, Miller WH Jr, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10330422", "url": "https://glygen.org/publication/PubMed/10330422" } ] }, { "title": "Oligomerization is required for p53 to be efficiently ubiquitinated by MDM2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10347217", "url": "https://glygen.org/publication/PubMed/10347217" } ] }, { "title": "Possible involvement of a novel STAM-associated molecule `AMSH` in intracellular signal transduction mediated by cytokines.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Tanaka N, Kaneko K, Asao H, Kasai H, Endo Y, Fujita T, Takeshita T, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "10383417", "url": "https://glygen.org/publication/PubMed/10383417" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "Serotonin-inducible transcription of interleukin-1alpha in uterine smooth muscle cells requires an AP-1 site: cloning and partial characterization of the rat IL-1alpha promoter.", "journal": "Molecular and cellular endocrinology", "date": "1999", "authors": "Huang TT, Vinci JM, Lan L, Jeffrey JJ, Wilcox BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10432220", "url": "https://glygen.org/publication/PubMed/10432220" } ] }, { "title": "Heteroduplex formation by human Rad51 protein: effects of DNA end-structure, hRP-A and hRad52.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Baumann P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10438626", "url": "https://glygen.org/publication/PubMed/10438626" } ] }, { "title": "Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases.", "journal": "Genomics", "date": "1999", "authors": "Baker RT, Wang XW, Woollatt E, White JA, Sutherland GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10444327", "url": "https://glygen.org/publication/PubMed/10444327" } ] }, { "title": "Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.", "journal": "Genes & development", "date": "1999", "authors": "Zhang Y, Ng HH, Erdjument-Bromage H, Tempst P, Bird A, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10444591", "url": "https://glygen.org/publication/PubMed/10444591" } ] }, { "title": "CoREST: a functional corepressor required for regulation of neural-specific gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Andres ME, Burger C, Peral-Rubio MJ, Battaglioli E, Anderson ME, Grimes J, Dallman J, Ballas N, Mandel G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10449787", "url": "https://glygen.org/publication/PubMed/10449787" } ] }, { "title": "MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex.", "journal": "Nature genetics", "date": "1999", "authors": "Ng HH, Zhang Y, Hendrich B, Johnson CA, Turner BM, Erdjument-Bromage H, Tempst P, Reinberg D, Bird A", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "10471499", "url": "https://glygen.org/publication/PubMed/10471499" } ] }, { "title": "A functional interaction between the histone deacetylase Rpd3 and the corepressor groucho in Drosophila development.", "journal": "Genes & development", "date": "1999", "authors": "Chen G, Fernandez J, Mische S, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10485845", "url": "https://glygen.org/publication/PubMed/10485845" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.", "journal": "Nature", "date": "1999", "authors": "Lukas C, Sorensen CS, Kramer E, Santoni-Rugiu E, Lindeneg C, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10548110", "url": "https://glygen.org/publication/PubMed/10548110" } ] }, { "title": "Recombinant human DNA (cytosine-5) methyltransferase. I. Expression, purification, and comparison of de novo and maintenance methylation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Pradhan S, Bacolla A, Wells RD, Roberts RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "10551868", "url": "https://glygen.org/publication/PubMed/10551868" } ] }, { "title": "The meiosis-specific recombinase hDmc1 forms ring structures and interacts with hRad51.", "journal": "The EMBO journal", "date": "1999", "authors": "Masson JY, Davies AA, Hajibagheri N, Van Dyck E, Benson FE, Stasiak AZ, Stasiak A, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10562567", "url": "https://glygen.org/publication/PubMed/10562567" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "A mechanism of repression by acute myeloid leukemia-1, the target of multiple chromosomal translocations in acute leukemia.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lutterbach B, Westendorf JJ, Linggi B, Isaac S, Seto E, Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "10617663", "url": "https://glygen.org/publication/PubMed/10617663" } ] }, { "title": "Control of human telomere length by TRF1 and TRF2.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Smogorzewska A, van Steensel B, Bianchi A, Oelmann S, Schaefer MR, Schnapp G, de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "10669743", "url": "https://glygen.org/publication/PubMed/10669743" } ] }, { "title": "Structural basis for recognition and repair of the endogenous mutagen 8-oxoguanine in DNA.", "journal": "Nature", "date": "2000", "authors": "Bruner SD, Norman DP, Verdine GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "10706276", "url": "https://glygen.org/publication/PubMed/10706276" } ] }, { "title": "Mdm2 is a RING finger-dependent ubiquitin protein ligase for itself and p53.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Fang S, Jensen JP, Ludwig RL, Vousden KH, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10722742", "url": "https://glygen.org/publication/PubMed/10722742" } ] }, { "title": "Association of the Bloom syndrome protein with topoisomerase IIIalpha in somatic and meiotic cells.", "journal": "Cancer research", "date": "2000", "authors": "Johnson FB, Lombard DB, Neff NF, Mastrangelo MA, Dewolf W, Ellis NA, Marciniak RA, Yin Y, Jaenisch R, Guarente L", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10728666", "url": "https://glygen.org/publication/PubMed/10728666" } ] }, { "title": "The Bloom's syndrome gene product interacts with topoisomerase III.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Wu L, Davies SL, North PS, Goulaouic H, Riou JF, Turley H, Gatter KC, Hickson ID", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10734115", "url": "https://glygen.org/publication/PubMed/10734115" } ] }, { "title": "Cloning and characterization of a novel human class I histone deacetylase that functions as a transcription repressor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hu E, Chen Z, Fredrickson T, Zhu Y, Kirkpatrick R, Zhang GF, Johanson K, Sung CM, Liu R, Winkler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10748112", "url": "https://glygen.org/publication/PubMed/10748112" } ] }, { "title": "The transcriptional coactivator CBP interacts with beta-catenin to activate gene expression.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Takemaru KI, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10769018", "url": "https://glygen.org/publication/PubMed/10769018" } ] }, { "title": "Immunolocalization of human p14(ARF) to the granular component of the interphase nucleolus.", "journal": "Experimental cell research", "date": "2000", "authors": "Lindstrom MS, Klangby U, Inoue R, Pisa P, Wiman KG, Asker CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10772813", "url": "https://glygen.org/publication/PubMed/10772813" } ] }, { "title": "The p300/CBP acetyltransferases function as transcriptional coactivators of beta-catenin in vertebrates.", "journal": "The EMBO journal", "date": "2000", "authors": "Hecht A, Vleminckx K, Stemmler MP, van Roy F, Kemler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10775268", "url": "https://glygen.org/publication/PubMed/10775268" } ] }, { "title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "10777502", "url": "https://glygen.org/publication/PubMed/10777502" } ] }, { "title": "A new human member of the MYST family of histone acetyl transferases with high sequence similarity to Drosophila MOF.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Neal KC, Pannuti A, Smith ER, Lucchesi JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "10786633", "url": "https://glygen.org/publication/PubMed/10786633" } ] }, { "title": "ATF-2 has intrinsic histone acetyltransferase activity which is modulated by phosphorylation.", "journal": "Nature", "date": "2000", "authors": "Kawasaki H, Schiltz L, Chiu R, Itakura K, Taira K, Nakatani Y, Yokoyama KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "10821277", "url": "https://glygen.org/publication/PubMed/10821277" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Groucho/TLE family proteins and transcriptional repression.", "journal": "Gene", "date": "2000", "authors": "Chen G, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10831834", "url": "https://glygen.org/publication/PubMed/10831834" } ] }, { "title": "c-Jun inhibits transforming growth factor beta-mediated transcription by repressing Smad3 transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Dennler S, Prunier C, Ferrand N, Gauthier JM, Atfi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10871633", "url": "https://glygen.org/publication/PubMed/10871633" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "Cell-cycle regulation, intracellular sorting and induced overexpression of the human NTH1 DNA glycosylase involved in removal of formamidopyrimidine residues from DNA.", "journal": "Mutation research", "date": "2000", "authors": "Luna L, Bjoras M, Hoff E, Rognes T, Seeberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "10882850", "url": "https://glygen.org/publication/PubMed/10882850" } ] }, { "title": "NuRD and SIN3 histone deacetylase complexes in development.", "journal": "Trends in genetics : TIG", "date": "2000", "authors": "Ahringer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10904264", "url": "https://glygen.org/publication/PubMed/10904264" } ] }, { "title": "Histone deacetylase inhibitors: inducers of differentiation or apoptosis of transformed cells.", "journal": "Journal of the National Cancer Institute", "date": "2000", "authors": "Marks PA, Richon VM, Rifkind RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10922406", "url": "https://glygen.org/publication/PubMed/10922406" } ] }, { "title": "Cloning and characterization of a novel human histone deacetylase, HDAC8.", "journal": "The Biochemical journal", "date": "2000", "authors": "Buggy JJ, Sideris ML, Mak P, Lorimer DD, McIntosh B, Clark JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10926844", "url": "https://glygen.org/publication/PubMed/10926844" } ] }, { "title": "MSH4 acts in conjunction with MLH1 during mammalian meiosis.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2000", "authors": "Santucci-Darmanin S, Walpita D, Lespinasse F, Desnuelle C, Ashley T, Paquis-Flucklinger V", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10928988", "url": "https://glygen.org/publication/PubMed/10928988" } ] }, { "title": "Biphasic kinetics of the human DNA repair protein MED1 (MBD4), a mismatch-specific DNA N-glycosylase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Petronzelli F, Riccio A, Markham GD, Seeholzer SH, Stoerker J, Genuardi M, Yeung AT, Matsumoto Y, Bellacosa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "10930409", "url": "https://glygen.org/publication/PubMed/10930409" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kato M, Miyazawa K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10982817", "url": "https://glygen.org/publication/PubMed/10982817" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Regulation of beta -catenin transformation by the p300 transcriptional coactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Sun Y, Kolligs FT, Hottiger MO, Mosavin R, Fearon ER, Nabel GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11050151", "url": "https://glygen.org/publication/PubMed/11050151" } ] }, { "title": "Investigation of the substrate spectrum of the human mismatch-specific DNA N-glycosylase MED1 (MBD4): fundamental role of the catalytic domain.", "journal": "Journal of cellular physiology", "date": "2000", "authors": "Petronzelli F, Riccio A, Markham GD, Seeholzer SH, Genuardi M, Karbowski M, Yeung AT, Matsumoto Y, Bellacosa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "11056019", "url": "https://glygen.org/publication/PubMed/11056019" } ] }, { "title": "Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity.", "journal": "The EMBO journal", "date": "2000", "authors": "Bauer A, Chauvet S, Huber O, Usseglio F, Rothbacher U, Aragnol D, Kemler R, Pradel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11080158", "url": "https://glygen.org/publication/PubMed/11080158" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Interleukin-6-induced tethering of STAT3 to the LAP/C/EBPbeta promoter suggests a new mechanism of transcriptional regulation by STAT3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Niehof M, Streetz K, Rakemann T, Bischoff SC, Manns MP, Horn F, Trautwein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11114305", "url": "https://glygen.org/publication/PubMed/11114305" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Crystal structure of a beta-catenin/Tcf complex.", "journal": "Cell", "date": "2000", "authors": "Graham TA, Weaver C, Mao F, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11136974", "url": "https://glygen.org/publication/PubMed/11136974" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Dominant-negative mutations of CEBPA, encoding CCAAT/enhancer binding protein-alpha (C/EBPalpha), in acute myeloid leukemia.", "journal": "Nature genetics", "date": "2001", "authors": "Pabst T, Mueller BU, Zhang P, Radomska HS, Narravula S, Schnittger S, Behre G, Hiddemann W, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11242107", "url": "https://glygen.org/publication/PubMed/11242107" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "The interacting domains of three MutL heterodimers in man: hMLH1 interacts with 36 homologous amino acid residues within hMLH3, hPMS1 and hPMS2.", "journal": "Nucleic acids research", "date": "2001", "authors": "Kondo E, Horii A, Fukushige S", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "11292842", "url": "https://glygen.org/publication/PubMed/11292842" } ] }, { "title": "A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Sorensen CS, Lukas C, Kramer ER, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11340163", "url": "https://glygen.org/publication/PubMed/11340163" } ] }, { "title": "c-Myc is a critical target for c/EBPalpha in granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Johansen LM, Iwama A, Lodie TA, Sasaki K, Felsher DW, Golub TR, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11340171", "url": "https://glygen.org/publication/PubMed/11340171" } ] }, { "title": "Methylation of histone H3 by coactivator-associated arginine methyltransferase 1.", "journal": "Biochemistry", "date": "2001", "authors": "Schurter BT, Koh SS, Chen D, Bunick GJ, Harp JM, Hanson BL, Henschen-Edman A, Mackay DR, Stallcup MR, Aswad DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11341840", "url": "https://glygen.org/publication/PubMed/11341840" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "CCAAT/enhancer-binding protein-alpha cooperates with p21 to inhibit cyclin-dependent kinase-2 activity and induces growth arrest independent of DNA binding.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harris TE, Albrecht JH, Nakanishi M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11369759", "url": "https://glygen.org/publication/PubMed/11369759" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1.", "journal": "Current biology : CB", "date": "2001", "authors": "Strahl BD, Briggs SD, Brame CJ, Caldwell JA, Koh SS, Ma H, Cook RG, Shabanowitz J, Hunt DF, Stallcup MR, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11448779", "url": "https://glygen.org/publication/PubMed/11448779" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Nuclear retention of ATM at sites of DNA double strand breaks.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Andegeko Y, Moyal L, Mittelman L, Tsarfaty I, Shiloh Y, Rotman G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "11454856", "url": "https://glygen.org/publication/PubMed/11454856" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "The SMRT and N-CoR corepressors are activating cofactors for histone deacetylase 3.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Guenther MG, Barak O, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11509652", "url": "https://glygen.org/publication/PubMed/11509652" } ] }, { "title": "The chromatin remodelling factor Brg-1 interacts with beta-catenin to promote target gene activation.", "journal": "The EMBO journal", "date": "2001", "authors": "Barker N, Hurlstone A, Musisi H, Miles A, Bienz M, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11532957", "url": "https://glygen.org/publication/PubMed/11532957" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "A novel active site-directed probe specific for deubiquitylating enzymes reveals proteasome association of USP14.", "journal": "The EMBO journal", "date": "2001", "authors": "Borodovsky A, Kessler BM, Casagrande R, Overkleeft HS, Wilkinson KD, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11566882", "url": "https://glygen.org/publication/PubMed/11566882" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "Histone H2AX is phosphorylated in an ATR-dependent manner in response to replicational stress.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ward IM, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "11673449", "url": "https://glygen.org/publication/PubMed/11673449" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.", "journal": "Molecular cell", "date": "2001", "authors": "Wang H, Iakova P, Wilde M, Welm A, Goode T, Roesler WJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11684017", "url": "https://glygen.org/publication/PubMed/11684017" } ] }, { "title": "Global regulation of post-translational modifications on core histones.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Galasinski SC, Louie DF, Gloor KK, Resing KA, Ahn NG", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" } ], "reference": [ { "type": "PubMed", "id": "11709551", "url": "https://glygen.org/publication/PubMed/11709551" } ] }, { "title": "Structure of a human Tcf4-beta-catenin complex.", "journal": "Nature structural biology", "date": "2001", "authors": "Poy F, Lepourcelet M, Shivdasani RA, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11713476", "url": "https://glygen.org/publication/PubMed/11713476" } ] }, { "title": "Isolation and characterization of a novel class II histone deacetylase, HDAC10.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fischer DD, Cai R, Bhatia U, Asselbergs FA, Song C, Terry R, Trogani N, Widmer R, Atadja P, Cohen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11739383", "url": "https://glygen.org/publication/PubMed/11739383" } ] }, { "title": "An immediate response of ribosomal transcription to growth factor stimulation in mammals is mediated by ERK phosphorylation of UBF.", "journal": "Molecular cell", "date": "2001", "authors": "Stefanovsky VY, Pelletier G, Hannan R, Gagnon-Kugler T, Rothblum LI, Moss T", "evidence": [ { "database": "Reactome", "id": "R-HSA-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728" } ], "reference": [ { "type": "PubMed", "id": "11741541", "url": "https://glygen.org/publication/PubMed/11741541" } ] }, { "title": "Valproic acid defines a novel class of HDAC inhibitors inducing differentiation of transformed cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Gottlicher M, Minucci S, Zhu P, Kramer OH, Schimpf A, Giavara S, Sleeman JP, Lo Coco F, Nervi C, Pelicci PG, Heinzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11742974", "url": "https://glygen.org/publication/PubMed/11742974" } ] }, { "title": "Hormone-dependent, CARM1-directed, arginine-specific methylation of histone H3 on a steroid-regulated promoter.", "journal": "Current biology : CB", "date": "2001", "authors": "Ma H, Baumann CT, Li H, Strahl BD, Rice R, Jelinek MA, Aswad DW, Allis CD, Hager GL, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11747826", "url": "https://glygen.org/publication/PubMed/11747826" } ] }, { "title": "Methylation at arginine 17 of histone H3 is linked to gene activation.", "journal": "EMBO reports", "date": "2002", "authors": "Bauer UM, Daujat S, Nielsen SJ, Nightingale K, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11751582", "url": "https://glygen.org/publication/PubMed/11751582" } ] }, { "title": "A novel WD repeat protein component of the methylosome binds Sm proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Friesen WJ, Wyce A, Paushkin S, Abel L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11756452", "url": "https://glygen.org/publication/PubMed/11756452" } ] }, { "title": "Nuclear import and export signals in control of the p53-related protein p73.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Inoue T, Stuart J, Leno R, Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "11847229", "url": "https://glygen.org/publication/PubMed/11847229" } ] }, { "title": "C/EBPalpha triggers proteasome-dependent degradation of cdk4 during growth arrest.", "journal": "The EMBO journal", "date": "2002", "authors": "Wang H, Goode T, Iakova P, Albrecht JH, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11867521", "url": "https://glygen.org/publication/PubMed/11867521" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "Identification and characterization of a human DNA glycosylase for repair of modified bases in oxidatively damaged DNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hazra TK, Izumi T, Boldogh I, Imhoff B, Kow YW, Jaruga P, Dizdaroglu M, Mitra S", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "11904416", "url": "https://glygen.org/publication/PubMed/11904416" } ] }, { "title": "Identification of mammalian Sds3 as an integral component of the Sin3/histone deacetylase corepressor complex.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Alland L, David G, Shen-Li H, Potes J, Muhle R, Lee HC, Hou H Jr, Chen K, DePinho RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11909966", "url": "https://glygen.org/publication/PubMed/11909966" } ] }, { "title": "Deubiquitination of p53 by HAUSP is an important pathway for p53 stabilization.", "journal": "Nature", "date": "2002", "authors": "Li M, Chen D, Shiloh A, Luo J, Nikolaev AY, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11923872", "url": "https://glygen.org/publication/PubMed/11923872" } ] }, { "title": "TCF: Lady Justice casting the final verdict on the outcome of Wnt signalling.", "journal": "Biological chemistry", "date": "2002", "authors": "Brantjes H, Barker N, van Es J, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11934263", "url": "https://glygen.org/publication/PubMed/11934263" } ] }, { "title": "Wnt/wingless signaling requires BCL9/legless-mediated recruitment of pygopus to the nuclear beta-catenin-TCF complex.", "journal": "Cell", "date": "2002", "authors": "Kramps T, Peter O, Brunner E, Nellen D, Froesch B, Chatterjee S, Murone M, Zullig S, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11955446", "url": "https://glygen.org/publication/PubMed/11955446" } ] }, { "title": "Acetylation of beta-catenin by CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wolf D, Rodova M, Miska EA, Calvet JP, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11973335", "url": "https://glygen.org/publication/PubMed/11973335" } ] }, { "title": "A new nuclear component of the Wnt signalling pathway.", "journal": "Nature cell biology", "date": "2002", "authors": "Thompson B, Townsley F, Rosin-Arbesfeld R, Musisi H, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11988739", "url": "https://glygen.org/publication/PubMed/11988739" } ] }, { "title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" } ] }, { "title": "PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.", "journal": "Molecular cell", "date": "2002", "authors": "Nishioka K, Rice JC, Sarma K, Erdjument-Bromage H, Werner J, Wang Y, Chuikov S, Valenzuela P, Tempst P, Steward R, Lis JT, Allis CD, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "12086618", "url": "https://glygen.org/publication/PubMed/12086618" } ] }, { "title": "Identification and characterization of a novel human DNA glycosylase for repair of cytosine-derived lesions.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hazra TK, Kow YW, Hatahet Z, Imhoff B, Boldogh I, Mokkapati SK, Mitra S, Izumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-110329", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110329" } ], "reference": [ { "type": "PubMed", "id": "12097317", "url": "https://glygen.org/publication/PubMed/12097317" } ] }, { "title": "Molecular interpretation of ERK signal duration by immediate early gene products.", "journal": "Nature cell biology", "date": "2002", "authors": "Murphy LO, Smith S, Chen RH, Fingar DC, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ] }, { "title": "Identification of 5-formyluracil DNA glycosylase activity of human hNTH1 protein.", "journal": "Nucleic acids research", "date": "2002", "authors": "Miyabe I, Zhang QM, Kino K, Sugiyama H, Takao M, Yasui A, Yonei S", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "12140329", "url": "https://glygen.org/publication/PubMed/12140329" } ] }, { "title": "pygopus Encodes a nuclear protein essential for wingless/Wnt signaling.", "journal": "Development (Cambridge, England)", "date": "2002", "authors": "Belenkaya TY, Han C, Standley HJ, Lin X, Houston DW, Heasman J, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "12163411", "url": "https://glygen.org/publication/PubMed/12163411" } ] }, { "title": "Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuura H, Nishitoh H, Takeda K, Matsuzawa A, Amagasa T, Ito M, Yoshioka K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12189133", "url": "https://glygen.org/publication/PubMed/12189133" } ] }, { "title": "Evidence of functional modulation of the MEKK/JNK/cJun signaling cascade by the low density lipoprotein receptor-related protein (LRP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lutz C, Nimpf J, Jenny M, Boecklinger K, Enzinger C, Utermann G, Baier-Bitterlich G, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12193592", "url": "https://glygen.org/publication/PubMed/12193592" } ] }, { "title": "Mitotic-specific methylation of histone H4 Lys 20 follows increased PR-Set7 expression and its localization to mitotic chromosomes.", "journal": "Genes & development", "date": "2002", "authors": "Rice JC, Nishioka K, Sarma K, Steward R, Reinberg D, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "12208845", "url": "https://glygen.org/publication/PubMed/12208845" } ] }, { "title": "Calreticulin interacts with C/EBPalpha and C/EBPbeta mRNAs and represses translation of C/EBP proteins.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Timchenko LT, Iakova P, Welm AL, Cai ZJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12242300", "url": "https://glygen.org/publication/PubMed/12242300" } ] }, { "title": "Role of histone H3 lysine 27 methylation in Polycomb-group silencing.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Cao R, Wang L, Wang H, Xia L, Erdjument-Bromage H, Tempst P, Jones RS, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "12351676", "url": "https://glygen.org/publication/PubMed/12351676" } ] }, { "title": "A cryptic protease couples deubiquitination and degradation by the proteasome.", "journal": "Nature", "date": "2002", "authors": "Yao T, Cohen RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "12353037", "url": "https://glygen.org/publication/PubMed/12353037" } ] }, { "title": "Human telomeric position effect is determined by chromosomal context and telomeric chromatin integrity.", "journal": "EMBO reports", "date": "2002", "authors": "Koering CE, Pollice A, Zibella MP, Bauwens S, Puisieux A, Brunori M, Brun C, Martins L, Sabatier L, Pulitzer JF, Gilson E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "12393752", "url": "https://glygen.org/publication/PubMed/12393752" } ] }, { "title": "The human and mouse replication-dependent histone genes.", "journal": "Genomics", "date": "2002", "authors": "Marzluff WF, Gongidi P, Woods KR, Jin J, Maltais LJ", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "12408966", "url": "https://glygen.org/publication/PubMed/12408966" } ] }, { "title": "CSB is a component of RNA pol I transcription.", "journal": "Molecular cell", "date": "2002", "authors": "Bradsher J, Auriol J, Proietti de Santis L, Iben S, Vonesch JL, Grummt I, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "12419226", "url": "https://glygen.org/publication/PubMed/12419226" } ] }, { "title": "Acetylation of p53 inhibits its ubiquitination by Mdm2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li M, Luo J, Brooks CL, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12421820", "url": "https://glygen.org/publication/PubMed/12421820" } ] }, { "title": "Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.", "journal": "Genes & development", "date": "2002", "authors": "Kuzmichev A, Nishioka K, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12435631", "url": "https://glygen.org/publication/PubMed/12435631" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "Mismatch repair in methylated DNA. Structure and activity of the mismatch-specific thymine glycosylase domain of methyl-CpG-binding protein MBD4.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu P, Qiu C, Sohail A, Zhang X, Bhagwat AS, Cheng X", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "12456671", "url": "https://glygen.org/publication/PubMed/12456671" } ] }, { "title": "The DNA methyltransferase-like protein DNMT3L stimulates de novo methylation by Dnmt3a.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Chedin F, Lieber MR, Hsieh CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "12481029", "url": "https://glygen.org/publication/PubMed/12481029" } ] }, { "title": "Molecular cloning and characterization of the GATA1 cofactor human FOG1 and assessment of its binding to GATA1 proteins carrying D218 substitutions.", "journal": "Human genetics", "date": "2003", "authors": "Freson K, Thys C, Wittewrongel C, Vermylen J, Hoylaerts MF, Van Geet C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12483298", "url": "https://glygen.org/publication/PubMed/12483298" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "A novel inducible transactivation domain in the androgen receptor: implications for PRK in prostate cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Metzger E, Muller JM, Ferrari S, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "12514133", "url": "https://glygen.org/publication/PubMed/12514133" } ] }, { "title": "DNA damage activates ATM through intermolecular autophosphorylation and dimer dissociation.", "journal": "Nature", "date": "2003", "authors": "Bakkenist CJ, Kastan MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "12556884", "url": "https://glygen.org/publication/PubMed/12556884" } ] }, { "title": "RUNX1 and GATA-1 coexpression and cooperation in megakaryocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Elagib KE, Racke FK, Mogass M, Khetawat R, Delehanty LL, Goldfarb AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12576332", "url": "https://glygen.org/publication/PubMed/12576332" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Rrn3 becomes inactivated in the process of ribosomal DNA transcription.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hirschler-Laszkiewicz I, Cavanaugh AH, Mirza A, Lun M, Hu Q, Smink T, Rothblum LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772" } ], "reference": [ { "type": "PubMed", "id": "12646563", "url": "https://glygen.org/publication/PubMed/12646563" } ] }, { "title": "Transcription activation function of C/EBPalpha is required for induction of granulocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Keeshan K, Santilli G, Corradini F, Perrotti D, Calabretta B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12702500", "url": "https://glygen.org/publication/PubMed/12702500" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "Mammalian 5-formyluracil-DNA glycosylase. 2. Role of SMUG1 uracil-DNA glycosylase in repair of 5-formyluracil and other oxidized and deaminated base lesions.", "journal": "Biochemistry", "date": "2003", "authors": "Masaoka A, Matsubara M, Hasegawa R, Tanaka T, Kurisu S, Terato H, Ohyama Y, Karino N, Matsuda A, Ide H", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "12718543", "url": "https://glygen.org/publication/PubMed/12718543" } ] }, { "title": "Identification and characterization of three new components of the mSin3A corepressor complex.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Fleischer TC, Yun UJ, Ayer DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12724404", "url": "https://glygen.org/publication/PubMed/12724404" } ] }, { "title": "Regulation of PRAK subcellular location by p38 MAP kinases.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "New L, Jiang Y, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12808055", "url": "https://glygen.org/publication/PubMed/12808055" } ] }, { "title": "Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Roux PP, Richards SA, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "12832467", "url": "https://glygen.org/publication/PubMed/12832467" } ] }, { "title": "Microtubule network facilitates nuclear targeting of human cytomegalovirus capsid.", "journal": "Journal of virology", "date": "2003", "authors": "Ogawa-Goto K, Tanaka K, Gibson W, Moriishi E, Miura Y, Kurata T, Irie S, Sata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "12857923", "url": "https://glygen.org/publication/PubMed/12857923" } ] }, { "title": "The amino terminal and E2F interaction domains are critical for C/EBP alpha-mediated induction of granulopoietic development of hematopoietic cells.", "journal": "Blood", "date": "2003", "authors": "D'Alo' F, Johansen LM, Nelson EA, Radomska HS, Evans EK, Zhang P, Nerlov C, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12869508", "url": "https://glygen.org/publication/PubMed/12869508" } ] }, { "title": "The ORC1 cycle in human cells: II. Dynamic changes in the human ORC complex during the cell cycle.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ohta S, Tatsumi Y, Fujita M, Tsurimoto T, Obuse C", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "12909626", "url": "https://glygen.org/publication/PubMed/12909626" } ] }, { "title": "CYLD is a deubiquitinating enzyme that negatively regulates NF-kappaB activation by TNFR family members.", "journal": "Nature", "date": "2003", "authors": "Trompouki E, Hatzivassiliou E, Tsichritzis T, Farmer H, Ashworth A, Mosialos G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917689", "url": "https://glygen.org/publication/PubMed/12917689" } ] }, { "title": "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination.", "journal": "Nature", "date": "2003", "authors": "Kovalenko A, Chable-Bessia C, Cantarella G, Israel A, Wallach D, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917691", "url": "https://glygen.org/publication/PubMed/12917691" } ] }, { "title": "The ATRX syndrome protein forms a chromatin-remodeling complex with Daxx and localizes in promyelocytic leukemia nuclear bodies.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Xue Y, Gibbons R, Yan Z, Yang D, McDowell TL, Sechi S, Qin J, Zhou S, Higgs D, Wang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "12953102", "url": "https://glygen.org/publication/PubMed/12953102" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "The GW182 protein colocalizes with mRNA degradation associated proteins hDcp1 and hLSm4 in cytoplasmic GW bodies.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Eystathioy T, Jakymiw A, Chan EK, Seraphin B, Cougot N, Fritzler MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "13130130", "url": "https://glygen.org/publication/PubMed/13130130" } ] }, { "title": "Expression of the MAPK kinases MKK-4 and MKK-7 in rheumatoid arthritis and their role as key regulators of JNK.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Sundarrajan M, Boyle DL, Chabaud-Riou M, Hammaker D, Firestein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "13130464", "url": "https://glygen.org/publication/PubMed/13130464" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "HdmX stimulates Hdm2-mediated ubiquitination and degradation of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Linares LK, Hengstermann A, Ciechanover A, Muller S, Scheffner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14507994", "url": "https://glygen.org/publication/PubMed/14507994" } ] }, { "title": "Restoration of C/EBPalpha expression in a BCR-ABL+ cell line induces terminal granulocytic differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tavor S, Park DJ, Gery S, Vuong PT, Gombart AF, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "14517214", "url": "https://glygen.org/publication/PubMed/14517214" } ] }, { "title": "EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Bracken AP, Pasini D, Capra M, Prosperini E, Colli E, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14532106", "url": "https://glygen.org/publication/PubMed/14532106" } ] }, { "title": "Requirement of the MRN complex for ATM activation by DNA damage.", "journal": "The EMBO journal", "date": "2003", "authors": "Uziel T, Lerenthal Y, Moyal L, Andegeko Y, Mittelman L, Shiloh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "14532133", "url": "https://glygen.org/publication/PubMed/14532133" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "Role of human ribosomal RNA (rRNA) promoter methylation and of methyl-CpG-binding protein MBD2 in the suppression of rRNA gene expression.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ghoshal K, Majumder S, Datta J, Motiwala T, Bai S, Sharma SM, Frankel W, Jacob ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "14610093", "url": "https://glygen.org/publication/PubMed/14610093" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "Two isoforms of otubain 1 regulate T cell anergy via GRAIL.", "journal": "Nature immunology", "date": "2004", "authors": "Soares L, Seroogy C, Skrenta H, Anandasabapathy N, Lovelace P, Chung CD, Engleman E, Fathman CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "14661020", "url": "https://glygen.org/publication/PubMed/14661020" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Identification of an autoregulatory feedback pathway involving interleukin-1alpha in induction of constitutive NF-kappaB activation in pancreatic cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Niu J, Li Z, Peng B, Chiao PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "14679213", "url": "https://glygen.org/publication/PubMed/14679213" } ] }, { "title": "TIP49 regulates beta-catenin-mediated neoplastic transformation and T-cell factor target gene induction via effects on chromatin remodeling.", "journal": "Cancer research", "date": "2003", "authors": "Feng Y, Lee N, Fearon ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "14695187", "url": "https://glygen.org/publication/PubMed/14695187" } ] }, { "title": "Mechanism of RNA polymerase I transcription.", "journal": "Advances in protein chemistry", "date": "2004", "authors": "Comai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772" } ], "reference": [ { "type": "PubMed", "id": "14969726", "url": "https://glygen.org/publication/PubMed/14969726" } ] }, { "title": "p53 regulates thymic Notch1 activation.", "journal": "European journal of immunology", "date": "2004", "authors": "Laws AM, Osborne BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "14991602", "url": "https://glygen.org/publication/PubMed/14991602" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Phosphorylation of histone H2A inhibits transcription on chromatin templates.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zhang Y, Griffin K, Mondal N, Parvin JD", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" } ], "reference": [ { "type": "PubMed", "id": "15010469", "url": "https://glygen.org/publication/PubMed/15010469" } ] }, { "title": "A dynamic role of HAUSP in the p53-Mdm2 pathway.", "journal": "Molecular cell", "date": "2004", "authors": "Li M, Brooks CL, Kon N, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15053880", "url": "https://glygen.org/publication/PubMed/15053880" } ] }, { "title": "Acetylation of beta-catenin by p300 regulates beta-catenin-Tcf4 interaction.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Levy L, Wei Y, Labalette C, Wu Y, Renard CA, Buendia MA, Neuveut C", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15060161", "url": "https://glygen.org/publication/PubMed/15060161" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "Direct activation of the ATM protein kinase by the Mre11/Rad50/Nbs1 complex.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Lee JH, Paull TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15064416", "url": "https://glygen.org/publication/PubMed/15064416" } ] }, { "title": "Nucleosomal histone kinase-1 phosphorylates H2A Thr 119 during mitosis in the early Drosophila embryo.", "journal": "Genes & development", "date": "2004", "authors": "Aihara H, Nakagawa T, Yasui K, Ohta T, Hirose S, Dhomae N, Takio K, Kaneko M, Takeshima Y, Muramatsu M, Ito T", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" } ], "reference": [ { "type": "PubMed", "id": "15078818", "url": "https://glygen.org/publication/PubMed/15078818" } ] }, { "title": "Different EZH2-containing complexes target methylation of histone H1 or nucleosomal histone H3.", "journal": "Molecular cell", "date": "2004", "authors": "Kuzmichev A, Jenuwein T, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "15099518", "url": "https://glygen.org/publication/PubMed/15099518" } ] }, { "title": "DNMT3L stimulates the DNA methylation activity of Dnmt3a and Dnmt3b through a direct interaction.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Suetake I, Shinozaki F, Miyagawa J, Takeshima H, Tajima S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "15105426", "url": "https://glygen.org/publication/PubMed/15105426" } ] }, { "title": "Groucho oligomerization is required for repression in vivo.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Song H, Hasson P, Paroush Z, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15121853", "url": "https://glygen.org/publication/PubMed/15121853" } ] }, { "title": "Cohesin component dynamics during meiotic prophase I in mammalian oocytes.", "journal": "Chromosome research : an international journal on the molecular, supramolecular and evolutionary aspects of chromosome biology", "date": "2004", "authors": "Prieto I, Tease C, Pezzi N, Buesa JM, Ortega S, Kremer L, Martinez A, Martinez-A C, Hulten MA, Barbero JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "15125634", "url": "https://glygen.org/publication/PubMed/15125634" } ] }, { "title": "Human meiotic recombinase Dmc1 promotes ATP-dependent homologous DNA strand exchange.", "journal": "Nature", "date": "2004", "authors": "Sehorn MG, Sigurdsson S, Bussen W, Unger VM, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "15164066", "url": "https://glygen.org/publication/PubMed/15164066" } ] }, { "title": "Female-specific features of recombinational double-stranded DNA repair in relation to synapsis and telomere dynamics in human oocytes.", "journal": "Chromosoma", "date": "2004", "authors": "Roig I, Liebe B, Egozcue J, Cabero L, Garcia M, Scherthan H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "15235794", "url": "https://glygen.org/publication/PubMed/15235794" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Catalysis and function of the p38 alpha.MK2a signaling complex.", "journal": "Biochemistry", "date": "2004", "authors": "Lukas SM, Kroe RR, Wildeson J, Peet GW, Frego L, Davidson W, Ingraham RH, Pargellis CA, Labadia ME, Werneburg BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15287722", "url": "https://glygen.org/publication/PubMed/15287722" } ] }, { "title": "Identification and in vivo role of the Armadillo-Legless interaction.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Hoffmans R, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15294866", "url": "https://glygen.org/publication/PubMed/15294866" } ] }, { "title": "hMSH4-hMSH5 recognizes Holliday Junctions and forms a meiosis-specific sliding clamp that embraces homologous chromosomes.", "journal": "Molecular cell", "date": "2004", "authors": "Snowden T, Acharya S, Butz C, Berardini M, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "15304223", "url": "https://glygen.org/publication/PubMed/15304223" } ] }, { "title": "Gene expression signatures identify rhabdomyosarcoma subtypes and detect a novel t(2;2)(q35;p23) translocation fusing PAX3 to NCOA1.", "journal": "Cancer research", "date": "2004", "authors": "Wachtel M, Dettling M, Koscielniak E, Stegmaier S, Treuner J, Simon-Klingenstein K, Buhlmann P, Niggli FK, Schafer BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "15313887", "url": "https://glygen.org/publication/PubMed/15313887" } ] }, { "title": "Oxidative DNA damage and disease: induction, repair and significance.", "journal": "Mutation research", "date": "2004", "authors": "Evans MD, Dizdaroglu M, Cooke MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "15341901", "url": "https://glygen.org/publication/PubMed/15341901" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Choreography of the DNA damage response: spatiotemporal relationships among checkpoint and repair proteins.", "journal": "Cell", "date": "2004", "authors": "Lisby M, Barlow JH, Burgess RC, Rothstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15369670", "url": "https://glygen.org/publication/PubMed/15369670" } ] }, { "title": "Mis16 and Mis18 are required for CENP-A loading and histone deacetylation at centromeres.", "journal": "Cell", "date": "2004", "authors": "Hayashi T, Fujita Y, Iwasaki O, Adachi Y, Takahashi K, Yanagida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "15369671", "url": "https://glygen.org/publication/PubMed/15369671" } ] }, { "title": "Role of histone H2A ubiquitination in Polycomb silencing.", "journal": "Nature", "date": "2004", "authors": "Wang H, Wang L, Erdjument-Bromage H, Vidal M, Tempst P, Jones RS, Zhang Y", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "15386022", "url": "https://glygen.org/publication/PubMed/15386022" } ] }, { "title": "Distribution and dynamics of chromatin modification induced by a defined DNA double-strand break.", "journal": "Current biology : CB", "date": "2004", "authors": "Shroff R, Arbel-Eden A, Pilch D, Ira G, Bonner WM, Petrini JH, Haber JE, Lichten M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15458641", "url": "https://glygen.org/publication/PubMed/15458641" } ] }, { "title": "Human SirT1 interacts with histone H1 and promotes formation of facultative heterochromatin.", "journal": "Molecular cell", "date": "2004", "authors": "Vaquero A, Scher M, Lee D, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359" } ], "reference": [ { "type": "PubMed", "id": "15469825", "url": "https://glygen.org/publication/PubMed/15469825" } ] }, { "title": "Activating mutations of NOTCH1 in human T cell acute lymphoblastic leukemia.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Weng AP, Ferrando AA, Lee W, Morris JP 4th, Silverman LB, Sanchez-Irizarry C, Blacklow SC, Look AT, Aster JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15472075", "url": "https://glygen.org/publication/PubMed/15472075" } ] }, { "title": "Human SWI/SNF-associated PRMT5 methylates histone H3 arginine 8 and negatively regulates expression of ST7 and NM23 tumor suppressor genes.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Pal S, Vishwanath SN, Erdjument-Bromage H, Tempst P, Sif S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "15485929", "url": "https://glygen.org/publication/PubMed/15485929" } ] }, { "title": "Autophosphorylation of ataxia-telangiectasia mutated is regulated by protein phosphatase 2A.", "journal": "The EMBO journal", "date": "2004", "authors": "Goodarzi AA, Jonnalagadda JC, Douglas P, Young D, Ye R, Moorhead GB, Lees-Miller SP, Khanna KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15510216", "url": "https://glygen.org/publication/PubMed/15510216" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Nuclear actin and myosin I are required for RNA polymerase I transcription.", "journal": "Nature cell biology", "date": "2004", "authors": "Philimonenko VV, Zhao J, Iben S, Dingova H, Kysela K, Kahle M, Zentgraf H, Hofmann WA, de Lanerolle P, Hozak P, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "15558034", "url": "https://glygen.org/publication/PubMed/15558034" } ] }, { "title": "MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Voncken JW, Niessen H, Neufeld B, Rennefahrt U, Dahlmans V, Kubben N, Holzer B, Ludwig S, Rapp UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15563468", "url": "https://glygen.org/publication/PubMed/15563468" } ] }, { "title": "Specific and potent RNAi in the nucleus of human cells.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Robb GB, Brown KM, Khurana J, Rana TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "15643423", "url": "https://glygen.org/publication/PubMed/15643423" } ] }, { "title": "The p400 E1A-associated protein is a novel component of the p53 --> p21 senescence pathway.", "journal": "Genes & development", "date": "2005", "authors": "Chan HM, Narita M, Lowe SW, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15655109", "url": "https://glygen.org/publication/PubMed/15655109" } ] }, { "title": "The ubiquitin-protein ligase Itch regulates p73 stability.", "journal": "The EMBO journal", "date": "2005", "authors": "Rossi M, De Laurenzi V, Munarriz E, Green DR, Liu YC, Vousden KH, Cesareni G, Melino G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "15678106", "url": "https://glygen.org/publication/PubMed/15678106" } ] }, { "title": "Molecular determinants of NOTCH4 transcription in vascular endothelium.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Wu J, Iwata F, Grass JA, Osborne CS, Elnitski L, Fraser P, Ohneda O, Yamamoto M, Bresnick EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15684396", "url": "https://glygen.org/publication/PubMed/15684396" } ] }, { "title": "Role of the RB1 family in stabilizing histone methylation at constitutive heterochromatin.", "journal": "Nature cell biology", "date": "2005", "authors": "Gonzalo S, Garcia-Cao M, Fraga MF, Schotta G, Peters AH, Cotter SE, Eguia R, Dean DC, Esteller M, Jenuwein T, Blasco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "15750587", "url": "https://glygen.org/publication/PubMed/15750587" } ] }, { "title": "Beta-catenin directly displaces Groucho/TLE repressors from Tcf/Lef in Wnt-mediated transcription activation.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Daniels DL, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15768032", "url": "https://glygen.org/publication/PubMed/15768032" } ] }, { "title": "Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.", "journal": "Genes & development", "date": "2005", "authors": "Tachibana M, Ueda J, Fukuda M, Takeda N, Ohta T, Iwanari H, Sakihama T, Kodama T, Hamakubo T, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "15774718", "url": "https://glygen.org/publication/PubMed/15774718" } ] }, { "title": "ATM activation by DNA double-strand breaks through the Mre11-Rad50-Nbs1 complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Lee JH, Paull TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "15790808", "url": "https://glygen.org/publication/PubMed/15790808" } ] }, { "title": "Deimination of histone H2A and H4 at arginine 3 in HL-60 granulocytes.", "journal": "Biochemistry", "date": "2005", "authors": "Hagiwara T, Hidaka Y, Yamada M", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "15823041", "url": "https://glygen.org/publication/PubMed/15823041" } ] }, { "title": "Transcriptional regulation of a metastasis suppressor gene by Tip60 and beta-catenin complexes.", "journal": "Nature", "date": "2005", "authors": "Kim JH, Kim B, Cai L, Choi HJ, Ohgi KA, Tran C, Chen C, Chung CH, Huber O, Rose DW, Sawyers CL, Rosenfeld MG, Baek SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15829968", "url": "https://glygen.org/publication/PubMed/15829968" } ] }, { "title": "Physical and functional interactions between the human DNMT3L protein and members of the de novo methyltransferase family.", "journal": "Journal of cellular biochemistry", "date": "2005", "authors": "Chen ZX, Mann JR, Hsieh CL, Riggs AD, Chedin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "15861382", "url": "https://glygen.org/publication/PubMed/15861382" } ] }, { "title": "Conserved docking site is essential for activation of mammalian MAP kinase kinases by specific MAP kinase kinase kinases.", "journal": "Molecular cell", "date": "2005", "authors": "Takekawa M, Tatebayashi K, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15866172", "url": "https://glygen.org/publication/PubMed/15866172" } ] }, { "title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2005", "authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "15867264", "url": "https://glygen.org/publication/PubMed/15867264" } ] }, { "title": "Loss of HAUSP-mediated deubiquitination contributes to DNA damage-induced destabilization of Hdmx and Hdm2.", "journal": "Molecular cell", "date": "2005", "authors": "Meulmeester E, Maurice MM, Boutell C, Teunisse AF, Ovaa H, Abraham TE, Dirks RW, Jochemsen AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15916963", "url": "https://glygen.org/publication/PubMed/15916963" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Pygopus and legless provide essential transcriptional coactivator functions to armadillo/beta-catenin.", "journal": "Current biology : CB", "date": "2005", "authors": "Hoffmans R, Stadeli R, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16005293", "url": "https://glygen.org/publication/PubMed/16005293" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.", "journal": "Human molecular genetics", "date": "2005", "authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16079151", "url": "https://glygen.org/publication/PubMed/16079151" } ] }, { "title": "LSD1 demethylates repressive histone marks to promote androgen-receptor-dependent transcription.", "journal": "Nature", "date": "2005", "authors": "Metzger E, Wissmann M, Yin N, Muller JM, Schneider R, Peters AH, Gunther T, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "16079795", "url": "https://glygen.org/publication/PubMed/16079795" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Temporal progression of recombination in human males.", "journal": "Molecular human reproduction", "date": "2005", "authors": "Oliver-Bonet M, Turek PJ, Sun F, Ko E, Martin RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "16123081", "url": "https://glygen.org/publication/PubMed/16123081" } ] }, { "title": "Deletion of gpUL132, a structural component of human cytomegalovirus, results in impaired virus replication in fibroblasts.", "journal": "Journal of virology", "date": "2005", "authors": "Spaderna S, Kropff B, Kodel Y, Shen S, Coley S, Lu S, Britt W, Mach M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "16140760", "url": "https://glygen.org/publication/PubMed/16140760" } ] }, { "title": "A role for the Tip60 histone acetyltransferase in the acetylation and activation of ATM.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Sun Y, Jiang X, Chen S, Fernandes N, Price BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16141325", "url": "https://glygen.org/publication/PubMed/16141325" } ] }, { "title": "Shelterin: the protein complex that shapes and safeguards human telomeres.", "journal": "Genes & development", "date": "2005", "authors": "de Lange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-171306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-171306" } ], "reference": [ { "type": "PubMed", "id": "16166375", "url": "https://glygen.org/publication/PubMed/16166375" } ] }, { "title": "Dissecting nuclear Wingless signalling: recruitment of the transcriptional co-activator Pygopus by a chain of adaptor proteins.", "journal": "Mechanisms of development", "date": "2005", "authors": "Stadeli R, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16169192", "url": "https://glygen.org/publication/PubMed/16169192" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "Microspherule protein 1, Mi-2beta, and RET finger protein associate in the nucleolus and up-regulate ribosomal gene transcription.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shimono K, Shimono Y, Shimokata K, Ishiguro N, Takahashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "16186106", "url": "https://glygen.org/publication/PubMed/16186106" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.", "journal": "Cellular signalling", "date": "2006", "authors": "Tzimas C, Michailidou G, Arsenakis M, Kieff E, Mosialos G, Hatzivassiliou EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16214042", "url": "https://glygen.org/publication/PubMed/16214042" } ] }, { "title": "Repair of formamidopyrimidines in DNA involves different glycosylases: role of the OGG1, NTH1, and NEIL1 enzymes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hu J, de Souza-Pinto NC, Haraguchi K, Hogue BA, Jaruga P, Greenberg MM, Dizdaroglu M, Bohr VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "16221681", "url": "https://glygen.org/publication/PubMed/16221681" } ] }, { "title": "Ubiquitination of p21Cip1/WAF1 by SCFSkp2: substrate requirement and ubiquitination site selection.", "journal": "Biochemistry", "date": "2005", "authors": "Wang W, Nacusi L, Sheaff RJ, Liu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16262255", "url": "https://glygen.org/publication/PubMed/16262255" } ] }, { "title": "A histone H3 methyltransferase controls epigenetic events required for meiotic prophase.", "journal": "Nature", "date": "2005", "authors": "Hayashi K, Yoshida K, Matsui Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "16292313", "url": "https://glygen.org/publication/PubMed/16292313" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Expression of the MutL homologue hMLH3 in human cells and its role in DNA mismatch repair.", "journal": "Cancer research", "date": "2005", "authors": "Cannavo E, Marra G, Sabates-Bellver J, Menigatti M, Lipkin SM, Fischer F, Cejka P, Jiricny J", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "16322221", "url": "https://glygen.org/publication/PubMed/16322221" } ] }, { "title": "Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells.", "journal": "Molecular cell", "date": "2005", "authors": "Nicke B, Bastien J, Khanna SJ, Warne PH, Cowling V, Cook SJ, Peters G, Delpuech O, Schulze A, Berns K, Mullenders J, Beijersbergen RL, Bernards R, Ganesan TS, Downward J, Hancock DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16337592", "url": "https://glygen.org/publication/PubMed/16337592" } ] }, { "title": "The Polycomb group protein EZH2 directly controls DNA methylation.", "journal": "Nature", "date": "2006", "authors": "Vire E, Brenner C, Deplus R, Blanchon L, Fraga M, Didelot C, Morey L, Van Eynde A, Bernard D, Vanderwinden JM, Bollen M, Esteller M, Di Croce L, de Launoit Y, Fuks F", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "16357870", "url": "https://glygen.org/publication/PubMed/16357870" } ] }, { "title": "Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing.", "journal": "Molecular cell", "date": "2005", "authors": "Cao R, Tsukada Y, Zhang Y", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "16359901", "url": "https://glygen.org/publication/PubMed/16359901" } ] }, { "title": "The antisense strand of small interfering RNAs directs histone methylation and transcriptional gene silencing in human cells.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Weinberg MS, Villeneuve LM, Ehsani A, Amarzguioui M, Aagaard L, Chen ZX, Riggs AD, Rossi JJ, Morris KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16373483", "url": "https://glygen.org/publication/PubMed/16373483" } ] }, { "title": "ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.", "journal": "Molecular cell", "date": "2006", "authors": "Doyon Y, Cayrou C, Ullah M, Landry AJ, Cote V, Selleck W, Lane WS, Tan S, Yang XJ, Cote J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "16387653", "url": "https://glygen.org/publication/PubMed/16387653" } ] }, { "title": "Substrate preferences of the EZH2 histone methyltransferase complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Martin C, Cao R, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "16431907", "url": "https://glygen.org/publication/PubMed/16431907" } ] }, { "title": "DNA damage signaling and p53-dependent senescence after prolonged beta-interferon stimulation.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Moiseeva O, Mallette FA, Mukhopadhyay UK, Moores A, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16436515", "url": "https://glygen.org/publication/PubMed/16436515" } ] }, { "title": "Precise characterization of human histones in the H2A gene family by top down mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Boyne MT 2nd, Pesavento JJ, Mizzen CA, Kelleher NL", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "16457589", "url": "https://glygen.org/publication/PubMed/16457589" } ] }, { "title": "The APC tumor suppressor counteracts beta-catenin activation and H3K4 methylation at Wnt target genes.", "journal": "Genes & development", "date": "2006", "authors": "Sierra J, Yoshida T, Joazeiro CA, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16510874", "url": "https://glygen.org/publication/PubMed/16510874" } ] }, { "title": "The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.", "journal": "EMBO reports", "date": "2006", "authors": "Percipalle P, Fomproix N, Cavellan E, Voit R, Reimer G, Kruger T, Thyberg J, Scheer U, Grummt I, Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "16514417", "url": "https://glygen.org/publication/PubMed/16514417" } ] }, { "title": "MicroRNA fingerprints during human megakaryocytopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16549775", "url": "https://glygen.org/publication/PubMed/16549775" } ] }, { "title": "A structural role for ATP in the formation and stability of the human origin recognition complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Ranjan A, Gossen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "16549788", "url": "https://glygen.org/publication/PubMed/16549788" } ] }, { "title": "Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.", "journal": "Cell", "date": "2006", "authors": "Whetstine JR, Nottke A, Lan F, Huarte M, Smolikov S, Chen Z, Spooner E, Li E, Zhang G, Colaiacovo M, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "16603238", "url": "https://glygen.org/publication/PubMed/16603238" } ] }, { "title": "The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cavellan E, Asp P, Percipalle P, Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "16603771", "url": "https://glygen.org/publication/PubMed/16603771" } ] }, { "title": "Notch 1 activation in the molecular pathogenesis of T-cell acute lymphoblastic leukaemia.", "journal": "Nature reviews. Cancer", "date": "2006", "authors": "Grabher C, von Boehmer H, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "16612405", "url": "https://glygen.org/publication/PubMed/16612405" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "The MAP kinase ERK5 binds to and phosphorylates p90 RSK.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Ranganathan A, Pearson GW, Chrestensen CA, Sturgill TW, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "16626623", "url": "https://glygen.org/publication/PubMed/16626623" } ] }, { "title": "Physical association of the patient-specific GATA1 mutants with RUNX1 in acute megakaryoblastic leukemia accompanying Down syndrome.", "journal": "Leukemia", "date": "2006", "authors": "Xu G, Kanezaki R, Toki T, Watanabe S, Takahashi Y, Terui K, Kitabayashi I, Ito E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "16628190", "url": "https://glygen.org/publication/PubMed/16628190" } ] }, { "title": "Parafibromin/Hyrax activates Wnt/Wg target gene transcription by direct association with beta-catenin/Armadillo.", "journal": "Cell", "date": "2006", "authors": "Mosimann C, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16630820", "url": "https://glygen.org/publication/PubMed/16630820" } ] }, { "title": "DNA damage triggers nucleotide excision repair-dependent monoubiquitylation of histone H2A.", "journal": "Genes & development", "date": "2006", "authors": "Bergink S, Salomons FA, Hoogstraten D, Groothuis TA, de Waard H, Wu J, Yuan L, Citterio E, Houtsmuller AB, Neefjes J, Hoeijmakers JH, Vermeulen W, Dantuma NP", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "16702407", "url": "https://glygen.org/publication/PubMed/16702407" } ] }, { "title": "Role of DNA methyltransferases in regulation of human ribosomal RNA gene transcription.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Majumder S, Ghoshal K, Datta J, Smith DS, Bai S, Jacob ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "16735507", "url": "https://glygen.org/publication/PubMed/16735507" } ] }, { "title": "C/EBPbeta is required for 'emergency' granulopoiesis.", "journal": "Nature immunology", "date": "2006", "authors": "Hirai H, Zhang P, Dayaram T, Hetherington CJ, Mizuno S, Imanishi J, Akashi K, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "16751774", "url": "https://glygen.org/publication/PubMed/16751774" } ] }, { "title": "Chromatin modifications by methylation and ubiquitination: implications in the regulation of gene expression.", "journal": "Annual review of biochemistry", "date": "2006", "authors": "Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16756492", "url": "https://glygen.org/publication/PubMed/16756492" } ] }, { "title": "Genetic analysis of human Orc2 reveals specific domains that are required in vivo for assembly and nuclear localization of the origin recognition complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Radichev I, Kwon SW, Zhao Y, DePamphilis ML, Vassilev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "16762929", "url": "https://glygen.org/publication/PubMed/16762929" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "Coupling mitochondrial respiratory chain to cell death: an essential role of mitochondrial complex I in the interferon-beta and retinoic acid-induced cancer cell death.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Huang G, Chen Y, Lu H, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16826196", "url": "https://glygen.org/publication/PubMed/16826196" } ] }, { "title": "Reconstitution and mechanism of the stimulation of de novo methylation by human DNMT3L.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kareta MS, Botello ZM, Ennis JJ, Chou C, Chedin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "16829525", "url": "https://glygen.org/publication/PubMed/16829525" } ] }, { "title": "Involvement of novel autophosphorylation sites in ATM activation.", "journal": "The EMBO journal", "date": "2006", "authors": "Kozlov SV, Graham ME, Peng C, Chen P, Robinson PJ, Lavin MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "16858402", "url": "https://glygen.org/publication/PubMed/16858402" } ] }, { "title": "A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response.", "journal": "Cell", "date": "2006", "authors": "Zhang D, Zaugg K, Mak TW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16901786", "url": "https://glygen.org/publication/PubMed/16901786" } ] }, { "title": "Proteasome recruitment and activation of the Uch37 deubiquitinating enzyme by Adrm1.", "journal": "Nature cell biology", "date": "2006", "authors": "Yao T, Song L, Xu W, DeMartino GN, Florens L, Swanson SK, Washburn MP, Conaway RC, Conaway JW, Cohen RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "16906146", "url": "https://glygen.org/publication/PubMed/16906146" } ] }, { "title": "Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kim DH, Villeneuve LM, Morris KV, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16936726", "url": "https://glygen.org/publication/PubMed/16936726" } ] }, { "title": "FOXO4 transcriptional activity is regulated by monoubiquitination and USP7/HAUSP.", "journal": "Nature cell biology", "date": "2006", "authors": "van der Horst A, de Vries-Smits AM, Brenkman AB, van Triest MH, van den Broek N, Colland F, Maurice MM, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16964248", "url": "https://glygen.org/publication/PubMed/16964248" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Crystal structure of a beta-catenin/BCL9/Tcf4 complex.", "journal": "Molecular cell", "date": "2006", "authors": "Sampietro J, Dahlberg CL, Cho US, Hinds TR, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17052462", "url": "https://glygen.org/publication/PubMed/17052462" } ] }, { "title": "LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.", "journal": "Nature medicine", "date": "2006", "authors": "Skokowa J, Cario G, Uenalan M, Schambach A, Germeshausen M, Battmer K, Zeidler C, Lehmann U, Eder M, Baum C, Grosschedl R, Stanulla M, Scherr M, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17063141", "url": "https://glygen.org/publication/PubMed/17063141" } ] }, { "title": "Small dsRNAs induce transcriptional activation in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Li LC, Okino ST, Zhao H, Pookot D, Place RF, Urakami S, Enokida H, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "17085592", "url": "https://glygen.org/publication/PubMed/17085592" } ] }, { "title": "hRpn13/ADRM1/GP110 is a novel proteasome subunit that binds the deubiquitinating enzyme, UCH37.", "journal": "The EMBO journal", "date": "2006", "authors": "Qiu XB, Ouyang SY, Li CJ, Miao S, Wang L, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "17139257", "url": "https://glygen.org/publication/PubMed/17139257" } ] }, { "title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17185360", "url": "https://glygen.org/publication/PubMed/17185360" } ] }, { "title": "Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1.", "journal": "Developmental cell", "date": "2007", "authors": "Fujita Y, Hayashi T, Kiyomitsu T, Toyoda Y, Kokubu A, Obuse C, Yanagida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "17199038", "url": "https://glygen.org/publication/PubMed/17199038" } ] }, { "title": "pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene.", "journal": "Genes & development", "date": "2007", "authors": "Kotake Y, Cao R, Viatour P, Sage J, Zhang Y, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17210787", "url": "https://glygen.org/publication/PubMed/17210787" } ] }, { "title": "Dimethyl sulfoxide to vorinostat: development of this histone deacetylase inhibitor as an anticancer drug.", "journal": "Nature biotechnology", "date": "2007", "authors": "Marks PA, Breslow R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "17211407", "url": "https://glygen.org/publication/PubMed/17211407" } ] }, { "title": "Histone arginine methylation regulates pluripotency in the early mouse embryo.", "journal": "Nature", "date": "2007", "authors": "Torres-Padilla ME, Parfitt DE, Kouzarides T, Zernicka-Goetz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17215844", "url": "https://glygen.org/publication/PubMed/17215844" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "Crystal structure of the p38 alpha-MAPKAP kinase 2 heterodimer.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "ter Haar E, Prabhakar P, Liu X, Lepre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17255097", "url": "https://glygen.org/publication/PubMed/17255097" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "The deubiquitinating enzyme USP2a regulates the p53 pathway by targeting Mdm2.", "journal": "The EMBO journal", "date": "2007", "authors": "Stevenson LF, Sparks A, Allende-Vega N, Xirodimas DP, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17290220", "url": "https://glygen.org/publication/PubMed/17290220" } ] }, { "title": "The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases.", "journal": "Cell", "date": "2007", "authors": "Iwase S, Lan F, Bayliss P, de la Torre-Ubieta L, Huarte M, Qi HH, Whetstine JR, Bonni A, Roberts TM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320160", "url": "https://glygen.org/publication/PubMed/17320160" } ] }, { "title": "RBP2 belongs to a family of demethylases, specific for tri-and dimethylated lysine 4 on histone 3.", "journal": "Cell", "date": "2007-03-23", "authors": "Christensen Jesper, Agger Karl, Cloos Paul A C, Pasini Diego, Rose Simon, Sennels Lau, Rappsilber Juri, Hansen Klaus H, Salcini Anna Elisabetta, Helin Kristian", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320161", "url": "https://glygen.org/publication/PubMed/17320161" } ] }, { "title": "The retinoblastoma binding protein RBP2 is an H3K4 demethylase.", "journal": "Cell", "date": "2007", "authors": "Klose RJ, Yan Q, Tothova Z, Yamane K, Erdjument-Bromage H, Tempst P, Gilliland DG, Zhang Y, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320163", "url": "https://glygen.org/publication/PubMed/17320163" } ] }, { "title": "Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.", "journal": "The EMBO journal", "date": "2007", "authors": "Dietrich N, Bracken AP, Trinh E, Schjerling CK, Koseki H, Rappsilber J, Helin K, Hansen KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17332741", "url": "https://glygen.org/publication/PubMed/17332741" } ] }, { "title": "Functional genomics identifies a Myb domain-containing protein family required for assembly of CENP-A chromatin.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Maddox PS, Hyndman F, Monen J, Oegema K, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "17339379", "url": "https://glygen.org/publication/PubMed/17339379" } ] }, { "title": "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.", "journal": "Genes & development", "date": "2007", "authors": "Bracken AP, Kleine-Kohlbrecher D, Dietrich N, Pasini D, Gargiulo G, Beekman C, Theilgaard-Monch K, Minucci S, Porse BT, Marine JC, Hansen KH, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17344414", "url": "https://glygen.org/publication/PubMed/17344414" } ] }, { "title": "Notch1 is a p53 target gene involved in human keratinocyte tumor suppression through negative regulation of ROCK1/2 and MRCKalpha kinases.", "journal": "Genes & development", "date": "2007", "authors": "Lefort K, Mandinova A, Ostano P, Kolev V, Calpini V, Kolfschoten I, Devgan V, Lieb J, Raffoul W, Hohl D, Neel V, Garlick J, Chiorino G, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17344417", "url": "https://glygen.org/publication/PubMed/17344417" } ] }, { "title": "Epigenetic disruption of ribosomal RNA genes and nucleolar architecture in DNA methyltransferase 1 (Dnmt1) deficient cells.", "journal": "Nucleic acids research", "date": "2007", "authors": "Espada J, Ballestar E, Santoro R, Fraga MF, Villar-Garea A, Nemeth A, Lopez-Serra L, Ropero S, Aranda A, Orozco H, Moreno V, Juarranz A, Stockert JC, Langst G, Grummt I, Bickmore W, Esteller M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "17355984", "url": "https://glygen.org/publication/PubMed/17355984" } ] }, { "title": "PLU-1 is an H3K4 demethylase involved in transcriptional repression and breast cancer cell proliferation.", "journal": "Molecular cell", "date": "2007", "authors": "Yamane K, Tateishi K, Klose RJ, Fang J, Fabrizio LA, Erdjument-Bromage H, Taylor-Papadimitriou J, Tempst P, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17363312", "url": "https://glygen.org/publication/PubMed/17363312" } ] }, { "title": "Molecular basis of MAPK-activated protein kinase 2:p38 assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "White A, Pargellis CA, Studts JM, Werneburg BG, Farmer BT 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17395714", "url": "https://glygen.org/publication/PubMed/17395714" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "Pygo1 and Pygo2 roles in Wnt signaling in mammalian kidney development.", "journal": "BMC biology", "date": "2007", "authors": "Schwab KR, Patterson LT, Hartman HA, Song N, Lang RA, Lin X, Potter SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17425782", "url": "https://glygen.org/publication/PubMed/17425782" } ] }, { "title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17428788", "url": "https://glygen.org/publication/PubMed/17428788" } ] }, { "title": "pygopus 2 has a crucial, Wnt pathway-independent function in lens induction.", "journal": "Development (Cambridge, England)", "date": "2007", "authors": "Song N, Schwab KR, Patterson LT, Yamaguchi T, Lin X, Potter SS, Lang RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17428831", "url": "https://glygen.org/publication/PubMed/17428831" } ] }, { "title": "Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.", "journal": "Nature", "date": "2007", "authors": "Stegmeier F, Rape M, Draviam VM, Nalepa G, Sowa ME, Ang XL, McDonald ER 3rd, Li MZ, Hannon GJ, Sorger PK, Kirschner MW, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17443180", "url": "https://glygen.org/publication/PubMed/17443180" } ] }, { "title": "Developmental phenotypes and reduced Wnt signaling in mice deficient for pygopus 2.", "journal": "Genesis (New York, N.Y. : 2000)", "date": "2007", "authors": "Li B, Rheaume C, Teng A, Bilanchone V, Munguia JE, Hu M, Jessen S, Piccolo S, Waterman ML, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17458864", "url": "https://glygen.org/publication/PubMed/17458864" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "Transcriptional activation of miR-34a contributes to p53-mediated apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Raver-Shapira N, Marciano E, Meiri E, Spector Y, Rosenfeld N, Moskovits N, Bentwich Z, Oren M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540598", "url": "https://glygen.org/publication/PubMed/17540598" } ] }, { "title": "Transactivation of miR-34a by p53 broadly influences gene expression and promotes apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Chang TC, Wentzel EA, Kent OA, Ramachandran K, Mullendore M, Lee KH, Feldmann G, Yamakuchi M, Ferlito M, Lowenstein CJ, Arking DE, Beer MA, Maitra A, Mendell JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540599", "url": "https://glygen.org/publication/PubMed/17540599" } ] }, { "title": "Interactions between human BRCA2 protein and the meiosis-specific recombinase DMC1.", "journal": "The EMBO journal", "date": "2007", "authors": "Thorslund T, Esashi F, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17541404", "url": "https://glygen.org/publication/PubMed/17541404" } ] }, { "title": "A microRNA component of the p53 tumour suppressor network.", "journal": "Nature", "date": "2007", "authors": "He L, He X, Lim LP, de Stanchina E, Xuan Z, Liang Y, Xue W, Zender L, Magnus J, Ridzon D, Jackson AL, Linsley PS, Chen C, Lowe SW, Cleary MA, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17554337", "url": "https://glygen.org/publication/PubMed/17554337" } ] }, { "title": "PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Yoshida H, Ichikawa H, Tagata Y, Katsumoto T, Ohnishi K, Akao Y, Naoe T, Pandolfi PP, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17562868", "url": "https://glygen.org/publication/PubMed/17562868" } ] }, { "title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.", "journal": "The EMBO journal", "date": "1991", "authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1756725", "url": "https://glygen.org/publication/PubMed/1756725" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "DNA methylation regulates MicroRNA expression.", "journal": "Cancer biology & therapy", "date": "2007", "authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17660710", "url": "https://glygen.org/publication/PubMed/17660710" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "UHRF1 plays a role in maintaining DNA methylation in mammalian cells.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Bostick M, Kim JK, Esteve PO, Clark A, Pradhan S, Jacobsen SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "17673620", "url": "https://glygen.org/publication/PubMed/17673620" } ] }, { "title": "Interactions and subcellular distribution of DNA replication initiation proteins in eukaryotic cells.", "journal": "Molecular genetics and genomics : MGG", "date": "2007", "authors": "Brand N, Faul T, Grummt F", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "17680271", "url": "https://glygen.org/publication/PubMed/17680271" } ] }, { "title": "Monitoring Notch1 activity in development: evidence for a feedback regulatory loop.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2007", "authors": "Del Monte G, Grego-Bessa J, Gonzalez-Rajal A, Bolos V, De La Pompa JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17685488", "url": "https://glygen.org/publication/PubMed/17685488" } ] }, { "title": "DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.", "journal": "Nature", "date": "2007", "authors": "Ooi SK, Qiu C, Bernstein E, Li K, Jia D, Yang Z, Erdjument-Bromage H, Tempst P, Lin SP, Allis CD, Cheng X, Bestor TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "17687327", "url": "https://glygen.org/publication/PubMed/17687327" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "MRE11-RAD50-NBS1 and ATM function as co-mediators of TRF1 in telomere length control.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Wu Y, Xiao S, Zhu XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "17694070", "url": "https://glygen.org/publication/PubMed/17694070" } ] }, { "title": "A histone H2A deubiquitinase complex coordinating histone acetylation and H1 dissociation in transcriptional regulation.", "journal": "Molecular cell", "date": "2007", "authors": "Zhu P, Zhou W, Wang J, Puc J, Ohgi KA, Erdjument-Bromage H, Tempst P, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "17707232", "url": "https://glygen.org/publication/PubMed/17707232" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "ATP-dependent assembly of the human origin recognition complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Siddiqui K, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "17716973", "url": "https://glygen.org/publication/PubMed/17716973" } ] }, { "title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17761849", "url": "https://glygen.org/publication/PubMed/17761849" } ] }, { "title": "Pro-inflammatory cytokines increase reactive oxygen species through mitochondria and NADPH oxidase in cultured RPE cells.", "journal": "Experimental eye research", "date": "2007", "authors": "Yang D, Elner SG, Bian ZM, Till GO, Petty HR, Elner VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17765224", "url": "https://glygen.org/publication/PubMed/17765224" } ] }, { "title": "MicroRNA-34b and MicroRNA-34c are targets of p53 and cooperate in control of cell proliferation and adhesion-independent growth.", "journal": "Cancer research", "date": "2007", "authors": "Corney DC, Flesken-Nikitin A, Godwin AK, Wang W, Nikitin AY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17823410", "url": "https://glygen.org/publication/PubMed/17823410" } ] }, { "title": "The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing.", "journal": "Cell", "date": "2007", "authors": "De Santa F, Totaro MG, Prosperini E, Notarbartolo S, Testa G, Natoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17825402", "url": "https://glygen.org/publication/PubMed/17825402" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Fbw7 and Usp28 regulate myc protein stability in response to DNA damage.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Popov N, Herold S, Llamazares M, Schulein C, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17873522", "url": "https://glygen.org/publication/PubMed/17873522" } ] }, { "title": "Targeted deletion of the mitogen-activated protein kinase kinase 4 gene in the nervous system causes severe brain developmental defects and premature death.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Wang X, Nadarajah B, Robinson AC, McColl BW, Jin JW, Dajas-Bailador F, Boot-Handford RP, Tournier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17875933", "url": "https://glygen.org/publication/PubMed/17875933" } ] }, { "title": "Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.", "journal": "Nature", "date": "2007", "authors": "Guccione E, Bassi C, Casadio F, Martinato F, Cesaroni M, Schuchlautz H, Luscher B, Amati B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17898714", "url": "https://glygen.org/publication/PubMed/17898714" } ] }, { "title": "DNA damage-induced acetylation of lysine 3016 of ATM activates ATM kinase activity.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Sun Y, Xu Y, Roy K, Price BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "17923702", "url": "https://glygen.org/publication/PubMed/17923702" } ] }, { "title": "Human CtIP promotes DNA end resection.", "journal": "Nature", "date": "2007", "authors": "Sartori AA, Lukas C, Coates J, Mistrik M, Fu S, Bartek J, Baer R, Lukas J, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17965729", "url": "https://glygen.org/publication/PubMed/17965729" } ] }, { "title": "hMSH4-hMSH5 adenosine nucleotide processing and interactions with homologous recombination machinery.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Snowden T, Shim KS, Schmutte C, Acharya S, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17977839", "url": "https://glygen.org/publication/PubMed/17977839" } ] }, { "title": "Human USP3 is a chromatin modifier required for S phase progression and genome stability.", "journal": "Current biology : CB", "date": "2007", "authors": "Nicassio F, Corrado N, Vissers JH, Areces LB, Bergink S, Marteijn JA, Geverts B, Houtsmuller AB, Vermeulen W, Di Fiore PP, Citterio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17980597", "url": "https://glygen.org/publication/PubMed/17980597" } ] }, { "title": "Regulation of early wave of germ cell apoptosis and spermatogenesis by deubiquitinating enzyme CYLD.", "journal": "Developmental cell", "date": "2007", "authors": "Wright A, Reiley WW, Chang M, Jin W, Lee AJ, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17981138", "url": "https://glygen.org/publication/PubMed/17981138" } ] }, { "title": "Analysis of replication protein A (RPA) in human spermatogenesis.", "journal": "Molecular human reproduction", "date": "2007", "authors": "Oliver-Bonet M, Campillo M, Turek PJ, Ko E, Martin RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17981954", "url": "https://glygen.org/publication/PubMed/17981954" } ] }, { "title": "RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.", "journal": "Cell", "date": "2007", "authors": "Mailand N, Bekker-Jensen S, Faustrup H, Melander F, Bartek J, Lukas C, Lukas J", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "18001824", "url": "https://glygen.org/publication/PubMed/18001824" } ] }, { "title": "RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.", "journal": "Cell", "date": "2007", "authors": "Huen MS, Grant R, Manke I, Minn K, Yu X, Yaffe MB, Chen J", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "18001825", "url": "https://glygen.org/publication/PubMed/18001825" } ] }, { "title": "Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Hong S, Cho YW, Yu LR, Yu H, Veenstra TD, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "18003914", "url": "https://glygen.org/publication/PubMed/18003914" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.", "journal": "Nature cell biology", "date": "2008", "authors": "Metzger E, Yin N, Wissmann M, Kunowska N, Fischer K, Friedrichs N, Patnaik D, Higgins JM, Potier N, Scheidtmann KH, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "18066052", "url": "https://glygen.org/publication/PubMed/18066052" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.", "journal": "Genes & development", "date": "2007", "authors": "Hyllus D, Stein C, Schnabel K, Schiltz E, Imhof A, Dou Y, Hsieh J, Bauer UM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18079182", "url": "https://glygen.org/publication/PubMed/18079182" } ] }, { "title": "Wingless signaling induces widespread chromatin remodeling of target loci.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Parker DS, Ni YY, Chang JL, Li J, Cadigan KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18160704", "url": "https://glygen.org/publication/PubMed/18160704" } ] }, { "title": "Deubiquitylation of histone H2A activates transcriptional initiation via trans-histone cross-talk with H3K4 di- and trimethylation.", "journal": "Genes & development", "date": "2008", "authors": "Nakagawa T, Kajitani T, Togo S, Masuko N, Ohdan H, Hishikawa Y, Koji T, Matsuyama T, Ikura T, Muramatsu M, Ito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18172164", "url": "https://glygen.org/publication/PubMed/18172164" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Entry route of HCMV into endothelial cells.", "journal": "Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology", "date": "2008", "authors": "Sinzger C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18203656", "url": "https://glygen.org/publication/PubMed/18203656" } ] }, { "title": "Loss of RB1 induces non-proliferative retinoma: increasing genomic instability correlates with progression to retinoblastoma.", "journal": "Human molecular genetics", "date": "2008", "authors": "Dimaras H, Khetan V, Halliday W, Orlic M, Prigoda NL, Piovesan B, Marrano P, Corson TW, Eagle RC Jr, Squire JA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18211953", "url": "https://glygen.org/publication/PubMed/18211953" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Aberrant promoter methylation and tumor suppressive activity of the DFNA5 gene in colorectal carcinoma.", "journal": "Oncogene", "date": "2008", "authors": "Kim MS, Chang X, Yamashita K, Nagpal JK, Baek JH, Wu G, Trink B, Ratovitski EA, Mori M, Sidransky D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "18223688", "url": "https://glygen.org/publication/PubMed/18223688" } ] }, { "title": "MicroRNA-373 induces expression of genes with complementary promoter sequences.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Place RF, Li LC, Pookot D, Noonan EJ, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18227514", "url": "https://glygen.org/publication/PubMed/18227514" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Formation and branch migration of Holliday junctions mediated by eukaryotic recombinases.", "journal": "Nature", "date": "2008", "authors": "Murayama Y, Kurokawa Y, Mayanagi K, Iwasaki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "18256600", "url": "https://glygen.org/publication/PubMed/18256600" } ] }, { "title": "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.", "journal": "Cell", "date": "2008", "authors": "Wajapeyee N, Serra RW, Zhu X, Mahalingam M, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18267069", "url": "https://glygen.org/publication/PubMed/18267069" } ] }, { "title": "Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.", "journal": "Molecular cell", "date": "2008", "authors": "Levy D, Adamovich Y, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "18280240", "url": "https://glygen.org/publication/PubMed/18280240" } ] }, { "title": "Cytosine methylation: remaining faithful.", "journal": "Current biology : CB", "date": "2008", "authors": "Ooi SK, Bestor TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "18302924", "url": "https://glygen.org/publication/PubMed/18302924" } ] }, { "title": "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity.", "journal": "Genes & development", "date": "2008", "authors": "Zhao X, Jankovic V, Gural A, Huang G, Pardanani A, Menendez S, Zhang J, Dunne R, Xiao A, Erdjument-Bromage H, Allis CD, Tempst P, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "18316480", "url": "https://glygen.org/publication/PubMed/18316480" } ] }, { "title": "TAN-1, the human homolog of the Drosophila notch gene, is broken by chromosomal translocations in T lymphoblastic neoplasms.", "journal": "Cell", "date": "1991", "authors": "Ellisen LW, Bird J, West DC, Soreng AL, Reynolds TC, Smith SD, Sklar J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "1831692", "url": "https://glygen.org/publication/PubMed/1831692" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "Methylation of the DFNA5 increases risk of lymph node metastasis in human breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Kim MS, Lebron C, Nagpal JK, Chae YK, Chang X, Huang Y, Chuang T, Yamashita K, Trink B, Ratovitski EA, Califano JA, Sidransky D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "18346456", "url": "https://glygen.org/publication/PubMed/18346456" } ] }, { "title": "Cell-type-specific function of BCL9 involves a transcriptional activation domain that synergizes with beta-catenin.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Sustmann C, Flach H, Ebert H, Eastman Q, Grosschedl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18347063", "url": "https://glygen.org/publication/PubMed/18347063" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "p16(INK4a) translation suppressed by miR-24.", "journal": "PloS one", "date": "2008", "authors": "Lal A, Kim HH, Abdelmohsen K, Kuwano Y, Pullmann R Jr, Srikantan S, Subrahmanyam R, Martindale JL, Yang X, Ahmed F, Navarro F, Dykxhoorn D, Lieberman J, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18365017", "url": "https://glygen.org/publication/PubMed/18365017" } ] }, { "title": "RBF1 promotes chromatin condensation through a conserved interaction with the Condensin II protein dCAP-D3.", "journal": "Genes & development", "date": "2008", "authors": "Longworth MS, Herr A, Ji JY, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18367646", "url": "https://glygen.org/publication/PubMed/18367646" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "Molecular basis of histone H3K4me3 recognition by ING4.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Palacios A, Munoz IG, Pantoja-Uceda D, Marcaida MJ, Torres D, Martin-Garcia JM, Luque I, Montoya G, Blanco FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "18381289", "url": "https://glygen.org/publication/PubMed/18381289" } ] }, { "title": "The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.", "journal": "EMBO reports", "date": "2008", "authors": "Lacroix M, El Messaoudi S, Rodier G, Le Cam A, Sardet C, Fabbrizio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18404153", "url": "https://glygen.org/publication/PubMed/18404153" } ] }, { "title": "Pygopus and the Wnt signaling pathway: a diverse set of connections.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2008", "authors": "Jessen S, Gu B, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18404694", "url": "https://glygen.org/publication/PubMed/18404694" } ] }, { "title": "Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartupee J, Li X, Hamilton T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18411265", "url": "https://glygen.org/publication/PubMed/18411265" } ] }, { "title": "HP1-beta mobilization promotes chromatin changes that initiate the DNA damage response.", "journal": "Nature", "date": "2008", "authors": "Ayoub N, Jeyasekharan AD, Bernal JA, Venkitaraman AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "18438399", "url": "https://glygen.org/publication/PubMed/18438399" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Regulation of IkappaB kinase-related kinases and antiviral responses by tumor suppressor CYLD.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhang M, Wu X, Lee AJ, Jin W, Chang M, Wright A, Imaizumi T, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18467330", "url": "https://glygen.org/publication/PubMed/18467330" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Epigenetic control of rDNA loci in response to intracellular energy status.", "journal": "Cell", "date": "2008", "authors": "Murayama A, Ohmori K, Fujimura A, Minami H, Yasuzawa-Tanaka K, Kuroda T, Oie S, Daitoku H, Okuwaki M, Nagata K, Fukamizu A, Kimura K, Shimizu T, Yanagisawa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359" } ], "reference": [ { "type": "PubMed", "id": "18485871", "url": "https://glygen.org/publication/PubMed/18485871" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.", "journal": "Nature", "date": "2008", "authors": "Schreiner P, Chen X, Husnjak K, Randles L, Zhang N, Elsasser S, Finley D, Dikic I, Walters KJ, Groll M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "18497827", "url": "https://glygen.org/publication/PubMed/18497827" } ] }, { "title": "Decoding of methylated histone H3 tail by the Pygo-BCL9 Wnt signaling complex.", "journal": "Molecular cell", "date": "2008", "authors": "Fiedler M, Sanchez-Barrena MJ, Nekrasov M, Mieszczanek J, Rybin V, Muller J, Evans P, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18498752", "url": "https://glygen.org/publication/PubMed/18498752" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "A comparative analysis of Dmc1 and Rad51 nucleoprotein filaments.", "journal": "Nucleic acids research", "date": "2008", "authors": "Sheridan SD, Yu X, Roth R, Heuser JE, Sehorn MG, Sung P, Egelman EH, Bishop DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "18535008", "url": "https://glygen.org/publication/PubMed/18535008" } ] }, { "title": "Tegument proteins of human cytomegalovirus.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2008", "authors": "Kalejta RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18535146", "url": "https://glygen.org/publication/PubMed/18535146" } ] }, { "title": "Chemokine signaling via the CXCR2 receptor reinforces senescence.", "journal": "Cell", "date": "2008", "authors": "Acosta JC, O'Loghlen A, Banito A, Guijarro MV, Augert A, Raguz S, Fumagalli M, Da Costa M, Brown C, Popov N, Takatsu Y, Melamed J, d'Adda di Fagagna F, Bernard D, Hernando E, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555777", "url": "https://glygen.org/publication/PubMed/18555777" } ] }, { "title": "Oncogene-induced senescence relayed by an interleukin-dependent inflammatory network.", "journal": "Cell", "date": "2008", "authors": "Kuilman T, Michaloglou C, Vredeveld LC, Douma S, van Doorn R, Desmet CJ, Aarden LA, Mooi WJ, Peeper DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555778", "url": "https://glygen.org/publication/PubMed/18555778" } ] }, { "title": "The crystal structure of the ING5 PHD finger in complex with an H3K4me3 histone peptide.", "journal": "Proteins", "date": "2008", "authors": "Champagne KS, Saksouk N, Pena PV, Johnson K, Ullah M, Yang XJ, Cote J, Kutateladze TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "18623064", "url": "https://glygen.org/publication/PubMed/18623064" } ] }, { "title": "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18632802", "url": "https://glygen.org/publication/PubMed/18632802" } ] }, { "title": "The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.", "journal": "EMBO reports", "date": "2008", "authors": "Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18636086", "url": "https://glygen.org/publication/PubMed/18636086" } ] }, { "title": "Truncated Cockayne syndrome B protein represses elongation by RNA polymerase I.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Lebedev A, Scharffetter-Kochanek K, Iben S", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "18656484", "url": "https://glygen.org/publication/PubMed/18656484" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "A regulatory circuit controlling Itch-mediated p73 degradation by Runx.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Levy D, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "18701449", "url": "https://glygen.org/publication/PubMed/18701449" } ] }, { "title": "Microcephalin/MCPH1 associates with the Condensin II complex to function in homologous recombination repair.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wood JL, Liang Y, Li K, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18718915", "url": "https://glygen.org/publication/PubMed/18718915" } ] }, { "title": "Structural basis for specific cleavage of Lys 63-linked polyubiquitin chains.", "journal": "Nature", "date": "2008", "authors": "Sato Y, Yoshikawa A, Yamagata A, Mimura H, Yamashita M, Ookata K, Nureki O, Iwai K, Komada M, Fukai S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "18758443", "url": "https://glygen.org/publication/PubMed/18758443" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Structural basis for recognition of hemi-methylated DNA by the SRA domain of human UHRF1.", "journal": "Nature", "date": "2008", "authors": "Avvakumov GV, Walker JR, Xue S, Li Y, Duan S, Bronner C, Arrowsmith CH, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "18772889", "url": "https://glygen.org/publication/PubMed/18772889" } ] }, { "title": "C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.", "journal": "Oncogene", "date": "2008", "authors": "Matsushita H, Nakajima H, Nakamura Y, Tsukamoto H, Tanaka Y, Jin G, Yabe M, Asai S, Ono R, Nosaka T, Sugita K, Morimoto A, Hayashi Y, Hotta T, Ando K, Miyachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "18776924", "url": "https://glygen.org/publication/PubMed/18776924" } ] }, { "title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Yekta S, Tabin CJ, Bartel DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "18781158", "url": "https://glygen.org/publication/PubMed/18781158" } ] }, { "title": "c-Jun expression, activation and function in neural cell death, inflammation and repair.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Raivich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Fluorescence correlation spectroscopy and fluorescence cross-correlation spectroscopy reveal the cytoplasmic origination of loaded nuclear RISC in vivo in human cells.", "journal": "Nucleic acids research", "date": "2008", "authors": "Ohrt T, Mutze J, Staroske W, Weinmann L, Hock J, Crell K, Meister G, Schwille P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18842624", "url": "https://glygen.org/publication/PubMed/18842624" } ] }, { "title": "MicroRNA-directed transcriptional gene silencing in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Kim DH, Saetrom P, Snove O Jr, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18852463", "url": "https://glygen.org/publication/PubMed/18852463" } ] }, { "title": "Structure and hemimethylated CpG binding of the SRA domain from human UHRF1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Qian C, Li S, Jakoncic J, Zeng L, Walsh MJ, Zhou MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "18945682", "url": "https://glygen.org/publication/PubMed/18945682" } ] }, { "title": "Polycomb proteins targeted by a short repeat RNA to the mouse X chromosome.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Zhao J, Sun BK, Erwin JA, Song JJ, Lee JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "18974356", "url": "https://glygen.org/publication/PubMed/18974356" } ] }, { "title": "Molecular characterization of human Argonaute-containing ribonucleoprotein complexes and their bound target mRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2008", "authors": "Landthaler M, Gaidatzis D, Rothballer A, Chen PY, Soll SJ, Dinic L, Ojo T, Hafner M, Zavolan M, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18978028", "url": "https://glygen.org/publication/PubMed/18978028" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "USP19 deubiquitinating enzyme supports cell proliferation by stabilizing KPC1, a ubiquitin ligase for p27Kip1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Lu Y, Adegoke OA, Nepveu A, Nakayama KI, Bedard N, Cheng D, Peng J, Wing SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19015242", "url": "https://glygen.org/publication/PubMed/19015242" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms.", "journal": "Molecular cell", "date": "2008", "authors": "Margueron R, Li G, Sarma K, Blais A, Zavadil J, Woodcock CL, Dynlacht BD, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "19026781", "url": "https://glygen.org/publication/PubMed/19026781" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "A regulatory interplay between miR-27a and Runx1 during megakaryopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ben-Ami O, Pencovich N, Lotem J, Levanon D, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19114653", "url": "https://glygen.org/publication/PubMed/19114653" } ] }, { "title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.", "journal": "Journal of cellular biochemistry", "date": "2009", "authors": "Fernandez CC, Gudas LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19115252", "url": "https://glygen.org/publication/PubMed/19115252" } ] }, { "title": "FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.", "journal": "Cell", "date": "2009", "authors": "Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19135894", "url": "https://glygen.org/publication/PubMed/19135894" } ] }, { "title": "ATR, BRCA1 and gammaH2AX localize to unsynapsed chromosomes at the pachytene stage in human oocytes.", "journal": "Reproductive biomedicine online", "date": "2009", "authors": "Garcia-Cruz R, Roig I, Robles P, Scherthan H, Garcia Caldes M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "19146767", "url": "https://glygen.org/publication/PubMed/19146767" } ] }, { "title": "Loss of expression for the Wnt pathway components adenomatous polyposis coli and glycogen synthase kinase 3-beta in parathyroid carcinomas.", "journal": "International journal of oncology", "date": "2009", "authors": "Juhlin CC, Haglund F, Villablanca A, Forsberg L, Sandelin K, Branstrom R, Larsson C, Hoog A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19148484", "url": "https://glygen.org/publication/PubMed/19148484" } ] }, { "title": "NOTCH3 expression is induced in mural cells through an autoregulatory loop that requires endothelial-expressed JAGGED1.", "journal": "Circulation research", "date": "2009", "authors": "Liu H, Kennard S, Lilly B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19150886", "url": "https://glygen.org/publication/PubMed/19150886" } ] }, { "title": "Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.", "journal": "Cell", "date": "2009", "authors": "Weinmann L, Hock J, Ivacevic T, Ohrt T, Mutze J, Schwille P, Kremmer E, Benes V, Urlaub H, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19167051", "url": "https://glygen.org/publication/PubMed/19167051" } ] }, { "title": "Isolation and characterization of two human H1 histone genes within clusters of core histone genes.", "journal": "Genomics", "date": "1991", "authors": "Albig W, Kardalinou E, Drabent B, Zimmer A, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "1916825", "url": "https://glygen.org/publication/PubMed/1916825" } ] }, { "title": "ING4 mediates crosstalk between histone H3 K4 trimethylation and H3 acetylation to attenuate cellular transformation.", "journal": "Molecular cell", "date": "2009", "authors": "Hung T, Binda O, Champagne KS, Kuo AJ, Johnson K, Chang HY, Simon MD, Kutateladze TG, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "19187765", "url": "https://glygen.org/publication/PubMed/19187765" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "Association of C-terminal ubiquitin hydrolase BRCA1-associated protein 1 with cell cycle regulator host cell factor 1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Misaghi S, Ottosen S, Izrael-Tomasevic A, Arnott D, Lamkanfi M, Lee J, Liu J, O'Rourke K, Dixit VM, Wilson AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "19188440", "url": "https://glygen.org/publication/PubMed/19188440" } ] }, { "title": "The Rap80-BRCC36 de-ubiquitinating enzyme complex antagonizes RNF8-Ubc13-dependent ubiquitination events at DNA double strand breaks.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shao G, Lilli DR, Patterson-Fortin J, Coleman KA, Morrissey DE, Greenberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "19202061", "url": "https://glygen.org/publication/PubMed/19202061" } ] }, { "title": "The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.", "journal": "Cell", "date": "2009", "authors": "Stewart GS, Panier S, Townsend K, Al-Hakim AK, Kolas NK, Miller ES, Nakada S, Ylanko J, Olivarius S, Mendez M, Oldreive C, Wildenhain J, Tagliaferro A, Pelletier L, Taubenheim N, Durandy A, Byrd PJ, Stankovic T, Taylor AM, Durocher D", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "19203578", "url": "https://glygen.org/publication/PubMed/19203578" } ] }, { "title": "RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.", "journal": "Cell", "date": "2009", "authors": "Doil C, Mailand N, Bekker-Jensen S, Menard P, Larsen DH, Pepperkok R, Ellenberg J, Panier S, Durocher D, Bartek J, Lukas J, Lukas C", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "19203579", "url": "https://glygen.org/publication/PubMed/19203579" } ] }, { "title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.", "journal": "BMC molecular biology", "date": "2009", "authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19232136", "url": "https://glygen.org/publication/PubMed/19232136" } ] }, { "title": "PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Zhao Q, Rank G, Tan YT, Li H, Moritz RL, Simpson RJ, Cerruti L, Curtis DJ, Patel DJ, Allis CD, Cunningham JM, Jane SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "19234465", "url": "https://glygen.org/publication/PubMed/19234465" } ] }, { "title": "Cloning and characterization of a 3-methyladenine DNA glycosylase cDNA from human cells whose gene maps to chromosome 16.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Samson L, Derfler B, Boosalis M, Call K", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "1924375", "url": "https://glygen.org/publication/PubMed/1924375" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shenoy SK, Modi AS, Shukla AK, Xiao K, Berthouze M, Ahn S, Wilkinson KD, Miller WE, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19363159", "url": "https://glygen.org/publication/PubMed/19363159" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Lazzaretti D, Tournier I, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383768", "url": "https://glygen.org/publication/PubMed/19383768" } ] }, { "title": "A C-terminal silencing domain in GW182 is essential for miRNA function.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Eulalio A, Helms S, Fritzsch C, Fauser M, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383769", "url": "https://glygen.org/publication/PubMed/19383769" } ] }, { "title": "Mammalian GW182 contains multiple Argonaute-binding sites and functions in microRNA-mediated translational repression.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Takimoto K, Wakiyama M, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19398495", "url": "https://glygen.org/publication/PubMed/19398495" } ] }, { "title": "The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bomberger JM, Barnaby RL, Stanton BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19398555", "url": "https://glygen.org/publication/PubMed/19398555" } ] }, { "title": "Active establishment of centromeric CENP-A chromatin by RSF complex.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Perpelescu M, Nozaki N, Obuse C, Yang H, Yoda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19398759", "url": "https://glygen.org/publication/PubMed/19398759" } ] }, { "title": "Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.", "journal": "Cell", "date": "2009", "authors": "Foltz DR, Jansen LE, Bailey AO, Yates JR 3rd, Bassett EA, Wood S, Black BE, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19410544", "url": "https://glygen.org/publication/PubMed/19410544" } ] }, { "title": "HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres.", "journal": "Cell", "date": "2009", "authors": "Dunleavy EM, Roche D, Tagami H, Lacoste N, Ray-Gallet D, Nakamura Y, Daigo Y, Nakatani Y, Almouzni-Pettinotti G", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19410545", "url": "https://glygen.org/publication/PubMed/19410545" } ] }, { "title": "The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.", "journal": "The EMBO journal", "date": "2009", "authors": "Berthouze M, Venkataramanan V, Li Y, Shenoy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19424180", "url": "https://glygen.org/publication/PubMed/19424180" } ] }, { "title": "The H3K27me3 demethylase JMJD3 contributes to the activation of the INK4A-ARF locus in response to oncogene- and stress-induced senescence.", "journal": "Genes & development", "date": "2009", "authors": "Agger K, Cloos PA, Rudkjaer L, Williams K, Andersen G, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451217", "url": "https://glygen.org/publication/PubMed/19451217" } ] }, { "title": "Histone demethylase JMJD3 contributes to epigenetic control of INK4a/ARF by oncogenic RAS.", "journal": "Genes & development", "date": "2009", "authors": "Barradas M, Anderton E, Acosta JC, Li S, Banito A, Rodriguez-Niedenfuhr M, Maertens G, Banck M, Zhou MM, Walsh MJ, Peters G, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451218", "url": "https://glygen.org/publication/PubMed/19451218" } ] }, { "title": "Groucho binds two conserved regions of LEF-1 for HDAC-dependent repression.", "journal": "BMC cancer", "date": "2009", "authors": "Arce L, Pate KT, Waterman ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19460168", "url": "https://glygen.org/publication/PubMed/19460168" } ] }, { "title": "Polycomb mediated epigenetic silencing and replication timing at the INK4a/ARF locus during senescence.", "journal": "PloS one", "date": "2009", "authors": "Agherbi H, Gaussmann-Wenger A, Verthuy C, Chasson L, Serrano M, Djabali M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19462008", "url": "https://glygen.org/publication/PubMed/19462008" } ] }, { "title": "Pygo2 expands mammary progenitor cells by facilitating histone H3 K4 methylation.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Gu B, Sun P, Yuan Y, Moraes RC, Li A, Teng A, Agrawal A, Rheaume C, Bilanchone V, Veltmaat JM, Takemaru K, Millar S, Lee EY, Lewis MT, Li B, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19487454", "url": "https://glygen.org/publication/PubMed/19487454" } ] }, { "title": "The PHD domain is required to link Drosophila Pygopus to Legless/beta-catenin and not to histone H3.", "journal": "Mechanisms of development", "date": "2009", "authors": "Kessler R, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19493659", "url": "https://glygen.org/publication/PubMed/19493659" } ] }, { "title": "Thrombospondin-1 is a transcriptional repression target of PRMT6.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Michaud-Levesque J, Richard S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19509293", "url": "https://glygen.org/publication/PubMed/19509293" } ] }, { "title": "Mitochondrial dysfunction contributes to oncogene-induced senescence.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Moiseeva O, Bourdeau V, Roux A, Deschenes-Simard X, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19528227", "url": "https://glygen.org/publication/PubMed/19528227" } ] }, { "title": "Many human large intergenic noncoding RNAs associate with chromatin-modifying complexes and affect gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Khalil AM, Guttman M, Huarte M, Garber M, Raj A, Rivea Morales D, Thomas K, Presser A, Bernstein BE, van Oudenaarden A, Regev A, Lander ES, Rinn JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "19571010", "url": "https://glygen.org/publication/PubMed/19571010" } ] }, { "title": "Telomerase modulates Wnt signalling by association with target gene chromatin.", "journal": "Nature", "date": "2009", "authors": "Park JI, Venteicher AS, Hong JY, Choi J, Jun S, Shkreli M, Chang W, Meng Z, Cheung P, Ji H, McLaughlin M, Veenstra TD, Nusse R, McCrea PD, Artandi SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19571879", "url": "https://glygen.org/publication/PubMed/19571879" } ] }, { "title": "Human cytomegalovirus exploits ESCRT machinery in the process of virion maturation.", "journal": "Journal of virology", "date": "2009", "authors": "Tandon R, AuCoin DP, Mocarski ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-9610379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379" } ], "reference": [ { "type": "PubMed", "id": "19640981", "url": "https://glygen.org/publication/PubMed/19640981" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "Chromatin structure regulates human cytomegalovirus gene expression during latency, reactivation and lytic infection.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "19682613", "url": "https://glygen.org/publication/PubMed/19682613" } ] }, { "title": "MicroRNA miR-34 inhibits human pancreatic cancer tumor-initiating cells.", "journal": "PloS one", "date": "2009", "authors": "Ji Q, Hao X, Zhang M, Tang W, Yang M, Li L, Xiang D, Desano JT, Bommer GT, Fan D, Fearon ER, Lawrence TS, Xu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19714243", "url": "https://glygen.org/publication/PubMed/19714243" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "MicroRNA-206 targets notch3, activates apoptosis, and inhibits tumor cell migration and focus formation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Song G, Zhang Y, Wang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19723635", "url": "https://glygen.org/publication/PubMed/19723635" } ] }, { "title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.", "journal": "Gastroenterology", "date": "2009", "authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19747919", "url": "https://glygen.org/publication/PubMed/19747919" } ] }, { "title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.", "journal": "Nature", "date": "1990", "authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1975088", "url": "https://glygen.org/publication/PubMed/1975088" } ] }, { "title": "MicroRNA-34a inhibits glioblastoma growth by targeting multiple oncogenes.", "journal": "Cancer research", "date": "2009", "authors": "Li Y, Guessous F, Zhang Y, Dipierro C, Kefas B, Johnson E, Marcinkiewicz L, Jiang J, Yang Y, Schmittgen TD, Lopes B, Schiff D, Purow B, Abounader R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19773441", "url": "https://glygen.org/publication/PubMed/19773441" } ] }, { "title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.", "journal": "Molecular cell", "date": "2009", "authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19782034", "url": "https://glygen.org/publication/PubMed/19782034" } ] }, { "title": "Histone H3 methylation links DNA damage detection to activation of the tumour suppressor Tip60.", "journal": "Nature cell biology", "date": "2009", "authors": "Sun Y, Jiang X, Xu Y, Ayrapetov MK, Moreau LA, Whetstine JR, Price BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "19783983", "url": "https://glygen.org/publication/PubMed/19783983" } ] }, { "title": "Cell surface-bound IL-1alpha is an upstream regulator of the senescence-associated IL-6/IL-8 cytokine network.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Orjalo AV, Bhaumik D, Gengler BK, Scott GK, Campisi J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "19805069", "url": "https://glygen.org/publication/PubMed/19805069" } ] }, { "title": "The deubiquitinating enzyme BAP1 regulates cell growth via interaction with HCF-1.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Machida YJ, Machida Y, Vashisht AA, Wohlschlegel JA, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "19815555", "url": "https://glygen.org/publication/PubMed/19815555" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Structural basis for recognition of H3K4 methylation status by the DNA methyltransferase 3A ATRX-DNMT3-DNMT3L domain.", "journal": "EMBO reports", "date": "2009", "authors": "Otani J, Nankumo T, Arita K, Inamoto S, Ariyoshi M, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "19834512", "url": "https://glygen.org/publication/PubMed/19834512" } ] }, { "title": "MdmX is a substrate for the deubiquitinating enzyme USP2a.", "journal": "Oncogene", "date": "2010", "authors": "Allende-Vega N, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" } ] }, { "title": "An intergenic non-coding rRNA correlated with expression of the rRNA and frequency of an rRNA single nucleotide polymorphism in lung cancer cells.", "journal": "PloS one", "date": "2009", "authors": "Shiao YH, Lupascu ST, Gu YD, Kasprzak W, Hwang CJ, Fields JR, Leighty RM, Quinones O, Shapiro BA, Alvord WG, Anderson LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "19838300", "url": "https://glygen.org/publication/PubMed/19838300" } ] }, { "title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.", "journal": "Molecular cell", "date": "2009", "authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19854132", "url": "https://glygen.org/publication/PubMed/19854132" } ] }, { "title": "USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha.", "journal": "Cellular signalling", "date": "2010", "authors": "Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19874889", "url": "https://glygen.org/publication/PubMed/19874889" } ] }, { "title": "Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19910467", "url": "https://glygen.org/publication/PubMed/19910467" } ] }, { "title": "Phosphorylation of H2A by Bub1 prevents chromosomal instability through localizing shugoshin.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Kawashima SA, Yamagishi Y, Honda T, Ishiguro K, Watanabe Y", "evidence": [ { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" } ], "reference": [ { "type": "PubMed", "id": "19965387", "url": "https://glygen.org/publication/PubMed/19965387" } ] }, { "title": "Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW, Conaway RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "20018852", "url": "https://glygen.org/publication/PubMed/20018852" } ] }, { "title": "PRDM9 is a major determinant of meiotic recombination hotspots in humans and mice.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Baudat F, Buard J, Grey C, Fledel-Alon A, Ober C, Przeworski M, Coop G, de Massy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20044539", "url": "https://glygen.org/publication/PubMed/20044539" } ] }, { "title": "Drive against hotspot motifs in primates implicates the PRDM9 gene in meiotic recombination.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Myers S, Bowden R, Tumian A, Bontrop RE, Freeman C, MacFie TS, McVean G, Donnelly P", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20044541", "url": "https://glygen.org/publication/PubMed/20044541" } ] }, { "title": "Structure of the hDmc1-ssDNA filament reveals the principles of its architecture.", "journal": "PloS one", "date": "2010", "authors": "Okorokov AL, Chaban YL, Bugreev DV, Hodgkinson J, Mazin AV, Orlova EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20062530", "url": "https://glygen.org/publication/PubMed/20062530" } ] }, { "title": "JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.", "journal": "Nature", "date": "2010", "authors": "Pasini D, Cloos PA, Walfridsson J, Olsson L, Bukowski JP, Johansen JV, Bak M, Tommerup N, Rappsilber J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20075857", "url": "https://glygen.org/publication/PubMed/20075857" } ] }, { "title": "HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Shuaib M, Ouararhni K, Dimitrov S, Hamiche A", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "20080577", "url": "https://glygen.org/publication/PubMed/20080577" } ] }, { "title": "Involvement of epigenetically silenced microRNA-181c in gastric carcinogenesis.", "journal": "Carcinogenesis", "date": "2010", "authors": "Hashimoto Y, Akiyama Y, Otsubo T, Shimada S, Yuasa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20080834", "url": "https://glygen.org/publication/PubMed/20080834" } ] }, { "title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.", "journal": "FEBS letters", "date": "2010", "authors": "Yates JA, Menon T, Thompson BA, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "20085832", "url": "https://glygen.org/publication/PubMed/20085832" } ] }, { "title": "Transcriptional role of cyclin D1 in development revealed by a genetic-proteomic screen.", "journal": "Nature", "date": "2010", "authors": "Bienvenu F, Jirawatnotai S, Elias JE, Meyer CA, Mizeracka K, Marson A, Frampton GM, Cole MF, Odom DT, Odajima J, Geng Y, Zagozdzon A, Jecrois M, Young RA, Liu XS, Cepko CL, Gygi SP, Sicinski P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20090754", "url": "https://glygen.org/publication/PubMed/20090754" } ] }, { "title": "USP10 regulates p53 localization and stability by deubiquitinating p53.", "journal": "Cell", "date": "2010", "authors": "Yuan J, Luo K, Zhang L, Cheville JC, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20096447", "url": "https://glygen.org/publication/PubMed/20096447" } ] }, { "title": "Jarid2 and PRC2, partners in regulating gene expression.", "journal": "Genes & development", "date": "2010", "authors": "Li G, Margueron R, Ku M, Chambon P, Bernstein BE, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20123894", "url": "https://glygen.org/publication/PubMed/20123894" } ] }, { "title": "Distinct factors control histone variant H3.3 localization at specific genomic regions.", "journal": "Cell", "date": "2010", "authors": "Goldberg AD, Banaszynski LA, Noh KM, Lewis PW, Elsaesser SJ, Stadler S, Dewell S, Law M, Guo X, Li X, Wen D, Chapgier A, DeKelver RC, Miller JC, Lee YL, Boydston EA, Holmes MC, Gregory PD, Greally JM, Rafii S, Yang C, Scambler PJ, Garrick D, Gibbons RJ, Higgs DR, Cristea IM, Urnov FD, Zheng D, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "20211137", "url": "https://glygen.org/publication/PubMed/20211137" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.", "journal": "Nature cell biology", "date": "2010", "authors": "Pereg Y, Liu BY, O'Rourke KM, Sagolla M, Dey A, Komuves L, French DM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20228808", "url": "https://glygen.org/publication/PubMed/20228808" } ] }, { "title": "AML1 is overexpressed in patients with myeloproliferative neoplasms and mediates JAK2V617F-independent overexpression of NF-E2.", "journal": "Blood", "date": "2010", "authors": "Wang W, Schwemmers S, Hexner EO, Pahl HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20339092", "url": "https://glygen.org/publication/PubMed/20339092" } ] }, { "title": "MicroRNA-34a suppresses invasion through downregulation of Notch1 and Jagged1 in cervical carcinoma and choriocarcinoma cells.", "journal": "Carcinogenesis", "date": "2010", "authors": "Pang RT, Leung CO, Ye TM, Liu W, Chiu PC, Lam KK, Lee KF, Yeung WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20351093", "url": "https://glygen.org/publication/PubMed/20351093" } ] }, { "title": "RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Lee S, Shuman JD, Guszczynski T, Sakchaisri K, Sebastian T, Copeland TD, Miller M, Cohen MS, Taunton J, Smart RC, Xiao Z, Yu LR, Veenstra TD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20351173", "url": "https://glygen.org/publication/PubMed/20351173" } ] }, { "title": "The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.", "journal": "Cell research", "date": "2010", "authors": "Chen R, Zhang L, Zhong B, Tan B, Liu Y, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20368735", "url": "https://glygen.org/publication/PubMed/20368735" } ] }, { "title": "Histone H2A deubiquitinase activity of the Polycomb repressive complex PR-DUB.", "journal": "Nature", "date": "2010", "authors": "Scheuermann JC, de Ayala Alonso AG, Oktaba K, Ly-Hartig N, McGinty RK, Fraterman S, Wilm M, Muir TW, Muller J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "20436459", "url": "https://glygen.org/publication/PubMed/20436459" } ] }, { "title": "DeltaNp63alpha repression of the Notch1 gene supports the proliferative capacity of normal human keratinocytes and cervical cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Yugawa T, Narisawa-Saito M, Yoshimatsu Y, Haga K, Ohno S, Egawa N, Fujita M, Kiyono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442293", "url": "https://glygen.org/publication/PubMed/20442293" } ] }, { "title": "Differential control of Notch1 gene transcription by Klf4 and Sp3 transcription factors in normal versus cancer-derived keratinocytes.", "journal": "PloS one", "date": "2010", "authors": "Lambertini C, Pantano S, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442780", "url": "https://glygen.org/publication/PubMed/20442780" } ] }, { "title": "CCAAT/Enhancer-binding protein beta DNA binding is auto-inhibited by multiple elements that also mediate association with p300/CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lee S, Miller M, Shuman JD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20452968", "url": "https://glygen.org/publication/PubMed/20452968" } ] }, { "title": "Epigenetically reprogramming metastatic tumor cells with an embryonic microenvironment.", "journal": "Epigenomics", "date": "2009", "authors": "Costa FF, Seftor EA, Bischof JM, Kirschmann DA, Strizzi L, Arndt K, Bonaldo Mde F, Soares MB, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20495621", "url": "https://glygen.org/publication/PubMed/20495621" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Dirac AM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20501646", "url": "https://glygen.org/publication/PubMed/20501646" } ] }, { "title": "Loss of pRB causes centromere dysfunction and chromosomal instability.", "journal": "Genes & development", "date": "2010", "authors": "Manning AL, Longworth MS, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20551165", "url": "https://glygen.org/publication/PubMed/20551165" } ] }, { "title": "Mitotic chromosome condensation mediated by the retinoblastoma protein is tumor-suppressive.", "journal": "Genes & development", "date": "2010", "authors": "Coschi CH, Martens AL, Ritchie K, Francis SM, Chakrabarti S, Berube NG, Dick FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20551166", "url": "https://glygen.org/publication/PubMed/20551166" } ] }, { "title": "Dual recognition of CENP-A nucleosomes is required for centromere assembly.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Carroll CW, Milks KJ, Straight AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "20566683", "url": "https://glygen.org/publication/PubMed/20566683" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.", "journal": "Nature", "date": "2010", "authors": "Liu W, Tanasa B, Tyurina OV, Zhou TY, Gassmann R, Liu WT, Ohgi KA, Benner C, Garcia-Bassets I, Aggarwal AK, Desai A, Dorrestein PC, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20622854", "url": "https://glygen.org/publication/PubMed/20622854" } ] }, { "title": "The inherent processivity of the human de novo methyltransferase 3A (DNMT3A) is enhanced by DNMT3L.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Holz-Schietinger C, Reich NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "20630873", "url": "https://glygen.org/publication/PubMed/20630873" } ] }, { "title": "Dynamics of cohesin proteins REC8, STAG3, SMC1 beta and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes.", "journal": "Human reproduction (Oxford, England)", "date": "2010", "authors": "Garcia-Cruz R, Brieno MA, Roig I, Grossmann M, Velilla E, Pujol A, Cabero L, Pessarrodona A, Barbero JL, Garcia Caldes M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "20634189", "url": "https://glygen.org/publication/PubMed/20634189" } ] }, { "title": "Daxx is an H3.3-specific histone chaperone and cooperates with ATRX in replication-independent chromatin assembly at telomeres.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Lewis PW, Elsaesser SJ, Noh KM, Stadler SC, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "20651253", "url": "https://glygen.org/publication/PubMed/20651253" } ] }, { "title": "C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence.", "journal": "Molecular biology reports", "date": "2010", "authors": "Cai R, Cai X, Chen B, Xu W, Lu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "20661648", "url": "https://glygen.org/publication/PubMed/20661648" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "NOTCH1 and NOTCH3 coordinate esophageal squamous differentiation through a CSL-dependent transcriptional network.", "journal": "Gastroenterology", "date": "2010", "authors": "Ohashi S, Natsuizaka M, Yashiro-Ohtani Y, Kalman RA, Nakagawa M, Wu L, Klein-Szanto AJ, Herlyn M, Diehl JA, Katz JP, Pear WS, Seykora JT, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20801121", "url": "https://glygen.org/publication/PubMed/20801121" } ] }, { "title": "The ubiquitin carboxyl hydrolase BAP1 forms a ternary complex with YY1 and HCF-1 and is a critical regulator of gene expression.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Yu H, Mashtalir N, Daou S, Hammond-Martel I, Ross J, Sui G, Hart GW, Rauscher FJ 3rd, Drobetsky E, Milot E, Shi Y, Affar el B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "20805357", "url": "https://glygen.org/publication/PubMed/20805357" } ] }, { "title": "Epithelial to mesenchymal transition is mechanistically linked with stem cell signatures in prostate cancer cells.", "journal": "PloS one", "date": "2010", "authors": "Kong D, Banerjee S, Ahmad A, Li Y, Wang Z, Sethi S, Sarkar FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20805998", "url": "https://glygen.org/publication/PubMed/20805998" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "PRDM9 variation strongly influences recombination hot-spot activity and meiotic instability in humans.", "journal": "Nature genetics", "date": "2010", "authors": "Berg IL, Neumann R, Lam KW, Sarbajna S, Odenthal-Hesse L, May CA, Jeffreys AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20818382", "url": "https://glygen.org/publication/PubMed/20818382" } ] }, { "title": "DNMT3L modulates significant and distinct flanking sequence preference for DNA methylation by DNMT3A and DNMT3B in vivo.", "journal": "PLoS genetics", "date": "2010", "authors": "Wienholz BL, Kareta MS, Moarefi AH, Gordon CA, Ginno PA, Chedin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "20838592", "url": "https://glygen.org/publication/PubMed/20838592" } ] }, { "title": "Identification of preferential target sites for human DNA methyltransferases.", "journal": "Nucleic acids research", "date": "2011", "authors": "Choi SH, Heo K, Byun HM, An W, Lu W, Yang AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "20841325", "url": "https://glygen.org/publication/PubMed/20841325" } ] }, { "title": "Regulation of platelet myosin light chain (MYL9) by RUNX1: implications for thrombocytopenia and platelet dysfunction in RUNX1 haplodeficiency.", "journal": "Blood", "date": "2010", "authors": "Jalagadugula G, Mao G, Kaur G, Goldfinger LE, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20876458", "url": "https://glygen.org/publication/PubMed/20876458" } ] }, { "title": "Combinatorial transcriptional control in blood stem/progenitor cells: genome-wide analysis of ten major transcriptional regulators.", "journal": "Cell stem cell", "date": "2010", "authors": "Wilson NK, Foster SD, Wang X, Knezevic K, Schutte J, Kaimakis P, Chilarska PM, Kinston S, Ouwehand WH, Dzierzak E, Pimanda JE, de Bruijn MF, Gottgens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "20887958", "url": "https://glygen.org/publication/PubMed/20887958" } ] }, { "title": "A chromatin localization screen reveals poly (ADP ribose)-regulated recruitment of the repressive polycomb and NuRD complexes to sites of DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Chou DM, Adamson B, Dephoure NE, Tan X, Nottke AC, Hurov KE, Gygi SP, Colaiacovo MP, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20937877", "url": "https://glygen.org/publication/PubMed/20937877" } ] }, { "title": "Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.", "journal": "Cancer cell", "date": "2010", "authors": "Aggarwal P, Vaites LP, Kim JK, Mellert H, Gurung B, Nakagawa H, Herlyn M, Hua X, Rustgi AK, McMahon SB, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "20951943", "url": "https://glygen.org/publication/PubMed/20951943" } ] }, { "title": "Dynamic regulation of the PR-Set7 histone methyltransferase is required for normal cell cycle progression.", "journal": "Genes & development", "date": "2010", "authors": "Wu S, Wang W, Kong X, Congdon LM, Yokomori K, Kirschner MW, Rice JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20966048", "url": "https://glygen.org/publication/PubMed/20966048" } ] }, { "title": "Binding of different histone marks differentially regulates the activity and specificity of polycomb repressive complex 2 (PRC2).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Xu C, Bian C, Yang W, Galka M, Ouyang H, Chen C, Qiu W, Liu H, Jones AE, MacKenzie F, Pan P, Li SS, Wang H, Min J", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20974918", "url": "https://glygen.org/publication/PubMed/20974918" } ] }, { "title": "Beta-N-acetylglucosamine (O-GlcNAc) is part of the histone code.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Sakabe K, Wang Z, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04908", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908" } ], "reference": [ { "type": "PubMed", "id": "21045127", "url": "https://glygen.org/publication/PubMed/21045127" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2011", "authors": "Aneja K, Jalagadugula G, Mao G, Singh A, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21129147", "url": "https://glygen.org/publication/PubMed/21129147" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Structure of DNMT1-DNA complex reveals a role for autoinhibition in maintenance DNA methylation.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Song J, Rechkoblit O, Bestor TH, Patel DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21163962", "url": "https://glygen.org/publication/PubMed/21163962" } ] }, { "title": "GC-rich sequence elements recruit PRC2 in mammalian ES cells.", "journal": "PLoS genetics", "date": "2010", "authors": "Mendenhall EM, Koche RP, Truong T, Zhou VW, Issac B, Chi AS, Ku M, Bernstein BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "21170310", "url": "https://glygen.org/publication/PubMed/21170310" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ramakrishna S, Suresh B, Lee EJ, Lee HJ, Ahn WS, Baek KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21239494", "url": "https://glygen.org/publication/PubMed/21239494" } ] }, { "title": "Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2011", "authors": "Jalagadugula G, Mao G, Kaur G, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21252065", "url": "https://glygen.org/publication/PubMed/21252065" } ] }, { "title": "Kruppel-like family of transcription factor 9, a differentiation-associated transcription factor, suppresses Notch1 signaling and inhibits glioblastoma-initiating stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2011", "authors": "Ying M, Sang Y, Li Y, Guerrero-Cazares H, Quinones-Hinojosa A, Vescovi AL, Eberhart CG, Xia S, Laterra J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21280156", "url": "https://glygen.org/publication/PubMed/21280156" } ] }, { "title": "JAK2V617F-mediated phosphorylation of PRMT5 downregulates its methyltransferase activity and promotes myeloproliferation.", "journal": "Cancer cell", "date": "2011", "authors": "Liu F, Zhao X, Perna F, Wang L, Koppikar P, Abdel-Wahab O, Harr MW, Levine RL, Xu H, Tefferi A, Deblasio A, Hatlen M, Menendez S, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21316606", "url": "https://glygen.org/publication/PubMed/21316606" } ] }, { "title": "USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase beta.", "journal": "Molecular cell", "date": "2011", "authors": "Parsons JL, Dianova II, Khoronenkova SV, Edelmann MJ, Kessler BM, Dianov GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21362556", "url": "https://glygen.org/publication/PubMed/21362556" } ] }, { "title": "Modulation of Dnmt3b function in vitro by interactions with Dnmt3L, Dnmt3a and Dnmt3b splice variants.", "journal": "Nucleic acids research", "date": "2011", "authors": "Van Emburgh BO, Robertson KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21378119", "url": "https://glygen.org/publication/PubMed/21378119" } ] }, { "title": "Endothelial Jarid2/Jumonji is required for normal cardiac development and proper Notch1 expression.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mysliwiec MR, Bresnick EH, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21402699", "url": "https://glygen.org/publication/PubMed/21402699" } ] }, { "title": "Transcriptional gene silencing in mammalian cells by miRNA mimics that target gene promoters.", "journal": "Nucleic acids research", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21427083", "url": "https://glygen.org/publication/PubMed/21427083" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.", "journal": "Blood", "date": "2011", "authors": "Haefliger S, Klebig C, Schaubitzer K, Schardt J, Timchenko N, Mueller BU, Pabst T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21471526", "url": "https://glygen.org/publication/PubMed/21471526" } ] }, { "title": "Recognition of multivalent histone states associated with heterochromatin by UHRF1 protein.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Nady N, Lemak A, Walker JR, Avvakumov GV, Kareta MS, Achour M, Xue S, Duan S, Allali-Hassani A, Zuo X, Wang YX, Bronner C, Chedin F, Arrowsmith CH, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21489993", "url": "https://glygen.org/publication/PubMed/21489993" } ] }, { "title": "The initial phase of chromosome condensation requires Cdk1-mediated phosphorylation of the CAP-D3 subunit of condensin II.", "journal": "Genes & development", "date": "2011", "authors": "Abe S, Nagasaka K, Hirayama Y, Kozuka-Hata H, Oyama M, Aoyagi Y, Obuse C, Hirota T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21498573", "url": "https://glygen.org/publication/PubMed/21498573" } ] }, { "title": "SET nuclear oncogene associates with microcephalin/MCPH1 and regulates chromosome condensation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Leung JW, Leitch A, Wood JL, Shaw-Smith C, Metcalfe K, Bicknell LS, Jackson AP, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21515671", "url": "https://glygen.org/publication/PubMed/21515671" } ] }, { "title": "Modulation of microRNA expression in human T-cell development: targeting of NOTCH3 by miR-150.", "journal": "Blood", "date": "2011", "authors": "Ghisi M, Corradin A, Basso K, Frasson C, Serafin V, Mukherjee S, Mussolin L, Ruggero K, Bonanno L, Guffanti A, De Bellis G, Gerosa G, Stellin G, D'Agostino DM, Basso G, Bronte V, Indraccolo S, Amadori A, Zanovello P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21551231", "url": "https://glygen.org/publication/PubMed/21551231" } ] }, { "title": "Assembly of the human origin recognition complex occurs through independent nuclear localization of its components.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ghosh S, Vassilev AP, Zhang J, Zhao Y, DePamphilis ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "21555516", "url": "https://glygen.org/publication/PubMed/21555516" } ] }, { "title": "The chromatin remodelling complex B-WICH changes the chromatin structure and recruits histone acetyl-transferases to active rRNA genes.", "journal": "PloS one", "date": "2011", "authors": "Vintermist A, Bohm S, Sadeghifar F, Louvet E, Mansen A, Percipalle P, Ostlund Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "21559432", "url": "https://glygen.org/publication/PubMed/21559432" } ] }, { "title": "Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.", "journal": "Developmental cell", "date": "2011", "authors": "Tijssen MR, Cvejic A, Joshi A, Hannah RL, Ferreira R, Forrai A, Bellissimo DC, Oram SH, Smethurst PA, Wilson NK, Wang X, Ottersbach K, Stemple DL, Green AR, Ouwehand WH, Gottgens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "21571218", "url": "https://glygen.org/publication/PubMed/21571218" } ] }, { "title": "Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Chen M, Gutierrez GJ, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21571647", "url": "https://glygen.org/publication/PubMed/21571647" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Romidepsin (Istodax, NSC 630176, FR901228, FK228, depsipeptide): a natural product recently approved for cutaneous T-cell lymphoma.", "journal": "The Journal of antibiotics", "date": "2011", "authors": "VanderMolen KM, McCulloch W, Pearce CJ, Oberlies NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "21587264", "url": "https://glygen.org/publication/PubMed/21587264" } ] }, { "title": "Transcriptional regulation by miRNA mimics that target sequences downstream of gene termini.", "journal": "Molecular bioSystems", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21589992", "url": "https://glygen.org/publication/PubMed/21589992" } ] }, { "title": "Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.", "journal": "Molecular cell", "date": "2011", "authors": "Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21596315", "url": "https://glygen.org/publication/PubMed/21596315" } ] }, { "title": "Control of vertebrate multiciliogenesis by miR-449 through direct repression of the Delta/Notch pathway.", "journal": "Nature cell biology", "date": "2011", "authors": "Marcet B, Chevalier B, Luxardi G, Coraux C, Zaragosi LE, Cibois M, Robbe-Sermesant K, Jolly T, Cardinaud B, Moreilhon C, Giovannini-Chami L, Nawrocki-Raby B, Birembaut P, Waldmann R, Kodjabachian L, Barbry P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21602795", "url": "https://glygen.org/publication/PubMed/21602795" } ] }, { "title": "SWI/SNF nucleosome remodellers and cancer.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Wilson BG, Roberts CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "21654818", "url": "https://glygen.org/publication/PubMed/21654818" } ] }, { "title": "USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Scortegagna M, Subtil T, Qi J, Kim H, Zhao W, Gu W, Kluger H, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21659512", "url": "https://glygen.org/publication/PubMed/21659512" } ] }, { "title": "Heparan sulfate proteoglycans.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Sarrazin S, Lamanna WC, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "21690215", "url": "https://glygen.org/publication/PubMed/21690215" } ] }, { "title": "Dynamic CpG island methylation landscape in oocytes and preimplantation embryos.", "journal": "Nature genetics", "date": "2011", "authors": "Smallwood SA, Tomizawa S, Krueger F, Ruf N, Carli N, Segonds-Pichon A, Sato S, Hata K, Andrews SR, Kelsey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21706000", "url": "https://glygen.org/publication/PubMed/21706000" } ] }, { "title": "Thymine DNA glycosylase is essential for active DNA demethylation by linked deamination-base excision repair.", "journal": "Cell", "date": "2011", "authors": "Cortellino S, Xu J, Sannai M, Moore R, Caretti E, Cigliano A, Le Coz M, Devarajan K, Wessels A, Soprano D, Abramowitz LK, Bartolomei MS, Rambow F, Bassi MR, Bruno T, Fanciulli M, Renner C, Klein-Szanto AJ, Matsumoto Y, Kobi D, Davidson I, Alberti C, Larue L, Bellacosa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "21722948", "url": "https://glygen.org/publication/PubMed/21722948" } ] }, { "title": "Down-regulation of the RUNX1-target gene NR4A3 contributes to hematopoiesis deregulation in familial platelet disorder/acute myelogenous leukemia.", "journal": "Blood", "date": "2011", "authors": "Bluteau D, Gilles L, Hilpert M, Antony-Debre I, James C, Debili N, Camara-Clayette V, Wagner-Ballon O, Cordette-Lagarde V, Robert T, Ripoche H, Gonin P, Swierczek S, Prchal J, Vainchenker W, Favier R, Raslova H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21725049", "url": "https://glygen.org/publication/PubMed/21725049" } ] }, { "title": "SHP2 tyrosine phosphatase converts parafibromin/Cdc73 from a tumor suppressor to an oncogenic driver.", "journal": "Molecular cell", "date": "2011", "authors": "Takahashi A, Tsutsumi R, Kikuchi I, Obuse C, Saito Y, Seidi A, Karisch R, Fernandez M, Cho T, Ohnishi N, Rozenblatt-Rosen O, Meyerson M, Neel BG, Hatakeyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "21726809", "url": "https://glygen.org/publication/PubMed/21726809" } ] }, { "title": "HJURP is a CENP-A chromatin assembly factor sufficient to form a functional de novo kinetochore.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Barnhart MC, Kuich PH, Stellfox ME, Ward JA, Bassett EA, Black BE, Foltz DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "21768289", "url": "https://glygen.org/publication/PubMed/21768289" } ] }, { "title": "Methylation of H2AR29 is a novel repressive PRMT6 target.", "journal": "Epigenetics & chromatin", "date": "2011", "authors": "Waldmann T, Izzo A, Kamieniarz K, Richter F, Vogler C, Sarg B, Lindner H, Young NL, Mittler G, Garcia BA, Schneider R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21774791", "url": "https://glygen.org/publication/PubMed/21774791" } ] }, { "title": "PHD finger recognition of unmodified histone H3R2 links UHRF1 to regulation of euchromatic gene expression.", "journal": "Molecular cell", "date": "2011", "authors": "Rajakumara E, Wang Z, Ma H, Hu L, Chen H, Lin Y, Guo R, Wu F, Li H, Lan F, Shi YG, Xu Y, Patel DJ, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21777816", "url": "https://glygen.org/publication/PubMed/21777816" } ] }, { "title": "Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.", "journal": "Cell research", "date": "2011", "authors": "Wang C, Shen J, Yang Z, Chen P, Zhao B, Hu W, Lan W, Tong X, Wu H, Li G, Cao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21808299", "url": "https://glygen.org/publication/PubMed/21808299" } ] }, { "title": "Crystal structure of PHD domain of UHRF1 and insights into recognition of unmodified histone H3 arginine residue 2.", "journal": "Cell research", "date": "2011", "authors": "Hu L, Li Z, Wang P, Lin Y, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21808300", "url": "https://glygen.org/publication/PubMed/21808300" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Activation of interleukin-6 gene expression through the NF-kappa B transcription factor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Libermann TA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2183031", "url": "https://glygen.org/publication/PubMed/2183031" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mei Y, Hahn AA, Hu S, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21849505", "url": "https://glygen.org/publication/PubMed/21849505" } ] }, { "title": "Notch signaling inhibits hepatocellular carcinoma following inactivation of the RB pathway.", "journal": "The Journal of experimental medicine", "date": "2011", "authors": "Viatour P, Ehmer U, Saddic LA, Dorrell C, Andersen JB, Lin C, Zmoos AF, Mazur PK, Schaffer BE, Ostermeier A, Vogel H, Sylvester KG, Thorgeirsson SS, Grompe M, Sage J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21875955", "url": "https://glygen.org/publication/PubMed/21875955" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "Modification of histones by sugar beta-N-acetylglucosamine (GlcNAc) occurs on multiple residues, including histone H3 serine 10, and is cell cycle-regulated.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhang S, Roche K, Nasheuer HP, Lowndes NF", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04908", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908" } ], "reference": [ { "type": "PubMed", "id": "21896475", "url": "https://glygen.org/publication/PubMed/21896475" } ] }, { "title": "MCPH1 regulates chromosome condensation and shaping as a composite modulator of condensin II.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Yamashita D, Shintomi K, Ono T, Gavvovidis I, Schindler D, Neitzel H, Trimborn M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21911480", "url": "https://glygen.org/publication/PubMed/21911480" } ] }, { "title": "Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.", "journal": "Cell", "date": "2011", "authors": "Tan M, Luo H, Lee S, Jin F, Yang JS, Montellier E, Buchou T, Cheng Z, Rousseaux S, Rajagopal N, Lu Z, Ye Z, Zhu Q, Wysocka J, Ye Y, Khochbin S, Ren B, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "21925322", "url": "https://glygen.org/publication/PubMed/21925322" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.", "journal": "Cell", "date": "2011", "authors": "Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21962518", "url": "https://glygen.org/publication/PubMed/21962518" } ] }, { "title": "Control of the senescence-associated secretory phenotype by NF-kappaB promotes senescence and enhances chemosensitivity.", "journal": "Genes & development", "date": "2011", "authors": "Chien Y, Scuoppo C, Wang X, Fang X, Balgley B, Bolden JE, Premsrirut P, Luo W, Chicas A, Lee CS, Kogan SC, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "21979375", "url": "https://glygen.org/publication/PubMed/21979375" } ] }, { "title": "Oligomerization of DNMT3A controls the mechanism of de novo DNA methylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Holz-Schietinger C, Matje DM, Harrison MF, Reich NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21979949", "url": "https://glygen.org/publication/PubMed/21979949" } ] }, { "title": "Regulation of MDM2 E3 ligase activity by phosphorylation after DNA damage.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Cheng Q, Cross B, Li B, Chen L, Li Z, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "21986495", "url": "https://glygen.org/publication/PubMed/21986495" } ] }, { "title": "The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.", "journal": "Leukemia research", "date": "2012", "authors": "Diakiw SM, Kok CH, To LB, Lewis ID, Brown AL, D'Andrea RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21993314", "url": "https://glygen.org/publication/PubMed/21993314" } ] }, { "title": "The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.", "journal": "Blood", "date": "2011", "authors": "Huang G, Zhao X, Wang L, Elf S, Xu H, Zhao X, Sashida G, Zhang Y, Liu Y, Lee J, Menendez S, Yang Y, Yan X, Zhang P, Tenen DG, Osato M, Hsieh JJ, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "22012064", "url": "https://glygen.org/publication/PubMed/22012064" } ] }, { "title": "Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.", "journal": "Oncogene", "date": "2012", "authors": "Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22020331", "url": "https://glygen.org/publication/PubMed/22020331" } ] }, { "title": "Ubiquitin-specific protease 4 (USP4) targets TRAF2 and TRAF6 for deubiquitination and inhibits TNFalpha-induced cancer cell migration.", "journal": "The Biochemical journal", "date": "2012", "authors": "Xiao N, Li H, Luo J, Wang R, Chen H, Chen J, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22029577", "url": "https://glygen.org/publication/PubMed/22029577" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "S phase-dependent interaction with DNMT1 dictates the role of UHRF1 but not UHRF2 in DNA methylation maintenance.", "journal": "Cell research", "date": "2011", "authors": "Zhang J, Gao Q, Li P, Liu X, Jia Y, Wu W, Li J, Dong S, Koseki H, Wong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "22064703", "url": "https://glygen.org/publication/PubMed/22064703" } ] }, { "title": "Direct evidence of nuclear Argonaute distribution during transcriptional silencing links the actin cytoskeleton to nuclear RNAi machinery in human cells.", "journal": "Nucleic acids research", "date": "2012", "authors": "Ahlenstiel CL, Lim HG, Cooper DA, Ishida T, Kelleher AD, Suzuki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22064859", "url": "https://glygen.org/publication/PubMed/22064859" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "Regulation of p53 stability and function by the deubiquitinating enzyme USP42.", "journal": "The EMBO journal", "date": "2011", "authors": "Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22085928", "url": "https://glygen.org/publication/PubMed/22085928" } ] }, { "title": "Jarid2 (Jumonji, AT rich interactive domain 2) regulates NOTCH1 expression via histone modification in the developing heart.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Mysliwiec MR, Carlson CD, Tietjen J, Hung H, Ansari AZ, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "22110129", "url": "https://glygen.org/publication/PubMed/22110129" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04908", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Altun M, Zhao B, Velasco K, Liu H, Hassink G, Paschke J, Pereira T, Lindsten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22128162", "url": "https://glygen.org/publication/PubMed/22128162" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "The human cytomegalovirus UL11 protein interacts with the receptor tyrosine phosphatase CD45, resulting in functional paralysis of T cells.", "journal": "PLoS pathogens", "date": "2011", "authors": "Gabaev I, Steinbruck L, Pokoyski C, Pich A, Stanton RJ, Schwinzer R, Schulz TF, Jacobs R, Messerle M, Kay-Fedorov PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "22174689", "url": "https://glygen.org/publication/PubMed/22174689" } ] }, { "title": "DNA damage signaling triggers degradation of histone methyltransferases through APC/C(Cdh1) in senescent cells.", "journal": "Molecular cell", "date": "2012", "authors": "Takahashi A, Imai Y, Yamakoshi K, Kuninaka S, Ohtani N, Yoshimoto S, Hori S, Tachibana M, Anderton E, Takeuchi T, Shinkai Y, Peters G, Saya H, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22178396", "url": "https://glygen.org/publication/PubMed/22178396" } ] }, { "title": "Pygo2 regulates histone gene expression and H3 K56 acetylation in human mammary epithelial cells.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Gu B, Watanabe K, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22186018", "url": "https://glygen.org/publication/PubMed/22186018" } ] }, { "title": "Probing transcription-specific outputs of beta-catenin in vivo.", "journal": "Genes & development", "date": "2011", "authors": "Valenta T, Gay M, Steiner S, Draganova K, Zemke M, Hoffmans R, Cinelli P, Aguet M, Sommer L, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22190459", "url": "https://glygen.org/publication/PubMed/22190459" } ] }, { "title": "Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.", "journal": "PloS one", "date": "2011", "authors": "Zhang YH, Zhou CJ, Zhou ZR, Song AX, Hu HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22216260", "url": "https://glygen.org/publication/PubMed/22216260" } ] }, { "title": "Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Migliori V, Muller J, Phalke S, Low D, Bezzi M, Mok WC, Sahu SK, Gunaratne J, Capasso P, Bassi C, Cecatiello V, De Marco A, Blackstock W, Kuznetsov V, Amati B, Mapelli M, Guccione E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "22231400", "url": "https://glygen.org/publication/PubMed/22231400" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Mutation of A677 in histone methyltransferase EZH2 in human B-cell lymphoma promotes hypertrimethylation of histone H3 on lysine 27 (H3K27).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "McCabe MT, Graves AP, Ganji G, Diaz E, Halsey WS, Jiang Y, Smitheman KN, Ott HM, Pappalardi MB, Allen KE, Chen SB, Della Pietra A 3rd, Dul E, Hughes AM, Gilbert SA, Thrall SH, Tummino PJ, Kruger RG, Brandt M, Schwartz B, Creasy CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "22323599", "url": "https://glygen.org/publication/PubMed/22323599" } ] }, { "title": "PCGF homologs, CBX proteins, and RYBP define functionally distinct PRC1 family complexes.", "journal": "Molecular cell", "date": "2012", "authors": "Gao Z, Zhang J, Bonasio R, Strino F, Sawai A, Parisi F, Kluger Y, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22325352", "url": "https://glygen.org/publication/PubMed/22325352" } ] }, { "title": "Regulation of p14ARF expression by miR-24: a potential mechanism compromising the p53 response during retinoblastoma development.", "journal": "BMC cancer", "date": "2012", "authors": "To KH, Pajovic S, Gallie BL, Theriault BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22336108", "url": "https://glygen.org/publication/PubMed/22336108" } ] }, { "title": "Kinetics of DNA methylation inheritance by the Dnmt1-including complexes during the cell cycle.", "journal": "Cell division", "date": "2012", "authors": "Hervouet E, Nadaradjane A, Gueguen M, Vallette FM, Cartron PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "22348533", "url": "https://glygen.org/publication/PubMed/22348533" } ] }, { "title": "Overexpression of wild-type or mutants forms of CEBPA alter normal human hematopoiesis.", "journal": "Leukemia", "date": "2012", "authors": "Quintana-Bustamante O, Lan-Lan Smith S, Griessinger E, Reyal Y, Vargaftig J, Lister TA, Fitzgibbon J, Bonnet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22371011", "url": "https://glygen.org/publication/PubMed/22371011" } ] }, { "title": "Lysine succinylation and lysine malonylation in histones.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Xie Z, Dai J, Dai L, Tan M, Cheng Z, Wu Y, Boeke JD, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "22389435", "url": "https://glygen.org/publication/PubMed/22389435" } ] }, { "title": "The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.", "journal": "Nature", "date": "2012", "authors": "Kuo AJ, Song J, Cheung P, Ishibe-Murakami S, Yamazoe S, Chen JK, Patel DJ, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "22398447", "url": "https://glygen.org/publication/PubMed/22398447" } ] }, { "title": "Studies of H3K4me3 demethylation by KDM5B/Jarid1B/PLU1 reveals strong substrate recognition in vitro and identifies 2,4-pyridine-dicarboxylic acid as an in vitro and in cell inhibitor.", "journal": "The FEBS journal", "date": "2012-06", "authors": "Kristensen Line H, Nielsen Anders L, Helgstrand Charlotte, Lees Michael, Cloos Paul, Kastrup Jette S, Helin Kristian, Olsen Lars, Gajhede Michael", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "22420752", "url": "https://glygen.org/publication/PubMed/22420752" } ] }, { "title": "A role for small RNAs in DNA double-strand break repair.", "journal": "Cell", "date": "2012", "authors": "Wei W, Ba Z, Gao M, Wu Y, Ma Y, Amiard S, White CI, Rendtlew Danielsen JM, Yang YG, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22445173", "url": "https://glygen.org/publication/PubMed/22445173" } ] }, { "title": "Sequential ChIP-bisulfite sequencing enables direct genome-scale investigation of chromatin and DNA methylation cross-talk.", "journal": "Genome research", "date": "2012", "authors": "Brinkman AB, Gu H, Bartels SJ, Zhang Y, Matarese F, Simmer F, Marks H, Bock C, Gnirke A, Meissner A, Stunnenberg HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "22466170", "url": "https://glygen.org/publication/PubMed/22466170" } ] }, { "title": "C/EBPalpha and DEK coordinately regulate myeloid differentiation.", "journal": "Blood", "date": "2012", "authors": "Koleva RI, Ficarro SB, Radomska HS, Carrasco-Alfonso MJ, Alberta JA, Webber JT, Luckey CJ, Marcucci G, Tenen DG, Marto JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22474248", "url": "https://glygen.org/publication/PubMed/22474248" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.", "journal": "Nature communications", "date": "2012", "authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22569366", "url": "https://glygen.org/publication/PubMed/22569366" } ] }, { "title": "Expression and purification of active mouse and human NEIL3 proteins.", "journal": "Protein expression and purification", "date": "2012", "authors": "Liu M, Bandaru V, Holmes A, Averill AM, Cannan W, Wallace SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "22569481", "url": "https://glygen.org/publication/PubMed/22569481" } ] }, { "title": "The many faces and functions of beta-catenin.", "journal": "The EMBO journal", "date": "2012", "authors": "Valenta T, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22617422", "url": "https://glygen.org/publication/PubMed/22617422" } ] }, { "title": "A polymorphism in the upstream regulatory region of the interleukin-1alpha gene confers differential binding by transcription factors of the AP-1 family.", "journal": "Life sciences", "date": "2012", "authors": "Moerman-Herzog AM, Barger SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22634325", "url": "https://glygen.org/publication/PubMed/22634325" } ] }, { "title": "The mitochondrial pathway and reactive oxygen species are critical contributors to interferon-alpha/beta-mediated apoptosis in Ubp43-deficient hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Yim HY, Yang Y, Lim JS, Lee MS, Zhang DE, Kim KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22683641", "url": "https://glygen.org/publication/PubMed/22683641" } ] }, { "title": "CBX3 regulates efficient RNA processing genome-wide.", "journal": "Genome research", "date": "2012", "authors": "Smallwood A, Hon GC, Jin F, Henry RE, Espinosa JM, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "22684280", "url": "https://glygen.org/publication/PubMed/22684280" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Li Q, Zhu F, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22705304", "url": "https://glygen.org/publication/PubMed/22705304" } ] }, { "title": "A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Gatti M, Pinato S, Maspero E, Soffientini P, Polo S, Penengo L", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "22713238", "url": "https://glygen.org/publication/PubMed/22713238" } ] }, { "title": "Site-specific DICER and DROSHA RNA products control the DNA-damage response.", "journal": "Nature", "date": "2012", "authors": "Francia S, Michelini F, Saxena A, Tang D, de Hoon M, Anelli V, Mione M, Carninci P, d'Adda di Fagagna F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22722852", "url": "https://glygen.org/publication/PubMed/22722852" } ] }, { "title": "Unraveling cell type-specific and reprogrammable human replication origin signatures associated with G-quadruplex consensus motifs.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Besnard E, Babled A, Lapasset L, Milhavet O, Parrinello H, Dantec C, Marin JM, Lemaitre JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "22751019", "url": "https://glygen.org/publication/PubMed/22751019" } ] }, { "title": "Histone arginine methylation keeps RUNX1 target genes in an intermediate state.", "journal": "Oncogene", "date": "2013", "authors": "Herglotz J, Kuvardina ON, Kolodziej S, Kumar A, Hussong H, Grez M, Lausen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "22777353", "url": "https://glygen.org/publication/PubMed/22777353" } ] }, { "title": "Biochemical and structural characterization of the glycosylase domain of MBD4 bound to thymine and 5-hydroxymethyuracil-containing DNA.", "journal": "Nucleic acids research", "date": "2012", "authors": "Morera S, Grin I, Vigouroux A, Couve S, Henriot V, Saparbaev M, Ishchenko AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "22848106", "url": "https://glygen.org/publication/PubMed/22848106" } ] }, { "title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.", "journal": "PloS one", "date": "2012", "authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22879880", "url": "https://glygen.org/publication/PubMed/22879880" } ] }, { "title": "Core transcriptional regulatory circuit controlled by the TAL1 complex in human T cell acute lymphoblastic leukemia.", "journal": "Cancer cell", "date": "2012", "authors": "Sanda T, Lawton LN, Barrasa MI, Fan ZP, Kohlhammer H, Gutierrez A, Ma W, Tatarek J, Ahn Y, Kelliher MA, Jamieson CH, Staudt LM, Young RA, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "22897851", "url": "https://glygen.org/publication/PubMed/22897851" } ] }, { "title": "Argonaute proteins couple chromatin silencing to alternative splicing.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Ameyar-Zazoua M, Rachez C, Souidi M, Robin P, Fritsch L, Young R, Morozova N, Fenouil R, Descostes N, Andrau JC, Mathieu J, Hamiche A, Ait-Si-Ali S, Muchardt C, Batsche E, Harel-Bellan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22961379", "url": "https://glygen.org/publication/PubMed/22961379" } ] }, { "title": "Excision of 5-hydroxymethyluracil and 5-carboxylcytosine by the thymine DNA glycosylase domain: its structural basis and implications for active DNA demethylation.", "journal": "Nucleic acids research", "date": "2012", "authors": "Hashimoto H, Hong S, Bhagwat AS, Zhang X, Cheng X", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "22962365", "url": "https://glygen.org/publication/PubMed/22962365" } ] }, { "title": "RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.", "journal": "Cell", "date": "2012", "authors": "Mattiroli F, Vissers JH, van Dijk WJ, Ikpa P, Citterio E, Vermeulen W, Marteijn JA, Sixma TK", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "22980979", "url": "https://glygen.org/publication/PubMed/22980979" } ] }, { "title": "The many roles of the conserved eukaryotic Paf1 complex in regulating transcription, histone modifications, and disease states.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Tomson BN, Arndt KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22982193", "url": "https://glygen.org/publication/PubMed/22982193" } ] }, { "title": "Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.", "journal": "Nature medicine", "date": "2012", "authors": "Skokowa J, Klimiankou M, Klimenkova O, Lan D, Gupta K, Hussein K, Carrizosa E, Kusnetsova I, Li Z, Sustmann C, Ganser A, Zeidler C, Kreipe HH, Burkhardt J, Grosschedl R, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "23001182", "url": "https://glygen.org/publication/PubMed/23001182" } ] }, { "title": "Association of UHRF1 with methylated H3K9 directs the maintenance of DNA methylation.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Rothbart SB, Krajewski K, Nady N, Tempel W, Xue S, Badeaux AI, Barsyte-Lovejoy D, Martinez JY, Bedford MT, Fuchs SM, Arrowsmith CH, Strahl BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "23022729", "url": "https://glygen.org/publication/PubMed/23022729" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "Human TNRC6A is an Argonaute-navigator protein for microRNA-mediated gene silencing in the nucleus.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Nishi K, Nishi A, Nagasawa T, Ui-Tei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23150874", "url": "https://glygen.org/publication/PubMed/23150874" } ] }, { "title": "The deubiquitinating protein USP24 interacts with DDB2 and regulates DDB2 stability.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Zhang L, Lubin A, Chen H, Sun Z, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23159851", "url": "https://glygen.org/publication/PubMed/23159851" } ] }, { "title": "Structural insight into coordinated recognition of trimethylated histone H3 lysine 9 (H3K9me3) by the plant homeodomain (PHD) and tandem tudor domain (TTD) of UHRF1 (ubiquitin-like, containing PHD and RING finger domains, 1) protein.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Cheng J, Yang Y, Fang J, Xiao J, Zhu T, Chen F, Wang P, Li Z, Yang H, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "23161542", "url": "https://glygen.org/publication/PubMed/23161542" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Genome-wide mapping of human DNA-replication origins: levels of transcription at ORC1 sites regulate origin selection and replication timing.", "journal": "Genome research", "date": "2013", "authors": "Dellino GI, Cittaro D, Piccioni R, Luzi L, Banfi S, Segalla S, Cesaroni M, Mendoza-Maldonado R, Giacca M, Pelicci PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "23187890", "url": "https://glygen.org/publication/PubMed/23187890" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.", "journal": "Cancer letters", "date": "2013", "authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23219899", "url": "https://glygen.org/publication/PubMed/23219899" } ] }, { "title": "Deubiquitination of NLRP3 by BRCC3 critically regulates inflammasome activity.", "journal": "Molecular cell", "date": "2013", "authors": "Py BF, Kim MS, Vakifahmetoglu-Norberg H, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901" } ], "reference": [ { "type": "PubMed", "id": "23246432", "url": "https://glygen.org/publication/PubMed/23246432" } ] }, { "title": "Nucleolar transcription factor hUBF contains a DNA-binding motif with homology to HMG proteins.", "journal": "Nature", "date": "1990", "authors": "Jantzen HM, Admon A, Bell SP, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728" } ], "reference": [ { "type": "PubMed", "id": "2330041", "url": "https://glygen.org/publication/PubMed/2330041" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Coordinate regulation of DNA methylation and H3K27me3 in mouse embryonic stem cells.", "journal": "PloS one", "date": "2013", "authors": "Hagarman JA, Motley MP, Kristjansdottir K, Soloway PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "23326524", "url": "https://glygen.org/publication/PubMed/23326524" } ] }, { "title": "Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Zhang J, Chen C, Hou X, Gao Y, Lin F, Yang J, Gao Z, Pan L, Tao L, Wen C, Yao Z, Tsun A, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23395819", "url": "https://glygen.org/publication/PubMed/23395819" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "Telomeres shorten during ageing of human fibroblasts.", "journal": "Nature", "date": "1990", "authors": "Harley CB, Futcher AB, Greider CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "2342578", "url": "https://glygen.org/publication/PubMed/2342578" } ] }, { "title": "Noncoding RNA and Polycomb recruitment.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Brockdorff N", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "23431328", "url": "https://glygen.org/publication/PubMed/23431328" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.", "journal": "Nature", "date": "2013", "authors": "Li J, D'Angiolella V, Seeley ES, Kim S, Kobayashi T, Fu W, Campos EI, Pagano M, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23486064", "url": "https://glygen.org/publication/PubMed/23486064" } ] }, { "title": "Characterisation of retinoblastomas without RB1 mutations: genomic, gene expression, and clinical studies.", "journal": "The Lancet. Oncology", "date": "2013", "authors": "Rushlow DE, Mol BM, Kennett JY, Yee S, Pajovic S, Theriault BL, Prigoda-Lee NL, Spencer C, Dimaras H, Corson TW, Pang R, Massey C, Godbout R, Jiang Z, Zacksenhaus E, Paton K, Moll AC, Houdayer C, Raizis A, Halliday W, Lam WL, Boutros PC, Lohmann D, Dorsman JC, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "23498719", "url": "https://glygen.org/publication/PubMed/23498719" } ] }, { "title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2013", "authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23534758", "url": "https://glygen.org/publication/PubMed/23534758" } ] }, { "title": "Nuclear myosin 1c facilitates the chromatin modifications required to activate rRNA gene transcription and cell cycle progression.", "journal": "PLoS genetics", "date": "2013", "authors": "Sarshad A, Sadeghifar F, Louvet E, Mori R, Bohm S, Al-Muzzaini B, Vintermist A, Fomproix N, Ostlund AK, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "23555303", "url": "https://glygen.org/publication/PubMed/23555303" } ] }, { "title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23630040", "url": "https://glygen.org/publication/PubMed/23630040" } ] }, { "title": "The chromatin remodeling factor CSB recruits histone acetyltransferase PCAF to rRNA gene promoters in active state for transcription initiation.", "journal": "PloS one", "date": "2013", "authors": "Shen M, Zhou T, Xie W, Ling T, Zhu Q, Zong L, Lyu G, Gao Q, Zhang F, Tao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "23667505", "url": "https://glygen.org/publication/PubMed/23667505" } ] }, { "title": "Convergent evolution of chromatin modification by structurally distinct enzymes: comparative enzymology of histone H3 Lys(2)(7) methylation by human polycomb repressive complex 2 and vSET.", "journal": "The Biochemical journal", "date": "2013", "authors": "Swalm BM, Hallenbeck KK, Majer CR, Jin L, Scott MP, Moyer MP, Copeland RA, Wigle TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "23679895", "url": "https://glygen.org/publication/PubMed/23679895" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "Multivalent histone engagement by the linked tandem Tudor and PHD domains of UHRF1 is required for the epigenetic inheritance of DNA methylation.", "journal": "Genes & development", "date": "2013", "authors": "Rothbart SB, Dickson BM, Ong MS, Krajewski K, Houliston S, Kireev DB, Arrowsmith CH, Strahl BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "23752590", "url": "https://glygen.org/publication/PubMed/23752590" } ] }, { "title": "Human NEIL3 is mainly a monofunctional DNA glycosylase removing spiroimindiohydantoin and guanidinohydantoin.", "journal": "DNA repair", "date": "2013", "authors": "Krokeide SZ, Laerdahl JK, Salah M, Luna L, Cederkvist FH, Fleming AM, Burrows CJ, Dalhus B, Bjoras M", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "23755964", "url": "https://glygen.org/publication/PubMed/23755964" } ] }, { "title": "Concerted interaction between origin recognition complex (ORC), nucleosomes and replication origin DNA ensures stable ORC-origin binding.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2013", "authors": "Hizume K, Yagura M, Araki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "23795651", "url": "https://glygen.org/publication/PubMed/23795651" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.", "journal": "Genes & development", "date": "2013", "authors": "Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23824326", "url": "https://glygen.org/publication/PubMed/23824326" } ] }, { "title": "USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Liu X, Li H, Zhong B, Blonska M, Gorjestani S, Yan M, Tian Q, Zhang DE, Lin X, Dong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23825189", "url": "https://glygen.org/publication/PubMed/23825189" } ] }, { "title": "N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1alpha by human gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Murakami Y, Watari K, Shibata T, Uba M, Ureshino H, Kawahara A, Abe H, Izumi H, Mukaida N, Kuwano M, Ono M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "23846687", "url": "https://glygen.org/publication/PubMed/23846687" } ] }, { "title": "The double-stranded RNA binding domain of human Dicer functions as a nuclear localization signal.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Doyle M, Badertscher L, Jaskiewicz L, Guttinger S, Jurado S, Hugenschmidt T, Kutay U, Filipowicz W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23882114", "url": "https://glygen.org/publication/PubMed/23882114" } ] }, { "title": "Regulation of SirT1-nucleomethylin binding by rRNA coordinates ribosome biogenesis with nutrient availability.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Yang L, Song T, Chen L, Kabra N, Zheng H, Koomen J, Seto E, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359" } ], "reference": [ { "type": "PubMed", "id": "23897426", "url": "https://glygen.org/publication/PubMed/23897426" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "Telomere reduction in human colorectal carcinoma and with ageing.", "journal": "Nature", "date": "1990", "authors": "Hastie ND, Dempster M, Dunlop MG, Thompson AM, Green DK, Allshire RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "2392154", "url": "https://glygen.org/publication/PubMed/2392154" } ] }, { "title": "Human origin recognition complex binds preferentially to G-quadruplex-preferable RNA and single-stranded DNA.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Hoshina S, Yura K, Teranishi H, Kiyasu N, Tominaga A, Kadoma H, Nakatsuka A, Kunichika T, Obuse C, Waga S", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "24003239", "url": "https://glygen.org/publication/PubMed/24003239" } ] }, { "title": "Involvement of a NF-kappa B-like transcription factor in the activation of the interleukin-6 gene by inflammatory lymphokines.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Shimizu H, Mitomo K, Watanabe T, Okamoto S, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2405250", "url": "https://glygen.org/publication/PubMed/2405250" } ] }, { "title": "Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Burska UL, Harle VJ, Coffey K, Darby S, Ramsey H, O'Neill D, Logan IR, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24056413", "url": "https://glygen.org/publication/PubMed/24056413" } ] }, { "title": "Dnmt3L antagonizes DNA methylation at bivalent promoters and favors DNA methylation at gene bodies in ESCs.", "journal": "Cell", "date": "2013", "authors": "Neri F, Krepelova A, Incarnato D, Maldotti M, Parlato C, Galvagni F, Matarese F, Stunnenberg HG, Oliviero S", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "24074865", "url": "https://glygen.org/publication/PubMed/24074865" } ] }, { "title": "Ago1 Interacts with RNA polymerase II and binds to the promoters of actively transcribed genes in human cancer cells.", "journal": "PLoS genetics", "date": "2013", "authors": "Huang V, Zheng J, Qi Z, Wang J, Place RF, Yu J, Li H, Li LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24086155", "url": "https://glygen.org/publication/PubMed/24086155" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.", "journal": "Molecular cell", "date": "2013", "authors": "Kim K, Kim JM, Kim JS, Choi J, Lee YS, Neamati N, Song JS, Heo K, An W", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "iPTMnet", "id": "P04908", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04908" } ], "reference": [ { "type": "PubMed", "id": "24140421", "url": "https://glygen.org/publication/PubMed/24140421" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Hox in motion: tracking HoxA cluster conformation during differentiation.", "journal": "Nucleic acids research", "date": "2014", "authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24174538", "url": "https://glygen.org/publication/PubMed/24174538" } ] }, { "title": "Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.", "journal": "PloS one", "date": "2013", "authors": "Zhong H, Wang D, Fang L, Zhang H, Luo R, Shang M, Ouyang C, Ouyang H, Chen H, Xiao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24260525", "url": "https://glygen.org/publication/PubMed/24260525" } ] }, { "title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.", "journal": "PloS one", "date": "2013", "authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24312487", "url": "https://glygen.org/publication/PubMed/24312487" } ] }, { "title": "Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.", "journal": "Nature", "date": "2014", "authors": "Tessarz P, Santos-Rosa H, Robson SC, Sylvestersen KB, Nelson CJ, Nielsen ML, Kouzarides T", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "24352239", "url": "https://glygen.org/publication/PubMed/24352239" } ] }, { "title": "The UHRF1 protein stimulates the activity and specificity of the maintenance DNA methyltransferase DNMT1 by an allosteric mechanism.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Bashtrykov P, Jankevicius G, Jurkowska RZ, Ragozin S, Jeltsch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "24368767", "url": "https://glygen.org/publication/PubMed/24368767" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.", "journal": "International journal of oncology", "date": "2014", "authors": "Iriyama N, Yuan B, Yoshino Y, Hatta Y, Horikoshi A, Aizawa S, Takei M, Takeuchi J, Takagi N, Toyoda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24379003", "url": "https://glygen.org/publication/PubMed/24379003" } ] }, { "title": "RNAi factors are present and active in human cell nuclei.", "journal": "Cell reports", "date": "2014", "authors": "Gagnon KT, Li L, Chu Y, Janowski BA, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24388755", "url": "https://glygen.org/publication/PubMed/24388755" } ] }, { "title": "USP21 negatively regulates antiviral response by acting as a RIG-I deubiquitinase.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Fan Y, Mao R, Yu Y, Liu S, Shi Z, Cheng J, Zhang H, An L, Zhao Y, Xu X, Chen Z, Kogiso M, Zhang D, Zhang H, Zhang P, Jung JU, Li X, Xu G, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24493797", "url": "https://glygen.org/publication/PubMed/24493797" } ] }, { "title": "CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.", "journal": "Scientific reports", "date": "2014", "authors": "Federzoni EA, Humbert M, Torbett BE, Behre G, Fey MF, Tschan MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24584857", "url": "https://glygen.org/publication/PubMed/24584857" } ] }, { "title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.", "journal": "PLoS genetics", "date": "2014", "authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24586203", "url": "https://glygen.org/publication/PubMed/24586203" } ] }, { "title": "Importin 8 regulates the transport of mature microRNAs into the cell nucleus.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wei Y, Li L, Wang D, Zhang CY, Zen K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24596094", "url": "https://glygen.org/publication/PubMed/24596094" } ] }, { "title": "Lysine 2-hydroxyisobutyrylation is a widely distributed active histone mark.", "journal": "Nature chemical biology", "date": "2014", "authors": "Dai L, Peng C, Montellier E, Lu Z, Chen Y, Ishii H, Debernardi A, Buchou T, Rousseaux S, Jin F, Sabari BR, Deng Z, Allis CD, Ren B, Khochbin S, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "24681537", "url": "https://glygen.org/publication/PubMed/24681537" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.", "journal": "Nature", "date": "2014", "authors": "Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24896179", "url": "https://glygen.org/publication/PubMed/24896179" } ] }, { "title": "Glycogen synthase kinase (GSK) 3beta phosphorylates and protects nuclear myosin 1c from proteasome-mediated degradation to activate rDNA transcription in early G1 cells.", "journal": "PLoS genetics", "date": "2014", "authors": "Sarshad AA, Corcoran M, Al-Muzzaini B, Borgonovo-Brandter L, Von Euler A, Lamont D, Visa N, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "24901984", "url": "https://glygen.org/publication/PubMed/24901984" } ] }, { "title": "New insight into role of myosin motors for activation of RNA polymerases.", "journal": "International review of cell and molecular biology", "date": "2014", "authors": "Sarshad AA, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "24952918", "url": "https://glygen.org/publication/PubMed/24952918" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "Targeting transcription regulation in cancer with a covalent CDK7 inhibitor.", "journal": "Nature", "date": "2014", "authors": "Kwiatkowski N, Zhang T, Rahl PB, Abraham BJ, Reddy J, Ficarro SB, Dastur A, Amzallag A, Ramaswamy S, Tesar B, Jenkins CE, Hannett NM, McMillin D, Sanda T, Sim T, Kim ND, Look T, Mitsiades CS, Weng AP, Brown JR, Benes CH, Marto JA, Young RA, Gray NS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "25043025", "url": "https://glygen.org/publication/PubMed/25043025" } ] }, { "title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.", "journal": "PLoS genetics", "date": "2014", "authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25101834", "url": "https://glygen.org/publication/PubMed/25101834" } ] }, { "title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25135475", "url": "https://glygen.org/publication/PubMed/25135475" } ] }, { "title": "Deubiquitination and stabilization of IL-33 by USP21.", "journal": "International journal of clinical and experimental pathology", "date": "2014", "authors": "Tao L, Chen C, Song H, Piccioni M, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25197364", "url": "https://glygen.org/publication/PubMed/25197364" } ] }, { "title": "Dimer monomer transition and dimer re-formation play important role for ATM cellular function during DNA repair.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Du F, Zhang M, Li X, Yang C, Meng H, Wang D, Chang S, Xu Y, Price B, Sun Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "25240135", "url": "https://glygen.org/publication/PubMed/25240135" } ] }, { "title": "E1A-dependent trans-activation of the human MYC promoter is mediated by the E2F factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hiebert SW, Lipp M, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2524830", "url": "https://glygen.org/publication/PubMed/2524830" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Zhang Z, Yang H, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25305019", "url": "https://glygen.org/publication/PubMed/25305019" } ] }, { "title": "The neuron-specific protein PGP 9.5 is a ubiquitin carboxyl-terminal hydrolase.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Wilkinson KD, Lee KM, Deshpande S, Duerksen-Hughes P, Boss JM, Pohl J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "2530630", "url": "https://glygen.org/publication/PubMed/2530630" } ] }, { "title": "Argonaute-1 binds transcriptional enhancers and controls constitutive and alternative splicing in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Allo M, Agirre E, Bessonov S, Bertucci P, Gomez Acuna L, Buggiano V, Bellora N, Singh B, Petrillo E, Blaustein M, Minana B, Dujardin G, Pozzi B, Pelisch F, Bechara E, Agafonov DE, Srebrow A, Luhrmann R, Valcarcel J, Eyras E, Kornblihtt AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "25313066", "url": "https://glygen.org/publication/PubMed/25313066" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Mansour MR, Abraham BJ, Anders L, Berezovskaya A, Gutierrez A, Durbin AD, Etchin J, Lawton L, Sallan SE, Silverman LB, Loh ML, Hunger SP, Sanda T, Young RA, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "25394790", "url": "https://glygen.org/publication/PubMed/25394790" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.", "journal": "Nature", "date": "2014", "authors": "Bhatnagar S, Gazin C, Chamberlain L, Ou J, Zhu X, Tushir JS, Virbasius CM, Lin L, Zhu LJ, Wajapeyee N, Green MR", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "25470042", "url": "https://glygen.org/publication/PubMed/25470042" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "The deubiquitinating enzyme USP24 is a regulator of the UV damage response.", "journal": "Cell reports", "date": "2015", "authors": "Zhang L, Nemzow L, Chen H, Lubin A, Rong X, Sun Z, Harris TK, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25578727", "url": "https://glygen.org/publication/PubMed/25578727" } ] }, { "title": "Alternative lengthening of telomeres renders cancer cells hypersensitive to ATR inhibitors.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Flynn RL, Cox KE, Jeitany M, Wakimoto H, Bryll AR, Ganem NJ, Bersani F, Pineda JR, Suva ML, Benes CH, Haber DA, Boussin FD, Zou L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "25593184", "url": "https://glygen.org/publication/PubMed/25593184" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "A Meier-Gorlin syndrome mutation impairs the ORC1-nucleosome association.", "journal": "ACS chemical biology", "date": "2015", "authors": "Zhang W, Sankaran S, Gozani O, Song J", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "25689043", "url": "https://glygen.org/publication/PubMed/25689043" } ] }, { "title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.", "journal": "Differentiation; research in biological diversity", "date": "1989", "authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "2570724", "url": "https://glygen.org/publication/PubMed/2570724" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "Orc1 Binding to Mitotic Chromosomes Precedes Spatial Patterning during G1 Phase and Assembly of the Origin Recognition Complex in Human Cells.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Kara N, Hossain M, Prasanth SG, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "25784553", "url": "https://glygen.org/publication/PubMed/25784553" } ] }, { "title": "miR-191 promotes tumorigenesis of human colorectal cancer through targeting C/EBPbeta.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang XF, Li KK, Gao L, Li SZ, Chen K, Zhang JB, Wang D, Tu RF, Zhang JX, Tao KX, Wang G, Zhang XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "25784653", "url": "https://glygen.org/publication/PubMed/25784653" } ] }, { "title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.", "journal": "FEBS letters", "date": "2015", "authors": "Lonfat N, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25913784", "url": "https://glygen.org/publication/PubMed/25913784" } ] }, { "title": "A novel RNA binding surface of the TAM domain of TIP5/BAZ2A mediates epigenetic regulation of rRNA genes.", "journal": "Nucleic acids research", "date": "2015", "authors": "Anosova I, Melnik S, Tripsianes K, Kateb F, Grummt I, Sattler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "25916849", "url": "https://glygen.org/publication/PubMed/25916849" } ] }, { "title": "Loss of RUNX1/AML1 arginine-methylation impairs peripheral T cell homeostasis.", "journal": "British journal of haematology", "date": "2015", "authors": "Mizutani S, Yoshida T, Zhao X, Nimer SD, Taniwaki M, Okuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "26010396", "url": "https://glygen.org/publication/PubMed/26010396" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "Genetic Inactivation of ATRX Leads to a Decrease in the Amount of Telomeric Cohesin and Level of Telomere Transcription in Human Glioma Cells.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Eid R, Demattei MV, Episkopou H, Auge-Gouillou C, Decottignies A, Grandin N, Charbonneau M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "26055325", "url": "https://glygen.org/publication/PubMed/26055325" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "NEIL1 p.Gln282Stop variant is predominantly localized in the cytoplasm and exhibits reduced activity in suppressing mutations.", "journal": "Gene", "date": "2015", "authors": "Shinmura K, Kato H, Kawanishi Y, Goto M, Tao H, Inoue Y, Nakamura S, Sugimura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "26095805", "url": "https://glygen.org/publication/PubMed/26095805" } ] }, { "title": "Belinostat in Patients With Relapsed or Refractory Peripheral T-Cell Lymphoma: Results of the Pivotal Phase II BELIEF (CLN-19) Study.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2015", "authors": "O'Connor OA, Horwitz S, Masszi T, Van Hoof A, Brown P, Doorduijn J, Hess G, Jurczak W, Knoblauch P, Chawla S, Bhat G, Choi MR, Walewski J, Savage K, Foss F, Allen LF, Shustov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "26101246", "url": "https://glygen.org/publication/PubMed/26101246" } ] }, { "title": "Drosophila model of Meier-Gorlin syndrome based on the mutation in a conserved C-Terminal domain of Orc6.", "journal": "American journal of medical genetics. Part A", "date": "2015", "authors": "Balasov M, Akhmetova K, Chesnokov I", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "26139588", "url": "https://glygen.org/publication/PubMed/26139588" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "Cytomegalovirus latency and reactivation: recent insights into an age old problem.", "journal": "Reviews in medical virology", "date": "2016", "authors": "Dupont L, Reeves MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "26572645", "url": "https://glygen.org/publication/PubMed/26572645" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Protein Kinase Ciota Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.", "journal": "Cancer cell", "date": "2016", "authors": "Ali SA, Justilien V, Jamieson L, Murray NR, Fields AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "26977885", "url": "https://glygen.org/publication/PubMed/26977885" } ] }, { "title": "Structure and function of human histone H3.Y nucleosome.", "journal": "Nucleic Acids Res.", "date": "2016", "authors": "Kujirai T, Horikoshi N, Sato K, Maehara K, Machida S, Osakabe A, Kimura H, Ohkawa Y, Kurumizaka H", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "27016736", "url": "https://glygen.org/publication/PubMed/27016736" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "USP51 deubiquitylates H2AK13,15ub and regulates DNA damage response.", "journal": "Genes & development", "date": "2016", "authors": "Wang Z, Zhang H, Liu J, Cheruiyot A, Lee JH, Ordog T, Lou Z, You Z, Zhang Z", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "27083998", "url": "https://glygen.org/publication/PubMed/27083998" } ] }, { "title": "Metabolic Regulation of Gene Expression by Histone Lysine beta-Hydroxybutyrylation.", "journal": "Molecular cell", "date": "2016", "authors": "Xie Z, Zhang D, Chung D, Tang Z, Huang H, Dai L, Qi S, Li J, Colak G, Chen Y, Xia C, Peng C, Ruan H, Kirkey M, Wang D, Jensen LM, Kwon OK, Lee S, Pletcher SD, Tan M, Lombard DB, White KP, Zhao H, Li J, Roeder RG, Yang X, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "27105115", "url": "https://glygen.org/publication/PubMed/27105115" } ] }, { "title": "SCL/TAL1 in Hematopoiesis and Cellular Reprogramming.", "journal": "Current topics in developmental biology", "date": "2016", "authors": "Hoang T, Lambert JA, Martin R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "27137657", "url": "https://glygen.org/publication/PubMed/27137657" } ] }, { "title": "Nuclear factor E2F mediates basic transcription and trans-activation by E1a of the human MYC promoter.", "journal": "Genes & development", "date": "1989", "authors": "Thalmeier K, Synovzik H, Mertz R, Winnacker EL, Lipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2721961", "url": "https://glygen.org/publication/PubMed/2721961" } ] }, { "title": "Tautomerization-dependent recognition and excision of oxidation damage in base-excision DNA repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Zhu C, Lu L, Zhang J, Yue Z, Song J, Zong S, Liu M, Stovicek O, Gao YQ, Yi C", "evidence": [ { "database": "Reactome", "id": "R-HSA-110329", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110329" } ], "reference": [ { "type": "PubMed", "id": "27354518", "url": "https://glygen.org/publication/PubMed/27354518" } ] }, { "title": "Human Cytomegalovirus Latency: Approaching the Gordian Knot.", "journal": "Annual review of virology", "date": "2016", "authors": "Goodrum F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "27501258", "url": "https://glygen.org/publication/PubMed/27501258" } ] }, { "title": "Novel O-GlcNAcylation on Ser(40) of canonical H2A isoforms specific to viviparity.", "journal": "Scientific reports", "date": "2016", "authors": "Hirosawa M, Hayakawa K, Yoneda C, Arai D, Shiota H, Suzuki T, Tanaka S, Dohmae N, Shiota K", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P04908", "url": "https://oglcnac.org/atlas/detail/P04908" } ], "reference": [ { "type": "PubMed", "id": "27615797", "url": "https://glygen.org/publication/PubMed/27615797" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "DFNA5 promoter methylation a marker for breast tumorigenesis.", "journal": "Oncotarget", "date": "2017", "authors": "Croes L, de Beeck KO, Pauwels P, Vanden Berghe W, Peeters M, Fransen E, Van Camp G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "28404884", "url": "https://glygen.org/publication/PubMed/28404884" } ] }, { "title": "Viral gene products actively promote latent infection by epigenetic silencing mechanisms.", "journal": "Current opinion in virology", "date": "2017", "authors": "Knipe DM, Raja P, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "28415052", "url": "https://glygen.org/publication/PubMed/28415052" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "NEIL3 Repairs Telomere Damage during S Phase to Secure Chromosome Segregation at Mitosis.", "journal": "Cell reports", "date": "2017", "authors": "Zhou J, Chan J, Lambele M, Yusufzai T, Stumpff J, Opresko PL, Thali M, Wallace SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "28854357", "url": "https://glygen.org/publication/PubMed/28854357" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "H2A O-GlcNAcylation at serine 40 functions genomic protection in association with acetylated H2AZ or gammaH2AX.", "journal": "Epigenetics & chromatin", "date": "2017", "authors": "Hayakawa K, Hirosawa M, Tani R, Yoneda C, Tanaka S, Shiota K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04908", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908" } ], "reference": [ { "type": "PubMed", "id": "29084613", "url": "https://glygen.org/publication/PubMed/29084613" } ] }, { "title": "Human NOTCH4 is a key target of RUNX1 in megakaryocytic differentiation.", "journal": "Blood", "date": "2018", "authors": "Li Y, Jin C, Bai H, Gao Y, Sun S, Chen L, Qin L, Liu PP, Cheng L, Wang QF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "29101237", "url": "https://glygen.org/publication/PubMed/29101237" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "C/EBPalpha overrides epigenetic reprogramming by oncogenic transcription factors in acute myeloid leukemia.", "journal": "Blood advances", "date": "2018", "authors": "Loke J, Chin PS, Keane P, Pickin A, Assi SA, Ptasinska A, Imperato MR, Cockerill PN, Bonifer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "29431622", "url": "https://glygen.org/publication/PubMed/29431622" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "HCMV miRNA Targets Reveal Important Cellular Pathways for Viral Replication, Latency, and Reactivation.", "journal": "Non-coding RNA", "date": "2018", "authors": "Diggins NL, Hancock MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30360396", "url": "https://glygen.org/publication/PubMed/30360396" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "HCMV latency: what regulates the regulators?", "journal": "Medical microbiology and immunology", "date": "2019", "authors": "Elder E, Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30761409", "url": "https://glygen.org/publication/PubMed/30761409" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "Methylation analysis of Gasdermin E shows great promise as a biomarker for colorectal cancer.", "journal": "Cancer medicine", "date": "2019", "authors": "Ibrahim J, Op de Beeck K, Fransen E, Croes L, Beyens M, Suls A, Vanden Berghe W, Peeters M, Van Camp G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "30993897", "url": "https://glygen.org/publication/PubMed/30993897" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "Glutarylation of Histone H4 Lysine 91 Regulates Chromatin Dynamics.", "journal": "Molecular cell", "date": "2019", "authors": "Bao X, Liu Z, Zhang W, Gladysz K, Fung YME, Tian G, Xiong Y, Wong JWH, Yuen KWY, Li XD", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "31542297", "url": "https://glygen.org/publication/PubMed/31542297" } ] }, { "title": "Gasdermin E suppresses tumour growth by activating anti-tumour immunity.", "journal": "Nature", "date": "2020", "authors": "Zhang Z, Zhang Y, Xia S, Kong Q, Li S, Liu X, Junqueira C, Meza-Sosa KF, Mok TMY, Ansara J, Sengupta S, Yao Y, Wu H, Lieberman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "32188940", "url": "https://glygen.org/publication/PubMed/32188940" } ] }, { "title": "Methylation-directed glycosylation of chromatin factors represses retrotransposon promoters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Boulard M, Rucli S, Edwards JR, Bestor TH", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04908", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04908" } ], "reference": [ { "type": "PubMed", "id": "32522876", "url": "https://glygen.org/publication/PubMed/32522876" } ] }, { "title": "The dynamic nature of the human origin recognition complex revealed through five cryoEM structures.", "journal": "eLife", "date": "2020", "authors": "Jaremko MJ, On KF, Thomas DR, Stillman B, Joshua-Tor L", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "32808929", "url": "https://glygen.org/publication/PubMed/32808929" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Structural basis for the inhibition of cGAS by nucleosomes.", "journal": "Science", "date": "2020", "authors": "Kujirai T, Zierhut C, Takizawa Y, Kim R, Negishi L, Uruma N, Hirai S, Funabiki H, Kurumizaka H", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "32912999", "url": "https://glygen.org/publication/PubMed/32912999" } ] }, { "title": "Structural basis for nucleosome-mediated inhibition of cGAS activity.", "journal": "Cell Res.", "date": "2020", "authors": "Cao D, Han X, Fan X, Xu RM, Zhang X", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "33051594", "url": "https://glygen.org/publication/PubMed/33051594" } ] }, { "title": "Structural insight into the assembly and conformational activation of human origin recognition complex.", "journal": "Cell discovery", "date": "2020", "authors": "Cheng J, Li N, Wang X, Hu J, Zhai Y, Gao N", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "33298899", "url": "https://glygen.org/publication/PubMed/33298899" } ] }, { "title": "Investigation of the Interaction of Human Origin Recognition Complex Subunit 1 with G-Quadruplex DNAs of Human c-myc Promoter and Telomere Regions.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Eladl A, Yamaoki Y, Hoshina S, Horinouchi H, Kondo K, Waga S, Nagata T, Katahira M", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "33801762", "url": "https://glygen.org/publication/PubMed/33801762" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Rolling back human pluripotent stem cells to an eight-cell embryo-like stage.", "journal": "Nature", "date": "2022-05", "authors": "Mazid Md Abdul, Ward Carl, Luo Zhiwei, Liu Chuanyu, Li Yunpan, Lai Yiwei, Wu Liang, Li Jinxiu, Jia Wenqi, Jiang Yu, Liu Hao, Fu Lixin, Yang Yueli, Iba\u00f1ez David P, Lai Junjian, Wei Xiaoyu, An Juan, Guo Pengcheng, Yuan Yue, Deng Qiuting, Wang Yang, Liu Ying, Gao Fei, Wang Junwen, Zaman Shahriar, Qin Baoming, Wu Guangming, Maxwell Patrick H, Xu Xun, Liu Longqi, Li Wenjuan, Esteban Miguel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "35314832", "url": "https://glygen.org/publication/PubMed/35314832" } ] }, { "title": "Inhibition of HIST1H2AB suppresses the proliferation of lung adenocarcinoma.", "journal": "The journal of gene medicine", "date": "2023-05", "authors": "Chai Xiaojun, Wang Guangxue, Hong Xuan, Feng Minghao, Wang He, Liu Fabing, Yao Wei, Zhu Dongyi, Li Qinchuan", "evidence": [ { "database": "RefSeq", "id": "NP_003504", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003504" } ], "reference": [ { "type": "PubMed", "id": "36511295", "url": "https://glygen.org/publication/PubMed/36511295" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "The primary structure and expression of four cloned human histone genes.", "journal": "Nucleic Acids Res.", "date": "1983", "authors": "Zhong R, Roeder R G, Heintz N", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "6647026", "url": "https://glygen.org/publication/PubMed/6647026" } ] }, { "title": "Escherichia coli, Saccharomyces cerevisiae, rat and human 3-methyladenine DNA glycosylases repair 1,N6-ethenoadenine when present in DNA.", "journal": "Nucleic acids research", "date": "1995", "authors": "Saparbaev M, Kleibl K, Laval J", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "7479006", "url": "https://glygen.org/publication/PubMed/7479006" } ] }, { "title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7488013", "url": "https://glygen.org/publication/PubMed/7488013" } ] }, { "title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "1996", "authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7501971", "url": "https://glygen.org/publication/PubMed/7501971" } ] }, { "title": "FR901228, a novel antitumor bicyclic depsipeptide produced by Chromobacterium violaceum No. 968. I. Taxonomy, fermentation, isolation, physico-chemical and biological properties, and antitumor activity.", "journal": "The Journal of antibiotics", "date": "1994", "authors": "Ueda H, Nakajima H, Hori Y, Fujita T, Nishimura M, Goto T, Okuhara M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "7513682", "url": "https://glygen.org/publication/PubMed/7513682" } ] }, { "title": "Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Raingeaud J, Gupta S, Rogers JS, Dickens M, Han J, Ulevitch RJ, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7535770", "url": "https://glygen.org/publication/PubMed/7535770" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Metabolism of the polyubiquitin degradation signal: structure, mechanism, and role of isopeptidase T.", "journal": "Biochemistry", "date": "1995", "authors": "Wilkinson KD, Tashayev VL, O'Connor LB, Larsen CN, Kasperek E, Pickart CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "7578059", "url": "https://glygen.org/publication/PubMed/7578059" } ] }, { "title": "The Mos/MAP kinase pathway stabilizes c-Fos by phosphorylation and augments its transforming activity in NIH 3T3 cells.", "journal": "The EMBO journal", "date": "1995", "authors": "Okazaki K, Sagata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ] }, { "title": "Molecular coevolution of mammalian ribosomal gene terminator sequences and the transcription termination factor TTF-I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Evers R, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "7597036", "url": "https://glygen.org/publication/PubMed/7597036" } ] }, { "title": "Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA.", "journal": "Nature", "date": "1995", "authors": "Glover JN, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7816143", "url": "https://glygen.org/publication/PubMed/7816143" } ] }, { "title": "A retinoic acid-triggered cascade of HOXB1 gene activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ogura T, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7831296", "url": "https://glygen.org/publication/PubMed/7831296" } ] }, { "title": "Lack of cyclin D-Cdk complexes in Rb-negative cells correlates with high levels of p16INK4/MTS1 tumour suppressor gene product.", "journal": "The EMBO journal", "date": "1995", "authors": "Parry D, Bates S, Mann DJ, Peters G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7859739", "url": "https://glygen.org/publication/PubMed/7859739" } ] }, { "title": "Autoregulation of the human C/EBP alpha gene by stimulation of upstream stimulatory factor binding.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Timchenko N, Wilson DR, Taylor LR, Abdelsayed S, Wilde M, Sawadogo M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "7862113", "url": "https://glygen.org/publication/PubMed/7862113" } ] }, { "title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.", "journal": "Blood", "date": "1994", "authors": "Sengupta PK, Lavelle DE, DeSimone J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7906964", "url": "https://glygen.org/publication/PubMed/7906964" } ] }, { "title": "Regulation of the human HOXD4 gene by retinoids.", "journal": "Mechanisms of development", "date": "1993", "authors": "Moroni MC, Vigano MA, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7908827", "url": "https://glygen.org/publication/PubMed/7908827" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.", "journal": "Genes & development", "date": "1994", "authors": "Guan KL, Jenkins CW, Li Y, Nichols MA, Wu X, O'Keefe CL, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8001816", "url": "https://glygen.org/publication/PubMed/8001816" } ] }, { "title": "Excision of hypoxanthine from DNA containing dIMP residues by the Escherichia coli, yeast, rat, and human alkylpurine DNA glycosylases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Saparbaev M, Laval J", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "8016081", "url": "https://glygen.org/publication/PubMed/8016081" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.", "journal": "Nature", "date": "1994", "authors": "Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8078588", "url": "https://glygen.org/publication/PubMed/8078588" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "1,N6-ethenoadenine is preferred over 3-methyladenine as substrate by a cloned human N-methylpurine-DNA glycosylase (3-methyladenine-DNA glycosylase).", "journal": "Biochemistry", "date": "1994", "authors": "Dosanjh MK, Roy R, Mitra S, Singer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "8110764", "url": "https://glygen.org/publication/PubMed/8110764" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Substrate specificity of the Escherichia coli endonuclease III: excision of thymine- and cytosine-derived lesions in DNA produced by radiation-generated free radicals.", "journal": "Biochemistry", "date": "1993", "authors": "Dizdaroglu M, Laval J, Boiteux S", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "8218289", "url": "https://glygen.org/publication/PubMed/8218289" } ] }, { "title": "Transcription factors NF-IL6 and NF-kappa B synergistically activate transcription of the inflammatory cytokines, interleukin 6 and interleukin 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Matsusaka T, Fujikawa K, Nishio Y, Mukaida N, Matsushima K, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8234276", "url": "https://glygen.org/publication/PubMed/8234276" } ] }, { "title": "The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases.", "journal": "Cell", "date": "1993", "authors": "Harper JW, Adami GR, Wei N, Keyomarsi K, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "8242751", "url": "https://glygen.org/publication/PubMed/8242751" } ] }, { "title": "WAF1, a potential mediator of p53 tumor suppression.", "journal": "Cell", "date": "1993", "authors": "el-Deiry WS, Tokino T, Velculescu VE, Levy DB, Parsons R, Trent JM, Lin D, Mercer WE, Kinzler KW, Vogelstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "8242752", "url": "https://glygen.org/publication/PubMed/8242752" } ] }, { "title": "A new regulatory motif in cell-cycle control causing specific inhibition of cyclin D/CDK4.", "journal": "Nature", "date": "1993", "authors": "Serrano M, Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8259215", "url": "https://glygen.org/publication/PubMed/8259215" } ] }, { "title": "Purification and characterization of human 3-methyladenine-DNA glycosylase.", "journal": "Nucleic acids research", "date": "1993", "authors": "O'Connor TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "8284199", "url": "https://glygen.org/publication/PubMed/8284199" } ] }, { "title": "The p53-mdm-2 autoregulatory feedback loop.", "journal": "Genes & development", "date": "1993", "authors": "Wu X, Bayle JH, Olson D, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8319905", "url": "https://glygen.org/publication/PubMed/8319905" } ] }, { "title": "Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Nakajima T, Kinoshita S, Sasagawa T, Sasaki K, Naruto M, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8384717", "url": "https://glygen.org/publication/PubMed/8384717" } ] }, { "title": "The purification of a mismatch-specific thymine-DNA glycosylase from HeLa cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Neddermann P, Jiricny J", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "8407958", "url": "https://glygen.org/publication/PubMed/8407958" } ] }, { "title": "NF-kappa B subunit-specific regulation of the interleukin-8 promoter.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Kunsch C, Rosen CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413215", "url": "https://glygen.org/publication/PubMed/8413215" } ] }, { "title": "Distinct mechanisms for regulation of the interleukin-8 gene involve synergism and cooperativity between C/EBP and NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Stein B, Baldwin AS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413306", "url": "https://glygen.org/publication/PubMed/8413306" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "Structure of the human 3-methyladenine DNA glycosylase gene and localization close to the 16p telomere.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Vickers MA, Vyas P, Harris PC, Simmons DL, Higgs DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "8475094", "url": "https://glygen.org/publication/PubMed/8475094" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "Interleukin-1 alpha activates an NF-kappaB-like factor in osteoclast-like cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8617720", "url": "https://glygen.org/publication/PubMed/8617720" } ] }, { "title": "MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Raingeaud J, Whitmarsh AJ, Barrett T, Derijard B, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622669", "url": "https://glygen.org/publication/PubMed/8622669" } ] }, { "title": "3pK, a new mitogen-activated protein kinase-activated protein kinase located in the small cell lung cancer tumor suppressor gene region.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Sithanandam G, Latif F, Duh FM, Bernal R, Smola U, Li H, Kuzmin I, Wixler V, Geil L, Shrestha S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622688", "url": "https://glygen.org/publication/PubMed/8622688" } ] }, { "title": "Identification of mitogen-activated protein (MAP) kinase-activated protein kinase-3, a novel substrate of CSBP p38 MAP kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "McLaughlin MM, Kumar S, McDonnell PC, Van Horn S, Lee JC, Livi GP, Young PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8626550", "url": "https://glygen.org/publication/PubMed/8626550" } ] }, { "title": "Cloning and expression of human G/T mismatch-specific thymine-DNA glycosylase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Neddermann P, Gallinari P, Lettieri T, Schmid D, Truong O, Hsuan JJ, Wiebauer K, Jiricny J", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "8662714", "url": "https://glygen.org/publication/PubMed/8662714" } ] }, { "title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.", "journal": "Development (Cambridge, England)", "date": "1996", "authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8674428", "url": "https://glygen.org/publication/PubMed/8674428" } ] }, { "title": "The transcription factor AP-1 binds to the human interleukin 1 alpha promoter.", "journal": "European cytokine network", "date": "1996", "authors": "Bailly S, Fay M, Israel N, Gougerot-Pocidalo MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8688489", "url": "https://glygen.org/publication/PubMed/8688489" } ] }, { "title": "PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells.", "journal": "Blood", "date": "1996", "authors": "Smith LT, Hohaus S, Gonzalez DA, Dziennis SE, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8695841", "url": "https://glygen.org/publication/PubMed/8695841" } ] }, { "title": "Isolation and characterization of p19INK4d, a p16-related inhibitor specific to CDK6 and CDK4.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Guan KL, Jenkins CW, Li Y, O'Keefe CL, Noh S, Wu X, Zariwala M, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8741839", "url": "https://glygen.org/publication/PubMed/8741839" } ] }, { "title": "XTcf-3 transcription factor mediates beta-catenin-induced axis formation in Xenopus embryos.", "journal": "Cell", "date": "1996", "authors": "Molenaar M, van de Wetering M, Oosterwegel M, Peterson-Maduro J, Godsave S, Korinek V, Roose J, Destree O, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "8756721", "url": "https://glygen.org/publication/PubMed/8756721" } ] }, { "title": "Functional interaction of beta-catenin with the transcription factor LEF-1.", "journal": "Nature", "date": "1996", "authors": "Behrens J, von Kries JP, Kuhl M, Bruhn L, Wedlich D, Grosschedl R, Birchmeier W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "8757136", "url": "https://glygen.org/publication/PubMed/8757136" } ] }, { "title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.", "journal": "Nucleic acids research", "date": "1996", "authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8759021", "url": "https://glygen.org/publication/PubMed/8759021" } ] }, { "title": "A comparison of the substrate specificity of MAPKAP kinase-2 and MAPKAP kinase-3 and their activation by cytokines and cellular stress.", "journal": "FEBS letters", "date": "1996", "authors": "Clifton AD, Young PR, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8774846", "url": "https://glygen.org/publication/PubMed/8774846" } ] }, { "title": "Centromere and telomere movements during early meiotic prophase of mouse and man are associated with the onset of chromosome pairing.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Scherthan H, Weich S, Schwegler H, Heyting C, Harle M, Cremer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "8794855", "url": "https://glygen.org/publication/PubMed/8794855" } ] }, { "title": "Identification of novel phosphorylation sites required for activation of MAPKAP kinase-2.", "journal": "The EMBO journal", "date": "1995", "authors": "Ben-Levy R, Leighton IA, Doza YN, Attwood P, Morrice N, Marshall CJ, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8846784", "url": "https://glygen.org/publication/PubMed/8846784" } ] }, { "title": "CCAAT/enhancer-binding protein alpha (C/EBP alpha) inhibits cell proliferation through the p21 (WAF-1/CIP-1/SDI-1) protein.", "journal": "Genes & development", "date": "1996", "authors": "Timchenko NA, Wilde M, Nakanishi M, Smith JR, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8846917", "url": "https://glygen.org/publication/PubMed/8846917" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Notch3 mutations in CADASIL, a hereditary adult-onset condition causing stroke and dementia.", "journal": "Nature", "date": "1996", "authors": "Joutel A, Corpechot C, Ducros A, Vahedi K, Chabriat H, Mouton P, Alamowitch S, Domenga V, Cecillion M, Marechal E, Maciazek J, Vayssiere C, Cruaud C, Cabanis EA, Ruchoux MM, Weissenbach J, Bach JF, Bousser MG, Tournier-Lasserve E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "8878478", "url": "https://glygen.org/publication/PubMed/8878478" } ] }, { "title": "Dermatotoxic chemical stimulate of c-jun and c-fos transcription and AP-1 DNA binding in human keratinocytes.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1996", "authors": "Burleson FG, Simeonova PP, Germolec DR, Luster MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8884985", "url": "https://glygen.org/publication/PubMed/8884985" } ] }, { "title": "Human Rad51 protein promotes ATP-dependent homologous pairing and strand transfer reactions in vitro.", "journal": "Cell", "date": "1996", "authors": "Baumann P, Benson FE, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "8929543", "url": "https://glygen.org/publication/PubMed/8929543" } ] }, { "title": "An AP-1 site is involved in the NGF induction of IL-1 alpha in PC12 cells.", "journal": "Neurochemistry international", "date": "1996", "authors": "Alheim K, McDowell TL, Symons JA, Duff GW, Bartfai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8939459", "url": "https://glygen.org/publication/PubMed/8939459" } ] }, { "title": "Products of the grg (Groucho-related gene) family can dimerize through the amino-terminal Q domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Pinto M, Lobe CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "8955148", "url": "https://glygen.org/publication/PubMed/8955148" } ] }, { "title": "Induction of apoptosis by ASK1, a mammalian MAPKKK that activates SAPK/JNK and p38 signaling pathways.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Ichijo H, Nishida E, Irie K, ten Dijke P, Saitoh M, Moriguchi T, Takagi M, Matsumoto K, Miyazono K, Gotoh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8974401", "url": "https://glygen.org/publication/PubMed/8974401" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "Association of BRCA1 with Rad51 in mitotic and meiotic cells.", "journal": "Cell", "date": "1997", "authors": "Scully R, Chen J, Plug A, Xiao Y, Weaver D, Feunteun J, Ashley T, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "9008167", "url": "https://glygen.org/publication/PubMed/9008167" } ] }, { "title": "Regulatory mechanisms involved in activator-protein-1 (AP-1)-mediated activation of glutathione-S-transferase gene expression by chemical agents.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Ainbinder E, Bergelson S, Pinkus R, Daniel V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9030721", "url": "https://glygen.org/publication/PubMed/9030721" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "Armadillo coactivates transcription driven by the product of the Drosophila segment polarity gene dTCF.", "journal": "Cell", "date": "1997", "authors": "van de Wetering M, Cavallo R, Dooijes D, van Beest M, van Es J, Loureiro J, Ypma A, Hursh D, Jones T, Bejsovec A, Peifer M, Mortin M, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9118222", "url": "https://glygen.org/publication/PubMed/9118222" } ] }, { "title": "Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.", "journal": "Cell", "date": "1997", "authors": "Zhang Y, Iratni R, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9150135", "url": "https://glygen.org/publication/PubMed/9150135" } ] }, { "title": "Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Deacon K, Blank JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9162092", "url": "https://glygen.org/publication/PubMed/9162092" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG, Xanthopoulos KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "9177240", "url": "https://glygen.org/publication/PubMed/9177240" } ] }, { "title": "Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue.", "journal": "Cancer research", "date": "1997", "authors": "Aburatani H, Hippo Y, Ishida T, Takashima R, Matsuba C, Kodama T, Takao M, Yasui A, Yamamoto K, Asano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "9187114", "url": "https://glygen.org/publication/PubMed/9187114" } ] }, { "title": "A novel mechanism of JNK1 activation. Nuclear translocation and activation of JNK1 during ischemia and reperfusion.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizukami Y, Yoshioka K, Morimoto S, Yoshida Ki", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9195981", "url": "https://glygen.org/publication/PubMed/9195981" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Cloning and characterization of a mammalian 8-oxoguanine DNA glycosylase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Rosenquist TA, Zharkov DO, Grollman AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "9207108", "url": "https://glygen.org/publication/PubMed/9207108" } ] }, { "title": "A novel class of RanGTP binding proteins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Gorlich D, Dabrowski M, Bischoff FR, Kutay U, Bork P, Hartmann E, Prehn S, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "9214382", "url": "https://glygen.org/publication/PubMed/9214382" } ] }, { "title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Di Rocco G, Mavilio F, Zappavigna V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9218805", "url": "https://glygen.org/publication/PubMed/9218805" } ] }, { "title": "Cloning and characterization of hOGG1, a human homolog of the OGG1 gene of Saccharomyces cerevisiae.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Radicella JP, Dherin C, Desmaze C, Fox MS, Boiteux S", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "9223305", "url": "https://glygen.org/publication/PubMed/9223305" } ] }, { "title": "Molecular cloning and functional expression of a human cDNA encoding the antimutator enzyme 8-hydroxyguanine-DNA glycosylase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Roldan-Arjona T, Wei YF, Carter KC, Klungland A, Anselmino C, Wang RP, Augustus M, Lindahl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "9223306", "url": "https://glygen.org/publication/PubMed/9223306" } ] }, { "title": "HOXD4 and regulation of the group 4 paralog genes.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9272954", "url": "https://glygen.org/publication/PubMed/9272954" } ] }, { "title": "Protein-protein interactions in the synaptonemal complex.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Tarsounas M, Pearlman RE, Gasser PJ, Park MS, Moens PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1221632", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632" } ], "reference": [ { "type": "PubMed", "id": "9285814", "url": "https://glygen.org/publication/PubMed/9285814" } ] }, { "title": "Distribution of the Rad51 recombinase in human and mouse spermatocytes.", "journal": "The EMBO journal", "date": "1997", "authors": "Barlow AL, Benson FE, West SC, Hulten MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9311981", "url": "https://glygen.org/publication/PubMed/9311981" } ] }, { "title": "Opposite base-dependent reactions of a human base excision repair enzyme on DNA containing 7,8-dihydro-8-oxoguanine and abasic sites.", "journal": "The EMBO journal", "date": "1997", "authors": "Bjoras M, Luna L, Johnsen B, Hoff E, Haug T, Rognes T, Seeberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "9321410", "url": "https://glygen.org/publication/PubMed/9321410" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "Nucleosomal DNA regulates the core-histone-binding subunit of the human Hat1 acetyltransferase.", "journal": "Current biology : CB", "date": "1998", "authors": "Verreault A, Kaufman PD, Kobayashi R, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "9427644", "url": "https://glygen.org/publication/PubMed/9427644" } ] }, { "title": "Release of normal bases from intact DNA by a native DNA repair enzyme.", "journal": "The EMBO journal", "date": "1998", "authors": "Berdal KG, Johansen RF, Seeberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-110331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110331" } ], "reference": [ { "type": "PubMed", "id": "9430628", "url": "https://glygen.org/publication/PubMed/9430628" } ] }, { "title": "The human histone gene cluster at the D6S105 locus.", "journal": "Hum. Genet.", "date": "1997", "authors": "Albig W, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "reference": [ { "type": "PubMed", "id": "9439656", "url": "https://glygen.org/publication/PubMed/9439656" } ] }, { "title": "Synergistic actions of Rad51 and Rad52 in recombination and DNA repair.", "journal": "Nature", "date": "1998", "authors": "Benson FE, Baumann P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9450758", "url": "https://glygen.org/publication/PubMed/9450758" } ] }, { "title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.", "journal": "The EMBO journal", "date": "1998", "authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9482740", "url": "https://glygen.org/publication/PubMed/9482740" } ] }, { "title": "Two members of the Tcf family implicated in Wnt/beta-catenin signaling during embryogenesis in the mouse.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Korinek V, Barker N, Willert K, Molenaar M, Roose J, Wagenaar G, Markman M, Lamers W, Destree O, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9488439", "url": "https://glygen.org/publication/PubMed/9488439" } ] }, { "title": "Molecular cloning of translocation t(1;14)(q21;q32) defines a novel gene (BCL9) at chromosome 1q21.", "journal": "Blood", "date": "1998", "authors": "Willis TG, Zalcberg IR, Coignet LJ, Wlodarska I, Stul M, Jadayel DM, Bastard C, Treleaven JG, Catovsky D, Silva ML, Dyer MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9490669", "url": "https://glygen.org/publication/PubMed/9490669" } ] }, { "title": "BAP1: a novel ubiquitin hydrolase which binds to the BRCA1 RING finger and enhances BRCA1-mediated cell growth suppression.", "journal": "Oncogene", "date": "1998", "authors": "Jensen DE, Proctor M, Marquis ST, Gardner HP, Ha SI, Chodosh LA, Ishov AM, Tommerup N, Vissing H, Sekido Y, Minna J, Borodovsky A, Schultz DC, Wilkinson KD, Maul GG, Barlev N, Berger SL, Prendergast GC, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "9528852", "url": "https://glygen.org/publication/PubMed/9528852" } ] }, { "title": "ARF promotes MDM2 degradation and stabilizes p53: ARF-INK4a locus deletion impairs both the Rb and p53 tumor suppression pathways.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, Xiong Y, Yarbrough WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9529249", "url": "https://glygen.org/publication/PubMed/9529249" } ] }, { "title": "A novel fusion between MOZ and the nuclear receptor coactivator TIF2 in acute myeloid leukemia.", "journal": "Blood", "date": "1998", "authors": "Carapeti M, Aguiar RC, Goldman JM, Cross NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "9558366", "url": "https://glygen.org/publication/PubMed/9558366" } ] }, { "title": "Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1.", "journal": "The EMBO journal", "date": "1998", "authors": "Saitoh M, Nishitoh H, Fujii M, Takeda K, Tobiume K, Sawada Y, Kawabata M, Miyazono K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9564042", "url": "https://glygen.org/publication/PubMed/9564042" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tang J, Gary JD, Clarke S, Herschman HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "9642256", "url": "https://glygen.org/publication/PubMed/9642256" } ] }, { "title": "SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.", "journal": "Molecular cell", "date": "1998", "authors": "Zhang Y, Sun ZW, Iratni R, Erdjument-Bromage H, Tempst P, Hampsey M, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9651585", "url": "https://glygen.org/publication/PubMed/9651585" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "Cloning, characterization, and the complete 56.8-kilobase DNA sequence of the human NOTCH4 gene.", "journal": "Genomics", "date": "1998", "authors": "Li L, Huang GM, Banta AB, Deng Y, Smith T, Dong P, Friedman C, Chen L, Trask BJ, Spies T, Rowen L, Hood L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "9693032", "url": "https://glygen.org/publication/PubMed/9693032" } ] }, { "title": "Purification and characterization of human NTH1, a homolog of Escherichia coli endonuclease III. Direct identification of Lys-212 as the active nucleophilic residue.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ikeda S, Biswas T, Roy R, Izumi T, Boldogh I, Kurosky A, Sarker AH, Seki S, Mitra S", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "9705289", "url": "https://glygen.org/publication/PubMed/9705289" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Enhanced phosphorylation of p53 by ATM in response to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Banin S, Moyal L, Shieh S, Taya Y, Anderson CW, Chessa L, Smorodinsky NI, Prives C, Reiss Y, Shiloh Y, Ziv Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "9733514", "url": "https://glygen.org/publication/PubMed/9733514" } ] }, { "title": "Activation of the ATM kinase by ionizing radiation and phosphorylation of p53.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Canman CE, Lim DS, Cimprich KA, Taya Y, Tamai K, Sakaguchi K, Appella E, Kastan MB, Siliciano JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "9733515", "url": "https://glygen.org/publication/PubMed/9733515" } ] }, { "title": "Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Levanon D, Goldstein RE, Bernstein Y, Tang H, Goldenberg D, Stifani S, Paroush Z, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9751710", "url": "https://glygen.org/publication/PubMed/9751710" } ] }, { "title": "Nuclear export of the stress-activated protein kinase p38 mediated by its substrate MAPKAP kinase-2.", "journal": "Current biology : CB", "date": "1998", "authors": "Ben-Levy R, Hooper S, Wilson R, Paterson HF, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9768359", "url": "https://glygen.org/publication/PubMed/9768359" } ] }, { "title": "Crossing over analysis at pachytene in man.", "journal": "European journal of human genetics : EJHG", "date": "1998", "authors": "Barlow AL, Hulten MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9781043", "url": "https://glygen.org/publication/PubMed/9781043" } ] }, { "title": "Crystal structure of a human alkylbase-DNA repair enzyme complexed to DNA: mechanisms for nucleotide flipping and base excision.", "journal": "Cell", "date": "1998", "authors": "Lau AY, Scharer OD, Samson L, Verdine GL, Ellenberger T", "evidence": [ { "database": "Reactome", "id": "R-HSA-110330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330" } ], "reference": [ { "type": "PubMed", "id": "9790531", "url": "https://glygen.org/publication/PubMed/9790531" } ] }, { "title": "The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, LeRoy G, Seelig HP, Lane WS, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9790534", "url": "https://glygen.org/publication/PubMed/9790534" } ] }, { "title": "Cleavage of the C-terminus of NEDD8 by UCH-L3.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Wada H, Kito K, Caskey LS, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "9790970", "url": "https://glygen.org/publication/PubMed/9790970" } ] }, { "title": "A 55-kDa protein isolated from human cells shows DNA glycosylase activity toward 3,N4-ethenocytosine and the G/T mismatch.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Hang B, Medina M, Fraenkel-Conrat H, Singer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "9811839", "url": "https://glygen.org/publication/PubMed/9811839" } ] }, { "title": "A role for Groucho tetramerization in transcriptional repression.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Chen G, Nguyen PH, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9819412", "url": "https://glygen.org/publication/PubMed/9819412" } ] }, { "title": "Mdm2 association with p53 targets its ubiquitination.", "journal": "Oncogene", "date": "1998", "authors": "Fuchs SY, Adler V, Buschmann T, Wu X, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9824166", "url": "https://glygen.org/publication/PubMed/9824166" } ] }, { "title": "Interaction of human rad51 recombination protein with single-stranded DNA binding protein, RPA.", "journal": "Nucleic acids research", "date": "1998", "authors": "Golub EI, Gupta RC, Haaf T, Wold MS, Radding CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9826763", "url": "https://glygen.org/publication/PubMed/9826763" } ] }, { "title": "ATM associates with and phosphorylates p53: mapping the region of interaction.", "journal": "Nature genetics", "date": "1998", "authors": "Khanna KK, Keating KE, Kozlov S, Scott S, Gatei M, Hobson K, Taya Y, Gabrielli B, Chan D, Lees-Miller SP, Lavin MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559586", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586" } ], "reference": [ { "type": "PubMed", "id": "9843217", "url": "https://glygen.org/publication/PubMed/9843217" } ] }, { "title": "Pontin52, an interaction partner of beta-catenin, binds to the TATA box binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Bauer A, Huber O, Kemler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9843967", "url": "https://glygen.org/publication/PubMed/9843967" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Overlapping but distinct patterns of histone acetylation by the human coactivators p300 and PCAF within nucleosomal substrates.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Schiltz RL, Mizzen CA, Vassilev A, Cook RG, Allis CD, Nakatani Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "9880483", "url": "https://glygen.org/publication/PubMed/9880483" } ] }, { "title": "Excision of products of oxidative DNA base damage by human NTH1 protein.", "journal": "Biochemistry", "date": "1999", "authors": "Dizdaroglu M, Karahalil B, Senturker S, Buckley TJ, Roldan-Arjona T", "evidence": [ { "database": "Reactome", "id": "R-HSA-110328", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328" } ], "reference": [ { "type": "PubMed", "id": "9890904", "url": "https://glygen.org/publication/PubMed/9890904" } ] } ], "pathway": [ { "id": "hsa:3012", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3012", "resource": "KEGG Pathway" }, { "id": "hsa:8335", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8335", "resource": "KEGG Pathway" }, { "id": "R-HSA-110328", "name": "Recognition and association of DNA glycosylase with site containing an affected pyrimidine", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110328", "resource": "Reactome", "description": "Recognition and association of DNA glycosylase with site containing an affected pyrimidine" }, { "id": "R-HSA-110329", "name": "Cleavage of the damaged pyrimidine", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110329", "resource": "Reactome", "description": "Cleavage of the damaged pyrimidine" }, { "id": "R-HSA-110330", "name": "Recognition and association of DNA glycosylase with site containing an affected purine", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110330", "resource": "Reactome", "description": "Recognition and association of DNA glycosylase with site containing an affected purine" }, { "id": "R-HSA-110331", "name": "Cleavage of the damaged purine", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110331", "resource": "Reactome", "description": "Cleavage of the damaged purine" }, { "id": "R-HSA-1221632", "name": "Meiotic synapsis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1221632", "resource": "Reactome", "description": "Meiotic synapsis" }, { "id": "R-HSA-171306", "name": "Packaging Of Telomere Ends", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-171306", "resource": "Reactome", "description": "Packaging Of Telomere Ends" }, { "id": "R-HSA-1912408", "name": "Pre-NOTCH Transcription and Translation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "resource": "Reactome", "description": "Pre-NOTCH Transcription and Translation" }, { "id": "R-HSA-201722", "name": "Formation of the beta-catenin:TCF transactivating complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722", "resource": "Reactome", "description": "Formation of the beta-catenin:TCF transactivating complex" }, { "id": "R-HSA-212300", "name": "PRC2 methylates histones and DNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300", "resource": "Reactome", "description": "PRC2 methylates histones and DNA" }, { "id": "R-HSA-2299718", "name": "Condensation of Prophase Chromosomes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718", "resource": "Reactome", "description": "Condensation of Prophase Chromosomes" }, { "id": "R-HSA-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-HSA-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-HSA-2559586", "name": "DNA Damage/Telomere Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559586", "resource": "Reactome", "description": "DNA Damage/Telomere Stress Induced Senescence" }, { "id": "R-HSA-3214815", "name": "HDACs deacetylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "resource": "Reactome", "description": "HDACs deacetylate histones" }, { "id": "R-HSA-3214847", "name": "HATs acetylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847", "resource": "Reactome", "description": "HATs acetylate histones" }, { "id": "R-HSA-3214858", "name": "RMTs methylate histone arginines", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-HSA-427359", "name": "SIRT1 negatively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359", "resource": "Reactome", "description": "SIRT1 negatively regulates rRNA expression" }, { "id": "R-HSA-427389", "name": "ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389", "resource": "Reactome", "description": "ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression" }, { "id": "R-HSA-427413", "name": "NoRC negatively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413", "resource": "Reactome", "description": "NoRC negatively regulates rRNA expression" }, { "id": "R-HSA-5250924", "name": "B-WICH complex positively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924", "resource": "Reactome", "description": "B-WICH complex positively regulates rRNA expression" }, { "id": "R-HSA-5334118", "name": "DNA methylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118", "resource": "Reactome", "description": "DNA methylation" }, { "id": "R-HSA-5578749", "name": "Transcriptional regulation by small RNAs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "resource": "Reactome", "description": "Transcriptional regulation by small RNAs" }, { "id": "R-HSA-5617472", "name": "Activation of anterior HOX genes in hindbrain development during early embryogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "resource": "Reactome", "description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis" }, { "id": "R-HSA-5625886", "name": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886", "resource": "Reactome", "description": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3" }, { "id": "R-HSA-5689603", "name": "UCH proteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-HSA-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-HSA-5689901", "name": "Metalloprotease DUBs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689901", "resource": "Reactome", "description": "Metalloprotease DUBs" }, { "id": "R-HSA-606279", "name": "Deposition of new CENPA-containing nucleosomes at the centromere", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279", "resource": "Reactome", "description": "Deposition of new CENPA-containing nucleosomes at the centromere" }, { "id": "R-HSA-68616", "name": "Assembly of the ORC complex at the origin of replication", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616", "resource": "Reactome", "description": "Assembly of the ORC complex at the origin of replication" }, { "id": "R-HSA-73728", "name": "RNA Polymerase I Promoter Opening", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728", "resource": "Reactome", "description": "RNA Polymerase I Promoter Opening" }, { "id": "R-HSA-73772", "name": "RNA Polymerase I Promoter Escape", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772", "resource": "Reactome", "description": "RNA Polymerase I Promoter Escape" }, { "id": "R-HSA-8936459", "name": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "resource": "Reactome", "description": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function" }, { "id": "R-HSA-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-912446", "name": "Meiotic recombination", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446", "resource": "Reactome", "description": "Meiotic recombination" }, { "id": "R-HSA-9609690", "name": "HCMV Early Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "resource": "Reactome", "description": "HCMV Early Events" }, { "id": "R-HSA-9610379", "name": "HCMV Late Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379", "resource": "Reactome", "description": "HCMV Late Events" }, { "id": "R-HSA-9616222", "name": "Transcriptional regulation of granulopoiesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "resource": "Reactome", "description": "Transcriptional regulation of granulopoiesis" }, { "id": "R-HSA-9670095", "name": "Inhibition of DNA recombination at telomere", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095", "resource": "Reactome", "description": "Inhibition of DNA recombination at telomere" }, { "id": "R-HSA-9710421", "name": "Defective pyroptosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421", "resource": "Reactome", "description": "Defective pyroptosis" }, { "id": "R-HSA-977225", "name": "Amyloid fiber formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" }, { "id": "R-HSA-9821002", "name": "Chromatin modifications during the maternal to zygotic transition (MZT)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002", "resource": "Reactome", "description": "Chromatin modifications during the maternal to zygotic transition (MZT)" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6ARS7-1", "protein_name": "Histone H2A", "gene_name": "LOC100910554", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGSYSERVGAGAPVYLAAVMEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESYHKAKGK", "length": 130 }, "evidence": [ { "id": "45922653", "url": "http://www.informatics.jax.org/homology/45922653", "database": "MGI" }, { "id": "45922652", "url": "http://www.informatics.jax.org/homology/45922652", "database": "MGI" }, { "id": "45922651", "url": "http://www.informatics.jax.org/homology/45922651", "database": "MGI" }, { "id": "45922650", "url": "http://www.informatics.jax.org/homology/45922650", "database": "MGI" }, { "id": "45922655", "url": "http://www.informatics.jax.org/homology/45922655", "database": "MGI" }, { "id": "45922648", "url": "http://www.informatics.jax.org/homology/45922648", "database": "MGI" }, { "id": "45922649", "url": "http://www.informatics.jax.org/homology/45922649", "database": "MGI" }, { "id": "45922645", "url": "http://www.informatics.jax.org/homology/45922645", "database": "MGI" }, { "id": "45922647", "url": "http://www.informatics.jax.org/homology/45922647", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8L2QLK6-1", "protein_name": "Histone H2A", "gene_name": "ENSRNOG00000068602", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGNVKKYGAAALILECFWNEENSNHFSAEIWQV", "length": 160 }, "evidence": [ { "id": "P04908", "url": "https://omabrowser.org/oma/group/P04908/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "C0HKE1-1", "protein_name": "Histone H2A type 1-B", "gene_name": "H2ac4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130 }, "evidence": [ { "id": "45922653", "url": "http://www.informatics.jax.org/homology/45922653", "database": "MGI" }, { "id": "45922652", "url": "http://www.informatics.jax.org/homology/45922652", "database": "MGI" }, { "id": "45922651", "url": "http://www.informatics.jax.org/homology/45922651", "database": "MGI" }, { "id": "45922650", "url": "http://www.informatics.jax.org/homology/45922650", "database": "MGI" }, { "id": "45922655", "url": "http://www.informatics.jax.org/homology/45922655", "database": "MGI" }, { "id": "45922648", "url": "http://www.informatics.jax.org/homology/45922648", "database": "MGI" }, { "id": "45922649", "url": "http://www.informatics.jax.org/homology/45922649", "database": "MGI" }, { "id": "45922645", "url": "http://www.informatics.jax.org/homology/45922645", "database": "MGI" }, { "id": "45922647", "url": "http://www.informatics.jax.org/homology/45922647", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "D3ZVK7-1", "protein_name": "Histone H2A", "gene_name": "H2ac4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130 }, "evidence": [ { "id": "45922653", "url": "http://www.informatics.jax.org/homology/45922653", "database": "MGI" }, { "id": "45922652", "url": "http://www.informatics.jax.org/homology/45922652", "database": "MGI" }, { "id": "45922651", "url": "http://www.informatics.jax.org/homology/45922651", "database": "MGI" }, { "id": "45922650", "url": "http://www.informatics.jax.org/homology/45922650", "database": "MGI" }, { "id": "45922655", "url": "http://www.informatics.jax.org/homology/45922655", "database": "MGI" }, { "id": "45922648", "url": "http://www.informatics.jax.org/homology/45922648", "database": "MGI" }, { "id": "45922649", "url": "http://www.informatics.jax.org/homology/45922649", "database": "MGI" }, { "id": "45922645", "url": "http://www.informatics.jax.org/homology/45922645", "database": "MGI" }, { "id": "45922647", "url": "http://www.informatics.jax.org/homology/45922647", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "G3V9C0-1", "protein_name": "Histone H2A", "gene_name": "Hist1h2ai", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130 }, "evidence": [ { "id": "45922653", "url": "http://www.informatics.jax.org/homology/45922653", "database": "MGI" }, { "id": "45922652", "url": "http://www.informatics.jax.org/homology/45922652", "database": "MGI" }, { "id": "45922651", "url": "http://www.informatics.jax.org/homology/45922651", "database": "MGI" }, { "id": "45922650", "url": "http://www.informatics.jax.org/homology/45922650", "database": "MGI" }, { "id": "45922655", "url": "http://www.informatics.jax.org/homology/45922655", "database": "MGI" }, { "id": "45922648", "url": "http://www.informatics.jax.org/homology/45922648", "database": "MGI" }, { "id": "45922649", "url": "http://www.informatics.jax.org/homology/45922649", "database": "MGI" }, { "id": "45922645", "url": "http://www.informatics.jax.org/homology/45922645", "database": "MGI" }, { "id": "45922647", "url": "http://www.informatics.jax.org/homology/45922647", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P0C0S8-1", "protein_name": "Histone H2A type 1", "gene_name": "H2AC16", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130 }, "evidence": [ { "id": "45922652", "url": "http://www.informatics.jax.org/homology/45922652", "database": "MGI" }, { "id": "45922651", "url": "http://www.informatics.jax.org/homology/45922651", "database": "MGI" }, { "id": "45922649", "url": "http://www.informatics.jax.org/homology/45922649", "database": "MGI" }, { "id": "45922645", "url": "http://www.informatics.jax.org/homology/45922645", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130 }, "evidence": [ { "id": "45922650", "url": "http://www.informatics.jax.org/homology/45922650", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6I8Q6-1", "protein_name": "Histone H2A", "gene_name": "Hist1h2af", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLYKGNYSERVGASAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKSKGK", "length": 130 }, "evidence": [ { "id": "45922653", "url": "http://www.informatics.jax.org/homology/45922653", "database": "MGI" }, { "id": "45922652", "url": "http://www.informatics.jax.org/homology/45922652", "database": "MGI" }, { "id": "45922651", "url": "http://www.informatics.jax.org/homology/45922651", "database": "MGI" }, { "id": "45922650", "url": "http://www.informatics.jax.org/homology/45922650", "database": "MGI" }, { "id": "45922655", "url": "http://www.informatics.jax.org/homology/45922655", "database": "MGI" }, { "id": "45922648", "url": "http://www.informatics.jax.org/homology/45922648", "database": "MGI" }, { "id": "45922649", "url": "http://www.informatics.jax.org/homology/45922649", "database": "MGI" }, { "id": "45922645", "url": "http://www.informatics.jax.org/homology/45922645", "database": "MGI" }, { "id": "45922647", "url": "http://www.informatics.jax.org/homology/45922647", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8CGP5-1", "protein_name": "Histone H2A type 1-F", "gene_name": "Hist1h2af", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKPKGK", "length": 130 }, "evidence": [ { "id": "P04908", "url": "https://omabrowser.org/oma/group/P04908/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK", "length": 130 }, "evidence": [ { "id": "45922647", "url": "http://www.informatics.jax.org/homology/45922647", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "CENP-A containing nucleosome", "id": "GO:0043505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043505", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" }, { "name": "protein localization to CENP-A containing chromatin", "id": "GO:0061644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061644", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 39, "end_pos": 41, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PubMed", "id": "21925322", "url": "https://glygen.org/publication/PubMed/21925322" } ] }, { "annotation": "Deiminated on Arg-4 in granulocytes upon calcium entry.", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PubMed", "id": "15823041", "url": "https://glygen.org/publication/PubMed/15823041" } ] }, { "annotation": "Glutamine methylation at Gln-105 (H2AQ104me) by FBL is specifically dedicated to polymerase I. It is present at 35S ribosomal DNA locus and impairs binding of the FACT complex (PubMed:24352239).", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PubMed", "id": "24352239", "url": "https://glygen.org/publication/PubMed/24352239" } ] }, { "annotation": "Monoubiquitination of Lys-120 (H2AK119Ub) by RING1, TRIM37 and RNF2/RING2 complex gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. It is involved in the initiation of both imprinted and random X inactivation. Ubiquitinated H2A is enriched in inactive X chromosome chromatin. Ubiquitination of H2A functions downstream of methylation of 'Lys-27' of histone H3 (H3K27me). H2AK119Ub by RNF2/RING2 can also be induced by ultraviolet and may be involved in DNA repair. Monoubiquitination of Lys-120 (H2AK119Ub) by TRIM37 may promote transformation of cells in a number of breast cancers (PubMed:25470042). Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties by the E2 ligase UBE2N and the E3 ligases RNF8 and RNF168, leading to the recruitment of repair proteins to sites of DNA damage. Ubiquitination at Lys-14 and Lys-16 (H2AK13Ub and H2AK15Ub, respectively) in response to DNA damage is initiated by RNF168 that mediates monoubiquitination at these 2 sites, and 'Lys-63'-linked ubiquitin are then conjugated to monoubiquitin; RNF8 is able to extend 'Lys-63'-linked ubiquitin chains in vitro. Deubiquitinated by USP51 at Lys-14 and Lys-16 (H2AK13Ub and H2AK15Ub, respectively) after damaged DNA is repaired (PubMed:27083998). H2AK119Ub and ionizing radiation-induced 'Lys-63'-linked ubiquitination (H2AK13Ub and H2AK15Ub) are distinct events.", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PubMed", "id": "19203579", "url": "https://glygen.org/publication/PubMed/19203579" }, { "database": "PubMed", "id": "22980979", "url": "https://glygen.org/publication/PubMed/22980979" }, { "database": "PubMed", "id": "16359901", "url": "https://glygen.org/publication/PubMed/16359901" }, { "database": "PubMed", "id": "16702407", "url": "https://glygen.org/publication/PubMed/16702407" }, { "database": "PubMed", "id": "25470042", "url": "https://glygen.org/publication/PubMed/25470042" }, { "database": "PubMed", "id": "22713238", "url": "https://glygen.org/publication/PubMed/22713238" }, { "database": "PubMed", "id": "18001825", "url": "https://glygen.org/publication/PubMed/18001825" }, { "database": "PubMed", "id": "18001824", "url": "https://glygen.org/publication/PubMed/18001824" }, { "database": "PubMed", "id": "15386022", "url": "https://glygen.org/publication/PubMed/15386022" }, { "database": "PubMed", "id": "19203578", "url": "https://glygen.org/publication/PubMed/19203578" }, { "database": "PubMed", "id": "24352239", "url": "https://glygen.org/publication/PubMed/24352239" }, { "database": "PubMed", "id": "27083998", "url": "https://glygen.org/publication/PubMed/27083998" } ] }, { "annotation": "Phosphorylation on Ser-2 (H2AS1ph) is enhanced during mitosis. Phosphorylation on Ser-2 by RPS6KA5/MSK1 directly represses transcription. Acetylation of H3 inhibits Ser-2 phosphorylation by RPS6KA5/MSK1. Phosphorylation at Thr-121 (H2AT120ph) by DCAF1 is present in the regulatory region of many tumor suppresor genes and down-regulates their transcription.", "evidence": [ { "database": "UniProtKB", "id": "P04908", "url": "https://www.uniprot.org/uniprot/P04908" }, { "database": "PubMed", "id": "15823041", "url": "https://glygen.org/publication/PubMed/15823041" }, { "database": "PubMed", "id": "16457589", "url": "https://glygen.org/publication/PubMed/16457589" }, { "database": "PubMed", "id": "15078818", "url": "https://glygen.org/publication/PubMed/15078818" }, { "database": "PubMed", "id": "24140421", "url": "https://glygen.org/publication/PubMed/24140421" }, { "database": "PubMed", "id": "11709551", "url": "https://glygen.org/publication/PubMed/11709551" }, { "database": "PubMed", "id": "15010469", "url": "https://glygen.org/publication/PubMed/15010469" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 41 ], "snv_sites": [ 41, 71, 75, 119 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 121, 123 ], "sequon_annotation_sites": [ { "start_pos": 39, "end_pos": 41 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 901 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }