{ "uniprot_canonical_ac": "P04001-1", "uniprot_ac": "P04001", "uniprot_id": "OPSG_HUMAN", "mass": { "chemical_mass": 40584.0, "monoisotopic_mass": 40584.0 }, "refseq": { "ac": "NP_000504", "name": "medium-wave-sensitive opsin 1", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000504" }, "gene_names": [ { "name": "OPN1MW2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04001", "id": "P04001" }, { "name": "OPN1MW", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04001", "id": "P04001" }, { "name": "GCP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04001", "id": "P04001" }, { "name": "OPN1MW", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04001", "id": "P04001" } ], "protein_names": [ { "name": "Medium-wave-sensitive opsin 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04001" }, { "name": "GOP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04001" }, { "name": "Green cone photoreceptor pigment", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04001" }, { "name": "Green-sensitive opsin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04001" }, { "name": "green cone photoreceptor pigment; cone dystrophy 5 (X-linked); green cone pigment; green-sensitive opsin; photopigment apoprotein; opsin 1 (cone pigments), medium-wave-sensitive; Medium-wave-sensitive opsin 2; Opsin 1 cone pigments medium-wave-sensitive 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000504", "id": "NP_000504" }, { "name": "medium-wave-sensitive opsin 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000504", "id": "NP_000504" } ], "function": [ { "annotation": "Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001#function" }, { "database": "PubMed", "id": "1302020", "url": "https://glygen.org/publication/PubMed/1302020" }, { "database": "PubMed", "id": "2937147", "url": "https://glygen.org/publication/PubMed/2937147" }, { "database": "PubMed", "id": "12051694", "url": "https://glygen.org/publication/PubMed/12051694" } ] } ], "disease": [ { "disease_id": "DOID:0050679", "recommended_name": { "id": "DOID:0050679", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050679", "name": "blue cone monochromacy", "description": "An achromatopsia that is characterized by severely impaired color discrimination, low visual acuity, nystagmus, photophobia due to the absence of functional long wavelength-sensitive and medium wavelength-sensitive cones in the retina and has_material_basis_in recessive X-linked inheritance." }, "synonyms": [ { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "blue cone monochromacy", "description": "Blue cone monochromatism (BCM) is a recessive X-linked disease characterized by severely impaired color discrimination, low visual acuity, nystagmus, and photophobia, due to dysfunction of the red (L) and green (M) cone photoreceptors. BCM is as an incomplete form of achromatopsia." }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "S cone monochromacy", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "S cone monochromatism", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "X-linked incomplete achromatopsia", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "atypical X-linked achromatopsia", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "blue cone monochromacy", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "blue cone monochromacy, X-linked recessive", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "blue cone monochromatism", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "color blindness, blue monocone monochromatic type", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "colour blindness, blue monocone monochromatic type", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "BCM", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "CBBM", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "X-chromosome-linked achromatopsia", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "X-linked achromatopsia incomplete", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "achromatopsia incomplete X-linked", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "color blindness blue mono cone monochromatic type", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "colorblindness, blue-Mono-cone-monochromatic type", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "colour blindness blue mono cone monochromatic type", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "cone dystrophy 5, X-linked", "description": "" }, { "id": "MONDO:0010563", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010563", "name": "incomplete achromatopsia X-linked", "description": "" }, { "id": "MIM:303700", "resource": "MIM", "url": "https://www.omim.org/entry/303700", "name": "Blue cone monochromacy", "description": "Blue cone monochromacy" } ], "evidence": [ { "id": "303700", "database": "MIM", "url": "https://www.omim.org/entry/303700" } ] }, { "disease_id": "DOID:13909", "recommended_name": { "id": "DOID:13909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13909", "name": "red-green color blindness", "description": "" }, "synonyms": [ { "id": "DOID:13909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13909", "name": "Deutan defect", "description": "" }, { "id": "DOID:13909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13909", "name": "Deuteranopia", "description": "" }, { "id": "DOID:13909", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13909", "name": "Reduced red-green discrimination", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "red-green color blindness", "description": "Deuteranopia is a type of color vision deficiency where the green photoreceptors are absent. It affects hue discrimination in the same way as protanopia, but without the dimming effect. Like protanopia, it is hereditary, sex-linked, and found in about 1% of the male population." }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "Deutan defect", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "colorblindness, deutan", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "deuteranopia", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "partial achromatopsia, deutan type", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "reduced red-green discrimination", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "CBD", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "Deutan colorblindness", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "Deuteranomaly", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "Green colorblindness", "description": "" }, { "id": "MONDO:0010564", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010564", "name": "colorblindness, partial, DEUTAN series", "description": "" }, { "id": "MIM:303800", "resource": "MIM", "url": "https://www.omim.org/entry/303800", "name": "Colorblindness, partial, deutan series", "description": "Colorblindness, partial, deutan series" } ], "evidence": [ { "id": "303800", "database": "MIM", "url": "https://www.omim.org/entry/303800" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "common_name": "Human" } ], "gene": [ { "name": "OPN1MW", "url": "https://www.uniprot.org/uniprot/P04001", "locus": { "chromosome": "X", "start_pos": 154196861, "end_pos": 154182596, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000268221", "url": "https://www.ensembl.org/id/ENSG00000268221" } ] } } ], "crossref": [ { "id": "ENSG00000166160", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166160", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSG00000268221", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268221", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "OPN1MW", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OPN1MW", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "101060233", "url": "https://www.ncbi.nlm.nih.gov/gene/101060233", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2652", "url": "https://www.ncbi.nlm.nih.gov/gene/2652", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "728458", "url": "https://www.ncbi.nlm.nih.gov/gene/728458", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26952", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26952", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4206", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4206", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000378", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000378", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027430", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027430", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "300821", "url": "http://www.omim.org/entry/300821", "database": "MIM", "categories": [ "Other" ] }, { "id": "303700", "url": "http://www.omim.org/entry/303700", "database": "MIM", "categories": [ "Other" ] }, { "id": "303800", "url": "http://www.omim.org/entry/303800", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04001", "url": "https://www.nextprot.org/entry/NX_P04001", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CAITMAE", "url": "https://omabrowser.org/oma/group/CAITMAE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5350930at2759", "url": "http://www.orthodb.org/?query=5350930at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04001", "url": "https://pharos.nih.gov/targets/P04001", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P04001", "url": "http://purl.obolibrary.org/obo/PR_P04001", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000504", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000504", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H0Y642", "url": "https://www.uniprot.org/uniprot/H0Y642", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y642-1", "url": "https://www.uniprot.org/uniprot/H0Y642-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04001-1", "url": "https://www.uniprot.org/uniprot/P04001-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVSPA", "length": 364, "header": "sp|P04001-1|OPSG_HUMAN Isoform 1 of Medium-wave-sensitive opsin 1 OS=Homo sapiens OX=9606 GN=OPN1MW PE=1 SV=1 CANONICAL=P04001-1" }, "isoforms": [ { "isoform_ac": "H0Y642-1", "url": "", "sequence": { "sequence": "XTGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVSPA", "length": 164, "header": "tr|H0Y642-1|H0Y642_HUMAN Computationally mapped isoform of Green cone photoreceptor pigment OS=Homo sapiens OX=9606 GN=OPN1MW2 PE=4 SV=1 CANONICAL=P04001-1" }, "locus": { "chromosome": "X", "start_pos": 154233179, "end_pos": 154227196, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430419.1", "url": "https://www.ensembl.org/id/ENST00000430419.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000403023.1", "url": "https://www.ensembl.org/id/ENSP00000403023.1" } ] } }, { "isoform_ac": "P04001-1", "url": "", "sequence": { "sequence": "MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVSPA", "length": 364, "header": "sp|P04001-1|OPSG_HUMAN Isoform 1 of Medium-wave-sensitive opsin 1 OS=Homo sapiens OX=9606 GN=OPN1MW PE=1 SV=1 CANONICAL=P04001-1" }, "locus": { "chromosome": "X", "start_pos": 154196037, "end_pos": 154182678, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000595290.6", "url": "https://www.ensembl.org/id/ENST00000595290.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000472316.1", "url": "https://www.ensembl.org/id/ENSP00000472316.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 34, "start_aa": "Asn", "end_pos": 34, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn34", "evidence": [ { "id": "P04001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04001#ptm_processing" }, { "id": "28402104", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28402104" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Encephalopsin: a novel mammalian extraretinal opsin discretely localized in the brain.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Blackshaw S, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "10234000", "url": "https://glygen.org/publication/PubMed/10234000" } ] }, { "title": "Mutations in the gene encoding 11-cis retinol dehydrogenase cause delayed dark adaptation and fundus albipunctatus.", "journal": "Nature genetics", "date": "1999", "authors": "Yamamoto H, Simon A, Eriksson U, Harris E, Berson EL, Dryja TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "10369264", "url": "https://glygen.org/publication/PubMed/10369264" } ] }, { "title": "Mutations in RGR, encoding a light-sensitive opsin homologue, in patients with retinitis pigmentosa.", "journal": "Nature genetics", "date": "1999", "authors": "Morimura H, Saindelle-Ribeaudeau F, Berson EL, Dryja TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "10581022", "url": "https://glygen.org/publication/PubMed/10581022" } ] }, { "title": "11-cis retinol dehydrogenase mutations as a major cause of the congenital night-blindness disorder known as fundus albipunctatus.", "journal": "Molecular vision", "date": "1999", "authors": "Gonzalez-Fernandez F, Kurz D, Bao Y, Newman S, Conway BP, Young JE, Han DP, Khani SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "10617778", "url": "https://glygen.org/publication/PubMed/10617778" } ] }, { "title": "A novel human opsin in the inner retina.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2000", "authors": "Provencio I, Rodriguez IR, Jiang G, Hayes WP, Moreira EF, Rollag MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "10632589", "url": "https://glygen.org/publication/PubMed/10632589" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "A high association with cone dystrophy in Fundus albipunctatus caused by mutations of the RDH5 gene.", "journal": "Investigative ophthalmology & visual science", "date": "2000", "authors": "Nakamura M, Hotta Y, Tanikawa A, Terasaki H, Miyake Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "11053295", "url": "https://glygen.org/publication/PubMed/11053295" } ] }, { "title": "A novel compound heterozygous mutation in the RDH5 gene in a patient with fundus albipunctatus.", "journal": "American journal of ophthalmology", "date": "2000", "authors": "Kuroiwa S, Kikuchi T, Yoshimura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "11078852", "url": "https://glygen.org/publication/PubMed/11078852" } ] }, { "title": "Rod and cone visual cycle consequences of a null mutation in the 11-cis-retinol dehydrogenase gene in man.", "journal": "Visual neuroscience", "date": "2000", "authors": "Cideciyan AV, Haeseleer F, Fariss RN, Aleman TS, Jang GF, Verlinde CLMJ, Marmor MF, Jacobson SG, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "11153648", "url": "https://glygen.org/publication/PubMed/11153648" } ] }, { "title": "Mutations in the gene encoding lecithin retinol acyltransferase are associated with early-onset severe retinal dystrophy.", "journal": "Nature genetics", "date": "2001", "authors": "Thompson DA, Li Y, McHenry CL, Carlson TJ, Ding X, Sieving PA, Apfelstedt-Sylla E, Gal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "11381255", "url": "https://glygen.org/publication/PubMed/11381255" } ] }, { "title": "The molecular basis of dichromatic color vision in males with multiple red and green visual pigment genes.", "journal": "Human molecular genetics", "date": "2002", "authors": "Jagla WM, Jagle H, Hayashi T, Sharpe LT, Deeb SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "11772996", "url": "https://glygen.org/publication/PubMed/11772996" } ] }, { "title": "Novel missense mutations in red/green opsin genes in congenital color-vision deficiencies.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Ueyama H, Kuwayama S, Imai H, Tanabe S, Oda S, Nishida Y, Wada A, Shichida Y, Yamade S", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "12051694", "url": "https://glygen.org/publication/PubMed/12051694" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "Rhodopsin with 11-cis-locked chromophore is capable of forming an active state photoproduct.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fan G, Siebert F, Sheves M, Vogel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "12177057", "url": "https://glygen.org/publication/PubMed/12177057" } ] }, { "title": "Isomerization and oxidation of vitamin a in cone-dominant retinas: a novel pathway for visual-pigment regeneration in daylight.", "journal": "Neuron", "date": "2002", "authors": "Mata NL, Radu RA, Clemmons RC, Travis GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "12367507", "url": "https://glygen.org/publication/PubMed/12367507" } ] }, { "title": "Defective colour vision associated with a missense mutation in the human green visual pigment gene.", "journal": "Nature genetics", "date": "1992", "authors": "Winderickx J, Sanocki E, Lindsey DT, Teller DY, Motulsky AG, Deeb SS", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "1302020", "url": "https://glygen.org/publication/PubMed/1302020" } ] }, { "title": "The familial distribution of congenital tritanopia, with some remarks on some similar conditions.", "journal": "Annals of human genetics", "date": "1955", "authors": "KALMUS H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "13249225", "url": "https://glygen.org/publication/PubMed/13249225" } ] }, { "title": "Human tritanopia associated with a third amino acid substitution in the blue-sensitive visual pigment.", "journal": "American journal of human genetics", "date": "1992", "authors": "Weitz CJ, Went LN, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "1386496", "url": "https://glygen.org/publication/PubMed/1386496" } ] }, { "title": "Neuropsin (Opn5): a novel opsin identified in mammalian neural tissue.", "journal": "FEBS letters", "date": "2003", "authors": "Tarttelin EE, Bellingham J, Hankins MW, Foster RG, Lucas RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "14623103", "url": "https://glygen.org/publication/PubMed/14623103" } ] }, { "title": "The characteristics of tritanopia.", "journal": "Journal of the Optical Society of America", "date": "1952", "authors": "WRIGHT WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "14946611", "url": "https://glygen.org/publication/PubMed/14946611" } ] }, { "title": "Mutations in RDH12 encoding a photoreceptor cell retinol dehydrogenase cause childhood-onset severe retinal dystrophy.", "journal": "Nature genetics", "date": "2004", "authors": "Janecke AR, Thompson DA, Utermann G, Becker C, Hubner CA, Schmid E, McHenry CL, Nair AR, Ruschendorf F, Heckenlively J, Wissinger B, Nurnberg P, Gal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "15258582", "url": "https://glygen.org/publication/PubMed/15258582" } ] }, { "title": "Human tritanopia associated with two amino acid substitutions in the blue-sensitive opsin.", "journal": "American journal of human genetics", "date": "1992", "authors": "Weitz CJ, Miyake Y, Shinzato K, Montag E, Zrenner E, Went LN, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "1531728", "url": "https://glygen.org/publication/PubMed/1531728" } ] }, { "title": "Retinal dehydrogenase 12 (RDH12) mutations in leber congenital amaurosis.", "journal": "American journal of human genetics", "date": "2004", "authors": "Perrault I, Hanein S, Gerber S, Barbet F, Ducroq D, Dollfus H, Hamel C, Dufier JL, Munnich A, Kaplan J, Rozet JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "15322982", "url": "https://glygen.org/publication/PubMed/15322982" } ] }, { "title": "Polymorphism in red photopigment underlies variation in colour matching.", "journal": "Nature", "date": "1992", "authors": "Winderickx J, Lindsey DT, Sanocki E, Teller DY, Motulsky AG, Deeb SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "1557123", "url": "https://glygen.org/publication/PubMed/1557123" } ] }, { "title": "Induction of photosensitivity by heterologous expression of melanopsin.", "journal": "Nature", "date": "2005", "authors": "Qiu X, Kumbalasiri T, Carlson SM, Wong KY, Krishna V, Provencio I, Berson DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "15674243", "url": "https://glygen.org/publication/PubMed/15674243" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "A human skin multifunctional O-acyltransferase that catalyzes the synthesis of acylglycerols, waxes, and retinyl esters.", "journal": "Journal of lipid research", "date": "2005", "authors": "Yen CL, Brown CH 4th, Monetti M, Farese RV Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "16106050", "url": "https://glygen.org/publication/PubMed/16106050" } ] }, { "title": "Chicken retinas contain a retinoid isomerase activity that catalyzes the direct conversion of all-trans-retinol to 11-cis-retinol.", "journal": "Biochemistry", "date": "2005", "authors": "Mata NL, Ruiz A, Radu RA, Bui TV, Travis GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "16128572", "url": "https://glygen.org/publication/PubMed/16128572" } ] }, { "title": "The vertebrate phototransduction cascade: amplification and termination mechanisms.", "journal": "Reviews of physiology, biochemistry and pharmacology", "date": "2005", "authors": "Chen CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16634148", "url": "https://glygen.org/publication/PubMed/16634148" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Screening genes of the retinoid metabolism: novel LRAT mutation in leber congenital amaurosis.", "journal": "American journal of ophthalmology", "date": "2006", "authors": "Senechal A, Humbert G, Surget MO, Bazalgette C, Bazalgette C, Arnaud B, Arndt C, Laurent E, Brabet P, Hamel CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "17011878", "url": "https://glygen.org/publication/PubMed/17011878" } ] }, { "title": "Mutations in STRA6 cause a broad spectrum of malformations including anophthalmia, congenital heart defects, diaphragmatic hernia, alveolar capillary dysplasia, lung hypoplasia, and mental retardation.", "journal": "American journal of human genetics", "date": "2007", "authors": "Pasutto F, Sticht H, Hammersen G, Gillessen-Kaesbach G, Fitzpatrick DR, Nurnberg G, Brasch F, Schirmer-Zimmermann H, Tolmie JL, Chitayat D, Houge G, Fernandez-Martinez L, Keating S, Mortier G, Hennekam RC, von der Wense A, Slavotinek A, Meinecke P, Bitoun P, Becker C, Nurnberg P, Reis A, Rauch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "17273977", "url": "https://glygen.org/publication/PubMed/17273977" } ] }, { "title": "Design, chemical synthesis, and expression of genes for the three human color vision pigments.", "journal": "Biochemistry", "date": "1991", "authors": "Oprian DD, Asenjo AB, Lee N, Pelletier SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "1742276", "url": "https://glygen.org/publication/PubMed/1742276" } ] }, { "title": "Identification of novel mutations in patients with Leber congenital amaurosis and juvenile RP by genome-wide homozygosity mapping with SNP microarrays.", "journal": "Investigative ophthalmology & visual science", "date": "2007", "authors": "den Hollander AI, Lopez I, Yzer S, Zonneveld MN, Janssen IM, Strom TM, Hehir-Kwa JY, Veltman JA, Arends ML, Meitinger T, Musarella MA, van den Born LI, Fishman GA, Maumenee IH, Rohrschneider K, Cremers FP, Koenekoop RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "18055821", "url": "https://glygen.org/publication/PubMed/18055821" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Genetic heterogeneity in two consanguineous families segregating early onset retinal degeneration: the pitfalls of homozygosity mapping.", "journal": "American journal of medical genetics. Part A", "date": "2009", "authors": "Benayoun L, Spiegel R, Auslender N, Abbasi AH, Rizel L, Hujeirat Y, Salama I, Garzozi HJ, Allon-Shalev S, Ben-Yosef T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "19140180", "url": "https://glygen.org/publication/PubMed/19140180" } ] }, { "title": "Two novel STRA6 mutations in a patient with anophthalmia and diaphragmatic eventration.", "journal": "American journal of medical genetics. Part A", "date": "2009", "authors": "West B, Bove KE, Slavotinek AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "19213032", "url": "https://glygen.org/publication/PubMed/19213032" } ] }, { "title": "The first step in vision: femtosecond isomerization of rhodopsin.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Schoenlein RW, Peteanu LA, Mathies RA, Shank CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "1925597", "url": "https://glygen.org/publication/PubMed/1925597" } ] }, { "title": "Involvement of all-trans-retinal in acute light-induced retinopathy of mice.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Maeda A, Maeda T, Golczak M, Chou S, Desai A, Hoppel CL, Matsuyama S, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "19304658", "url": "https://glygen.org/publication/PubMed/19304658" } ] }, { "title": "Phenotypic spectrum of STRA6 mutations: from Matthew-Wood syndrome to non-lethal anophthalmia.", "journal": "Human mutation", "date": "2009", "authors": "Chassaing N, Golzio C, Odent S, Lequeux L, Vigouroux A, Martinovic-Bouriel J, Tiziano FD, Masini L, Piro F, Maragliano G, Delezoide AL, Attie-Bitach T, Manouvrier-Hanu S, Etchevers HC, Calvas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "19309693", "url": "https://glygen.org/publication/PubMed/19309693" } ] }, { "title": "Limited roles of Rdh8, Rdh12, and Abca4 in all-trans-retinal clearance in mouse retina.", "journal": "Investigative ophthalmology & visual science", "date": "2009", "authors": "Maeda A, Golczak M, Maeda T, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "19553623", "url": "https://glygen.org/publication/PubMed/19553623" } ] }, { "title": "An alternative pathway mediates the mouse and human cone visual cycle.", "journal": "Current biology : CB", "date": "2009", "authors": "Wang JS, Kefalov VJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "19781940", "url": "https://glygen.org/publication/PubMed/19781940" } ] }, { "title": "Bothnia dystrophy is caused by domino-like rearrangements in cellular retinaldehyde-binding protein mutant R234W.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "He X, Lobsiger J, Stocker A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "19846785", "url": "https://glygen.org/publication/PubMed/19846785" } ] }, { "title": "Leber congenital amaurosis: clinical correlations with genotypes, gene therapy trials update, and future directions.", "journal": "Journal of AAPOS : the official publication of the American Association for Pediatric Ophthalmology and Strabismus", "date": "2009", "authors": "Chung DC, Traboulsi EI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "20006823", "url": "https://glygen.org/publication/PubMed/20006823" } ] }, { "title": "X-linked cone dystrophy caused by mutation of the red and green cone opsins.", "journal": "American journal of human genetics", "date": "2010", "authors": "Gardner JC, Webb TR, Kanuga N, Robson AG, Holder GE, Stockman A, Ripamonti C, Ebenezer ND, Ogun O, Devery S, Wright GA, Maher ER, Cheetham ME, Moore AT, Michaelides M, Hardcastle AJ", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "20579627", "url": "https://glygen.org/publication/PubMed/20579627" } ] }, { "title": "Characterization and comparative structural features of the gene for human interstitial retinol-binding protein.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Fong SL, Fong WB, Morris TA, Kedzie KM, Bridges CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "2303470", "url": "https://glygen.org/publication/PubMed/2303470" } ] }, { "title": "Identification of DES1 as a vitamin A isomerase in Muller glial cells of the retina.", "journal": "Nature chemical biology", "date": "2013", "authors": "Kaylor JJ, Yuan Q, Cook J, Sarfare S, Makshanoff J, Miu A, Kim A, Kim P, Habib S, Roybal CN, Xu T, Nusinowitz S, Travis GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "23143414", "url": "https://glygen.org/publication/PubMed/23143414" } ] }, { "title": "Chemistry of the retinoid (visual) cycle.", "journal": "Chemical reviews", "date": "2014", "authors": "Kiser PD, Golczak M, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "23905688", "url": "https://glygen.org/publication/PubMed/23905688" } ] }, { "title": "Identification of the 11-cis-specific retinyl-ester synthase in retinal Muller cells as multifunctional O-acyltransferase (MFAT).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Kaylor JJ, Cook JD, Makshanoff J, Bischoff N, Yong J, Travis GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "24799687", "url": "https://glygen.org/publication/PubMed/24799687" } ] }, { "title": "Alpha transducin is present in blue-, green-, and red-sensitive cone photoreceptors in the human retina.", "journal": "Neuron", "date": "1989", "authors": "Lerea CL, Bunt-Milam AH, Hurley JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2534964", "url": "https://glygen.org/publication/PubMed/2534964" } ] }, { "title": "Human interstitial retinoid-binding protein. Gene structure and primary structure.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Liou GI, Ma DP, Yang YW, Geng L, Zhu C, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "2542268", "url": "https://glygen.org/publication/PubMed/2542268" } ] }, { "title": "Nucleotide sequence for a cDNA encoding the alpha subunit of retinal transducin (GNAT1) isolated from the human eye.", "journal": "Nucleic acids research", "date": "1989", "authors": "Van Dop C, Medynski DC, Apone LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2748346", "url": "https://glygen.org/publication/PubMed/2748346" } ] }, { "title": "Molecular genetics of human blue cone monochromacy.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Nathans J, Davenport CM, Maumenee IH, Lewis RA, Hejtmancik JF, Litt M, Lovrien E, Weleber R, Bachynski B, Zwas F, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "2788922", "url": "https://glygen.org/publication/PubMed/2788922" } ] }, { "title": "Allosteric modulation of the substrate specificity of acyl-CoA wax alcohol acyltransferase 2.", "journal": "Journal of lipid research", "date": "2017", "authors": "Arne JM, Widjaja-Adhi MA, Hughes T, Huynh KW, Silvaroli JA, Chelstowska S, Moiseenkova-Bell VY, Golczak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "28096191", "url": "https://glygen.org/publication/PubMed/28096191" } ] }, { "title": "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2834384", "url": "https://glygen.org/publication/PubMed/2834384" } ] }, { "title": "Hydrogen/Deuterium Exchange Mass Spectrometry of Human Green Opsin Reveals a Conserved Pro-Pro Motif in Extracellular Loop 2 of Monostable Visual G Protein-Coupled Receptors.", "journal": "Biochemistry", "date": "2017", "authors": "Hofmann L, Alexander NS, Sun W, Zhang J, Orban T, Palczewski K", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001#ptm_processing" }, { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "reference": [ { "type": "PubMed", "id": "28402104", "url": "https://glygen.org/publication/PubMed/28402104" } ] }, { "title": "Molecular genetics of human color vision: the genes encoding blue, green, and red pigments.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Nathans J, Thomas D, Hogness DS", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "2937147", "url": "https://glygen.org/publication/PubMed/2937147" } ] }, { "title": "Human red and green cone opsins are O-glycosylated at an N-terminal Ser/Thr-rich domain conserved in vertebrates.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Salom D, Jin H, Gerken TA, Yu C, Huang L, Palczewski K", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "reference": [ { "type": "PubMed", "id": "30948514", "url": "https://glygen.org/publication/PubMed/30948514" } ] }, { "title": "Internal quadruplication in the structure of human interstitial retinol-binding protein deduced from its cloned cDNA.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Fong SL, Bridges CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "3170584", "url": "https://glygen.org/publication/PubMed/3170584" } ] }, { "title": "Molecular biology of the visual pigments.", "journal": "Vision Res.", "date": "1986", "authors": "Applebury ML, Hargrave PA", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "reference": [ { "type": "PubMed", "id": "3303660", "url": "https://glygen.org/publication/PubMed/3303660" } ] }, { "title": "Molecular genetics of inherited variation in human color vision.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Nathans J, Piantanida TP, Eddy RL, Shows TB, Hogness DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "3485310", "url": "https://glygen.org/publication/PubMed/3485310" } ] }, { "title": "The genetics of tritan disturbances.", "journal": "Human genetics", "date": "1985", "authors": "Went LN, Pronk N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "3872255", "url": "https://glygen.org/publication/PubMed/3872255" } ] }, { "title": "Kinetics of rhodopsin bleaching in the isolated human retina.", "journal": "The Journal of physiology", "date": "1973", "authors": "Baumann C, Bender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "4772407", "url": "https://glygen.org/publication/PubMed/4772407" } ] }, { "title": "Isolation and nucleotide sequence of the gene encoding human rhodopsin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Nathans J, Hogness DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "6589631", "url": "https://glygen.org/publication/PubMed/6589631" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "A human opsin-related gene that encodes a retinaldehyde-binding protein.", "journal": "Biochemistry", "date": "1994", "authors": "Shen D, Jiang M, Hao W, Tao L, Salazar M, Fong HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "7947717", "url": "https://glygen.org/publication/PubMed/7947717" } ] }, { "title": "Human taste cells express the G protein alpha-gustducin and neuron-specific enolase.", "journal": "Brain research. Molecular brain research", "date": "1994", "authors": "Takami S, Getchell TV, McLaughlin SK, Margolskee RF, Getchell ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8015379", "url": "https://glygen.org/publication/PubMed/8015379" } ] }, { "title": "Genetic heterogeneity among blue-cone monochromats.", "journal": "American journal of human genetics", "date": "1993", "authors": "Nathans J, Maumenee IH, Zrenner E, Sadowski B, Sharpe LT, Lewis RA, Hansen E, Rosenberg T, Schwartz M, Heckenlively JR, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "8213841", "url": "https://glygen.org/publication/PubMed/8213841" } ] }, { "title": "Characterization of the gene encoding human cone transducin alpha-subunit (GNAT2).", "journal": "Genomics", "date": "1993", "authors": "Morris TA, Fong SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8406495", "url": "https://glygen.org/publication/PubMed/8406495" } ] }, { "title": "Gene conversion between red and defective green opsin gene in blue cone monochromacy.", "journal": "Genomics", "date": "1995", "authors": "Reyniers E, Van Thienen MN, Meire F, De Boulle K, Devries K, Kestelijn P, Willems PJ", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "8666378", "url": "https://glygen.org/publication/PubMed/8666378" } ] }, { "title": "A photoreceptor cell-specific ATP-binding transporter gene (ABCR) is mutated in recessive Stargardt macular dystrophy.", "journal": "Nature genetics", "date": "1997", "authors": "Allikmets R, Singh N, Sun H, Shroyer NF, Hutchinson A, Chidambaram A, Gerrard B, Baird L, Stauffer D, Peiffer A, Rattner A, Smallwood P, Li Y, Anderson KL, Lewis RA, Nathans J, Leppert M, Dean M, Lupski JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "9054934", "url": "https://glygen.org/publication/PubMed/9054934" } ] }, { "title": "Peropsin, a novel visual pigment-like protein located in the apical microvilli of the retinal pigment epithelium.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Sun H, Gilbert DJ, Copeland NG, Jenkins NA, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771" } ], "reference": [ { "type": "PubMed", "id": "9275222", "url": "https://glygen.org/publication/PubMed/9275222" } ] }, { "title": "Structural and functional characterization of recombinant human cellular retinaldehyde-binding protein.", "journal": "Protein science : a publication of the Protein Society", "date": "1998", "authors": "Crabb JW, Carlson A, Chen Y, Goldflam S, Intres R, West KA, Hulmes JD, Kapron JT, Luck LA, Horwitz J, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "9541407", "url": "https://glygen.org/publication/PubMed/9541407" } ] }, { "title": "Molecular characterization of a novel short-chain dehydrogenase/reductase that reduces all-trans-retinal.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Haeseleer F, Huang J, Lebioda L, Saari JC, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2187335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335" } ], "reference": [ { "type": "PubMed", "id": "9705317", "url": "https://glygen.org/publication/PubMed/9705317" } ] }, { "title": "Spectrum of ABCR gene mutations in autosomal recessive macular dystrophies.", "journal": "European journal of human genetics : EJHG", "date": "1998", "authors": "Rozet JM, Gerber S, Souied E, Perrault I, Chatelin S, Ghazi I, Leowski C, Dufier JL, Munnich A, Kaplan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2453864", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864" } ], "reference": [ { "type": "PubMed", "id": "9781034", "url": "https://glygen.org/publication/PubMed/9781034" } ] } ], "pathway": [ { "id": "R-HSA-2187335", "name": "The retinoid cycle in cones (daylight vision)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2187335", "resource": "Reactome", "description": "The retinoid cycle in cones (daylight vision)" }, { "id": "R-HSA-2453864", "name": "Retinoid cycle disease events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453864", "resource": "Reactome", "description": "Retinoid cycle disease events" }, { "id": "R-HSA-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-HSA-419771", "name": "Opsins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-419771", "resource": "Reactome", "description": "Opsins" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "G protein-coupled photoreceptor activity", "id": "GO:0008020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008020", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "photoreceptor activity", "id": "GO:0009881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009881", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "photoreceptor disc membrane", "id": "GO:0097381", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097381", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "photoreceptor outer segment", "id": "GO:0001750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001750", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "phototransduction", "id": "GO:0007602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007602", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "positive regulation of cytokinesis", "id": "GO:0032467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032467", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" }, { "name": "cellular response to light stimulus", "id": "GO:0071482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071482", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 34, "end_pos": 36, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated (PubMed:30948514). O-glycosylated (PubMed:30948514).", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "PubMed", "id": "30948514", "url": "https://glygen.org/publication/PubMed/30948514" } ] }, { "annotation": "Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region.", "evidence": [ { "database": "UniProtKB", "id": "P04001", "url": "https://www.uniprot.org/uniprot/P04001" }, { "database": "PubMed", "id": "2937147", "url": "https://glygen.org/publication/PubMed/2937147" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [ 34 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 34, "end_pos": 36 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 76 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }