{ "uniprot_canonical_ac": "P03967-1", "uniprot_ac": "P03967", "uniprot_id": "RASD_DICDI", "mass": { "chemical_mass": 21202.0, "monoisotopic_mass": 21202.0 }, "refseq": { "ac": "XP_629338", "name": "Ras GTPase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629338" }, "gene_names": [ { "name": "rasD", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P03967", "id": "P03967" }, { "name": "DDB_G0292996", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03967", "id": "P03967" }, { "name": "rasA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03967", "id": "P03967" }, { "name": "rasD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629338", "id": "XP_629338" }, { "name": "ras", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03967", "id": "P03967" } ], "protein_names": [ { "name": "Ras-like protein rasD", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P03967" }, { "name": "3.6.5.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03967" }, { "name": "Ras GTPase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629338", "id": "XP_629338" }, { "name": "Transforming protein p23 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03967" } ], "function": [ { "annotation": "Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967#function" }, { "database": "PubMed", "id": "18948008", "url": "https://glygen.org/publication/PubMed/18948008" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "rasD", "url": "https://www.uniprot.org/uniprot/P03967", "locus": {} } ], "crossref": [ { "id": "cd04138", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04138", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0292996", "url": "http://dictybase.org/gene/DDB_G0292996", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8629062", "url": "https://www.ncbi.nlm.nih.gov/gene/8629062", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0292996", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0292996", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CYRKQWV", "url": "https://omabrowser.org/oma/group/CYRKQWV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24070", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24070", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24070:SF416", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24070:SF416", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P03967", "url": "http://purl.obolibrary.org/obo/PR_P03967", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_629338", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629338", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19669", "url": "https://www.rhea-db.org/rhea/19669", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P03967-1", "url": "https://www.uniprot.org/uniprot/P03967-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTEYKLVIVGGGGVGKSALTIQLIQNHFIDEYDPTIEDSYRKQVSIDDETCLLDILDTAGQEEYSAMRDQYMRTGQGFLCVYSITSRSSYDEIASFREQILRVKDKDRVPLILVGNKADLDHERQVSVNEGQELAKGFNCPFMESSAKSRINVEEAFYSLVREIRKELKGDQSSGKAQKKKKQCLIL", "length": 187, "header": "sp|P03967-1|RASD_DICDI Isoform 1 of Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2 CANONICAL=P03967-1" }, "isoforms": [ { "isoform_ac": "P03967-1", "url": "", "sequence": { "sequence": "MTEYKLVIVGGGGVGKSALTIQLIQNHFIDEYDPTIEDSYRKQVSIDDETCLLDILDTAGQEEYSAMRDQYMRTGQGFLCVYSITSRSSYDEIASFREQILRVKDKDRVPLILVGNKADLDHERQVSVNEGQELAKGFNCPFMESSAKSRINVEEAFYSLVREIRKELKGDQSSGKAQKKKKQCLIL", "length": 187, "header": "sp|P03967-1|RASD_DICDI Isoform 1 of Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2 CANONICAL=P03967-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "cAMP and cell sorting control the spatial expression of a developmentally essential cell-type-specific ras gene in Dictyostelium.", "journal": "Genes Dev.", "date": "1991", "authors": "Esch R K, Firtel R A", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "reference": [ { "type": "PubMed", "id": "1703508", "url": "https://glygen.org/publication/PubMed/1703508" } ] }, { "title": "Spatiotemporal regulation of Ras activity provides directional sensing.", "journal": "Current biology : CB", "date": "2008-10-28", "authors": "Zhang Sheng, Charest Pascale G, Firtel Richard A", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "reference": [ { "type": "PubMed", "id": "18948008", "url": "https://glygen.org/publication/PubMed/18948008" } ] }, { "title": "Developmental regulation of a Dictyostelium gene encoding a protein homologous to mammalian ras protein.", "journal": "Cell", "date": "1984", "authors": "Reymond C D, Gomer R H, Mehdy M C, Firtel R A", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "reference": [ { "type": "PubMed", "id": "6091907", "url": "https://glygen.org/publication/PubMed/6091907" } ] } ], "pathway": [ { "id": "ddi:DDB_G0292996", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0292996", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "mitogen-activated protein kinase binding", "id": "GO:0051019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051019", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "protein kinase inhibitor activity", "id": "GO:0004860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004860", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "protein kinase regulator activity", "id": "GO:0019887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019887", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "protein kinase B binding", "id": "GO:0043422", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043422", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "filamin binding", "id": "GO:0031005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031005", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "G protein activity", "id": "GO:0003925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003925", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "lipid droplet", "id": "GO:0005811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "Ras protein signal transduction", "id": "GO:0007265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "phototaxis", "id": "GO:0042331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042331", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "thermotaxis", "id": "GO:0043052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043052", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" }, { "name": "adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway", "id": "GO:0140582", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140582", "evidence": [ { "database": "UniProtKB", "id": "P03967", "url": "https://www.uniprot.org/uniprot/P03967" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19669", "name": "", "equation": "GTP + H2O = GDP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q08877-1", "Q6AYC2-1", "Q2TA68-1", "P61589-1", "Q6RUV5-1", "P23640-1", "O35303-1", "P21575-1", "P39052-1", "Q6AYF9-1", "Q8CFN2-1", "Q63663-1", "M0RC99-1", "Q99P74-1", "B2GUV7-1", "Q8R4Z9-1", "Q8R500-1", "D3ZQL7-1", "P97538-1", "Q6IMA3-1", "Q5BJQ5-1", "Q62636-1", "Q63486-1", "Q63487-1", "P61227-1", "P62836-1", "P63322-1", "Q04970-1", "P08644-1", "D3Z8L7-1", "P35281-1", "P36860-1", "Q6IMA7-1", "C9WPN6-1", "P20171-1", "P81795-1", "Q6AYZ1-1", "Q6AY56-1", "Q99MB4-1", "Q5XIF6-1", "P84079-1", "P68370-1", "Q68FR8-1", "Q6P9V9-1", "P51146-1", "O35509-1", "P62494-1", "Q6NYB7-1", "Q66HA6-1", "P09527-1", "P10536-1", "P05714-1", "Q8K586-1", "P62828-1", "P62332-1", "P35280-1", "P05712-1", "Q6AYB5-1", "Q6AXM7-1", "P05197-1", "P62630-1", "D3ZM99-1", "D3ZLK2-1", "Q5BJP6-1", "F1M2G3-1", "A0A8I5ZU96-1", "A0A8I6AHV4-1", "Q62639-1", "P97687-1", "P60953-2", "Q9UQ16-1", "P55039-1", "Q9Y295-1", "O00429-1", "Q05193-1", "P50570-1", "Q6NXR0-1", "Q96PP8-1", "P32455-1", "Q9H0R5-1", "Q96PP9-1", "P32456-1", "Q8N442-1", "O60841-1", "Q8IWA4-1", "O95140-1", "O60313-1", "Q8IVH4-1", "Q5S007-1", "O00194-1", "P51159-1", "P63000-1", "P20339-1", "P61586-1", "O94811-1", "P61018-1", "Q9H0U4-1", "P51148-1", "P51149-1", "Q9Y227-1", "P62820-1", "Q9NQZ7-1", "P20338-1", "P62491-1", "Q15907-1", "Q92928-1", "P61020-1", "Q9NVJ2-1", "A6NIZ1-1", "P61224-1", "A1A4Y4-1", "P61011-1", "P62834-1", "P11234-1", "Q2VIR3-1", "P41091-1", "P01112-1", "P61225-1", "Q9Y3L5-1", "Q96S79-1", "Q9NQL2-1", "Q9HB90-1", "Q9H628-1", "O14807-1", "P01116-1", "P60763-1", "P11233-1", "P01111-1", "Q99578-1", "Q96A58-1", "Q92737-1", "Q9BPW5-1", "Q7Z444-1", "P10114-1", "Q5VZM2-1", "P10301-1", "P62070-1", "Q6T310-1", "P61026-1", "Q92963-1", "Q7L523-1", "Q9NYN1-1", "P62826-1", "P62330-1", "Q8N8V2-1", "Q9NRW1-1", "Q6ZN66-1", "Q8WUD1-1", "P61006-1", "P61019-1", "Q9BSD7-1", "Q9NY65-1", "Q9H853-1", "P68366-1", "Q4V339-1", "Q8IUF1-1", "Q71U36-1", "Q9BQE3-1", "P68363-1", "Q5RIA9-1", "Q9BRT8-1", "A6NHL2-1", "Q5JTY5-1", "P84077-1", "Q6PEY2-1", "P13639-1", "P15170-1", "P0DPH7-1", "P0DPH8-1", "Q969S9-1", "Q15382-1", "P49961-1", "Q8IYD1-1", "P68104-1", "P61221-1", "Q9Y450-1", "P61021-1", "Q62293-1", "Q61107-1", "P60766-2", "Q8BZ98-1", "Q8CFB4-1", "P32233-1", "Q9QXB9-1", "Q01514-1", "Q8K1M6-1", "P39053-1", "P39054-1", "Q8C262-1", "Q5S006-1", "Q8C3X4-1", "Q9Z0E6-1", "Q9QZ85-1", "Q05D44-1", "P58281-1", "Q8C7H1-1", "Q80U63-1", "Q811U4-1", "Q99P58-1", "Q9QUI0-1", "Q9ERI2-1", "P63001-1", "Q3T9E4-1", "Q7TQD2-1", "Q9CQD1-1", "Q9CQW2-1", "P56371-1", "P62821-1", "P62492-1", "Q91ZR1-1", "P35278-1", "P46638-1", "P51150-1", "Q3TCT4-1", "Q9D1G1-1", "P61226-1", "P61027-1", "P62071-1", "Q99JI6-1", "Q8R367-1", "Q922H7-1", "Q8BU31-1", "Q80ZJ1-1", "Q80X95-1", "O08989-1", "P70426-1", "Q8K5A4-1", "P10833-1", "P70425-1", "Q61411-1", "Q5SSG5-1", "Q7TT45-1", "Q6NTA4-1", "Q99K70-1", "Q9JIW9-1", "Q08AT1-1", "P60764-1", "P62835-1", "P63321-1", "Q6IMB1-1", "P32883-1", "Q9Z0N2-1", "Q9Z0N1-1", "P08556-1", "Q7TN89-1", "A4UUI3-1", "Q8VEH6-1", "A0A0G2JDV3-1", "P68368-1", "Q91Z40-1", "Q60766-1", "A0A140LIF8-1", "Q9DCE9-1", "Q3UX10-1", "Q9JJZ2-1", "Q0GUM3-1", "E9PXC0-1", "P62331-1", "Q9CQA9-1", "P53994-1", "P59279-1", "P62827-1", "P68369-1", "P55258-1", "P61294-1", "Q61820-1", "P05214-1", "P84078-1", "Q69ZS7-1", "P05213-1", "P68373-1", "Q149F3-1", "Q8R050-1", "P14576-1", "Q921J2-1", "P55772-1", "Q8R2Q4-1", "B2RVE2-1", "P10126-1", "P61222-1", "P58252-1", "P13856-1", "P20606-1", "P01119-1", "P01120-1", "P05453-1", "P06780-1", "P06781-1", "P09733-1", "P09734-1", "P11076-1", "P19073-1", "P32324-1", "P32481-1", "P32769-1", "P53893-1", "P54861-1", "Q00246-1", "P39730-1", "P46943-1", "P38297-1", "P53729-1", "P20424-1", "P53290-1", "Q00582-1", "Q54Y30-1", "Q54XP6-1", "Q54XD8-1", "Q55CA9-1", "Q55CB0-1", "Q55CB7-1", "Q55CB8-1", "Q55CB9-1", "Q55CC0-1", "Q75K18-1", "Q869Q0-1", "Q86L51-1", "B0G189-1", "O00909-1", "P03967-1", "P0CT31-1", "P15064-1", "P15112-1", "P18613-1", "P32252-1", "P32253-1", "P32254-1", "P32255-1", "P36409-1", "P36411-1", "Q54MH8-1", "Q55AX0-1", "Q55BW0-1", "Q55F94-1", "P08645-1", "P08646-1", "P40793-1", "Q24208-1", "P04388-1", "P27619-1", "Q7YU24-1", "P48555-1", "Q9VRH6-1", "A1Z9N0-1", "O18412-1", "P06604-1", "P06606-1", "P61209-1", "P06603-1", "P06605-1", "Q9W074-1", "O18333-1", "Q9V3I2-1", "Q9VRY2-1", "O76742-1", "P13060-1", "Q9VM20-1" ], "evidence": [ { "id": "19669", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19669" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JDV3", "gene_name": "Gbp6", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A0A0G2JDV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ] } ] }, { "uniprot_ac": "A0A140LIF8", "gene_name": "Irgm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A0A140LIF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A140LIF8" } ] } ] }, { "uniprot_ac": "A0A8I5ZU96", "gene_name": "ENSRNOG00000063798", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A0A8I5ZU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZU96" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A0A8I5ZU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZU96" } ] } ] }, { "uniprot_ac": "A0A8I6AHV4", "gene_name": "LOC367858", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A0A8I6AHV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AHV4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A0A8I6AHV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AHV4" } ] } ] }, { "uniprot_ac": "A1A4Y4", "gene_name": "IRGM", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A1A4Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1A4Y4" } ] } ] }, { "uniprot_ac": "A1Z9N0", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A1Z9N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9N0" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "A1Z9N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9N0" } ] } ] }, { "uniprot_ac": "A4UUI3", "gene_name": "Gbp4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A4UUI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ] } ] }, { "uniprot_ac": "A6NHL2", "gene_name": "TUBAL3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A6NHL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NHL2" } ] } ] }, { "uniprot_ac": "A6NIZ1", "gene_name": "RAP1BL", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A6NIZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NIZ1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A6NIZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NIZ1" } ] } ] }, { "uniprot_ac": "B0G189", "gene_name": "guf1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "B0G189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G189" } ] } ] }, { "uniprot_ac": "B2GUV7", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "B2GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUV7" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "B2GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUV7" } ] } ] }, { "uniprot_ac": "B2RVE2", "gene_name": "Rergl", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "B2RVE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RVE2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "B2RVE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RVE2" } ] } ] }, { "uniprot_ac": "C9WPN6", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "C9WPN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9WPN6" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "C9WPN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9WPN6" } ] } ] }, { "uniprot_ac": "D3Z8L7", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "D3Z8L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8L7" } ] } ] }, { "uniprot_ac": "D3ZLK2", "gene_name": "Rasl12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "D3ZLK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLK2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "D3ZLK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLK2" } ] } ] }, { "uniprot_ac": "D3ZM99", "gene_name": "Rergl", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "D3ZM99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZM99" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "D3ZM99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZM99" } ] } ] }, { "uniprot_ac": "D3ZQL7", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "D3ZQL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQL7" } ] } ] }, { "uniprot_ac": "E9PXC0", "gene_name": "Srp54c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "E9PXC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PXC0" } ] } ] }, { "uniprot_ac": "F1M2G3", "gene_name": "Rerg", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "F1M2G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M2G3" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "F1M2G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M2G3" } ] } ] }, { "uniprot_ac": "M0RC99", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "M0RC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RC99" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "M0RC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RC99" } ] } ] }, { "uniprot_ac": "O00194", "gene_name": "RAB27B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O00194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00194" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O00194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00194" } ] } ] }, { "uniprot_ac": "O00429", "gene_name": "DNM1L", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O00429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00429" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O00429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00429" } ] } ] }, { "uniprot_ac": "O00909", "gene_name": "arfA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O00909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00909" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O00909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00909" } ] } ] }, { "uniprot_ac": "O08989", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] } ] }, { "uniprot_ac": "O14807", "gene_name": "MRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O14807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14807" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O14807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14807" } ] } ] }, { "uniprot_ac": "O18333", "gene_name": "Rab2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O18333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18333" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O18333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18333" } ] } ] }, { "uniprot_ac": "O18412", "gene_name": "fzo", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O18412", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18412" } ] } ] }, { "uniprot_ac": "O35303", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O35303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35303" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O35303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35303" } ] } ] }, { "uniprot_ac": "O35509", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O35509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35509" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O35509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35509" } ] } ] }, { "uniprot_ac": "O60313", "gene_name": "OPA1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O60313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60313" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O60313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60313" } ] } ] }, { "uniprot_ac": "O60841", "gene_name": "EIF5B", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O60841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60841" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "O60841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60841" } ] } ] }, { "uniprot_ac": "O76742", "gene_name": "Rab7", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O76742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76742" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O76742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76742" } ] } ] }, { "uniprot_ac": "O94811", "gene_name": "TPPP", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O94811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94811" } ] } ] }, { "uniprot_ac": "O95140", "gene_name": "MFN2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O95140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95140" } ] } ] }, { "uniprot_ac": "P01111", "gene_name": "NRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] } ] }, { "uniprot_ac": "P01112", "gene_name": "HRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] } ] }, { "uniprot_ac": "P01116", "gene_name": "KRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01116" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01116" } ] } ] }, { "uniprot_ac": "P01119", "gene_name": "RAS1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01119", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01119" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01119", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01119" } ] } ] }, { "uniprot_ac": "P01120", "gene_name": "RAS2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01120" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01120" } ] } ] }, { "uniprot_ac": "P03967", "gene_name": "rasD", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P03967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03967" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P03967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03967" } ] } ] }, { "uniprot_ac": "P04388", "gene_name": "Ras64B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P04388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04388" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P04388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04388" } ] } ] }, { "uniprot_ac": "P05197", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05197" } ] } ] }, { "uniprot_ac": "P05213", "gene_name": "Tuba1b", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05213", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05213" } ] } ] }, { "uniprot_ac": "P05214", "gene_name": "Tuba3a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05214" } ] } ] }, { "uniprot_ac": "P05453", "gene_name": "SUP35", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05453" } ] } ] }, { "uniprot_ac": "P05712", "gene_name": "Rab2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P05712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05712" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P05712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05712" } ] } ] }, { "uniprot_ac": "P05714", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P05714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05714" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P05714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05714" } ] } ] }, { "uniprot_ac": "P06603", "gene_name": "alphaTub84B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06603" } ] } ] }, { "uniprot_ac": "P06604", "gene_name": "alphaTub85E", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06604" } ] } ] }, { "uniprot_ac": "P06605", "gene_name": "alphaTub84D", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06605" } ] } ] }, { "uniprot_ac": "P06606", "gene_name": "alphaTub67C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06606" } ] } ] }, { "uniprot_ac": "P06780", "gene_name": "RHO1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P06780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06780" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P06780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06780" } ] } ] }, { "uniprot_ac": "P06781", "gene_name": "RHO2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P06781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06781" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P06781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06781" } ] } ] }, { "uniprot_ac": "P08556", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] } ] }, { "uniprot_ac": "P08644", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08644" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08644" } ] } ] }, { "uniprot_ac": "P08645", "gene_name": "Rap1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08645" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08645" } ] } ] }, { "uniprot_ac": "P08646", "gene_name": "Ras85D", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08646" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08646" } ] } ] }, { "uniprot_ac": "P09527", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P09527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09527" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P09527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09527" } ] } ] }, { "uniprot_ac": "P09733", "gene_name": "TUB1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P09733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09733" } ] } ] }, { "uniprot_ac": "P09734", "gene_name": "TUB3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P09734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09734" } ] } ] }, { "uniprot_ac": "P0CT31", "gene_name": "eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0CT31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CT31" } ] } ] }, { "uniprot_ac": "P0DPH7", "gene_name": "TUBA3C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0DPH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPH7" } ] } ] }, { "uniprot_ac": "P0DPH8", "gene_name": "TUBA3D", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0DPH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPH8" } ] } ] }, { "uniprot_ac": "P10114", "gene_name": "RAP2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P10114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10114" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P10114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10114" } ] } ] }, { "uniprot_ac": "P10126", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10126" } ] } ] }, { "uniprot_ac": "P10301", "gene_name": "RRAS", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10301", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10301" } ] } ] }, { "uniprot_ac": "P10536", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P10536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10536" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P10536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10536" } ] } ] }, { "uniprot_ac": "P10833", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10833" } ] } ] }, { "uniprot_ac": "P11076", "gene_name": "ARF1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P11076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11076" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11076" } ] } ] }, { "uniprot_ac": "P11233", "gene_name": "RALA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P11233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11233" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11233" } ] } ] }, { "uniprot_ac": "P11234", "gene_name": "RALB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P11234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11234" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11234" } ] } ] }, { "uniprot_ac": "P13060", "gene_name": "eEF2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P13060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13060" } ] } ] }, { "uniprot_ac": "P13639", "gene_name": "EEF2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P13639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13639" } ] } ] }, { "uniprot_ac": "P13856", "gene_name": "RSR1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P13856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13856" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P13856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13856" } ] } ] }, { "uniprot_ac": "P14576", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] } ] }, { "uniprot_ac": "P15064", "gene_name": "rasG", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P15064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15064" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P15064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15064" } ] } ] }, { "uniprot_ac": "P15112", "gene_name": "efbA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P15112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15112" } ] } ] }, { "uniprot_ac": "P15170", "gene_name": "GSPT1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P15170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15170" } ] } ] }, { "uniprot_ac": "P18613", "gene_name": "rapA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P18613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18613" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P18613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18613" } ] } ] }, { "uniprot_ac": "P19073", "gene_name": "CDC42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P19073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19073" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P19073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19073" } ] } ] }, { "uniprot_ac": "P20171", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20171" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20171" } ] } ] }, { "uniprot_ac": "P20338", "gene_name": "RAB4A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20338" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20338" } ] } ] }, { "uniprot_ac": "P20339", "gene_name": "RAB5A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20339" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20339" } ] } ] }, { "uniprot_ac": "P20424", "gene_name": "SRP54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20424" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P20424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20424" } ] } ] }, { "uniprot_ac": "P20606", "gene_name": "SAR1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P20606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20606" } ] } ] }, { "uniprot_ac": "P21575", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P21575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21575" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P21575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21575" } ] } ] }, { "uniprot_ac": "P23640", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P23640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23640" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P23640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23640" } ] } ] }, { "uniprot_ac": "P27619", "gene_name": "shi", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P27619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27619" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P27619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27619" } ] } ] }, { "uniprot_ac": "P32233", "gene_name": "Drg1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32233" } ] } ] }, { "uniprot_ac": "P32252", "gene_name": "rasB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32252" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32252" } ] } ] }, { "uniprot_ac": "P32253", "gene_name": "rasC", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32253" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32253" } ] } ] }, { "uniprot_ac": "P32254", "gene_name": "rasS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32254" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32254" } ] } ] }, { "uniprot_ac": "P32255", "gene_name": "tubA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32255" } ] } ] }, { "uniprot_ac": "P32324", "gene_name": "EFT1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32324" } ] } ] }, { "uniprot_ac": "P32455", "gene_name": "GBP1", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] } ] }, { "uniprot_ac": "P32456", "gene_name": "GBP2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32456" } ] } ] }, { "uniprot_ac": "P32481", "gene_name": "GCD11", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32481" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P32481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32481" } ] } ] }, { "uniprot_ac": "P32769", "gene_name": "HBS1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32769" } ] } ] }, { "uniprot_ac": "P32883", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] } ] }, { "uniprot_ac": "P35278", "gene_name": "Rab5c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] } ] }, { "uniprot_ac": "P35280", "gene_name": "Rab8a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35280" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35280" } ] } ] }, { "uniprot_ac": "P35281", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35281" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35281" } ] } ] }, { "uniprot_ac": "P36409", "gene_name": "rab2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36409" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36409" } ] } ] }, { "uniprot_ac": "P36411", "gene_name": "rab7A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36411" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36411" } ] } ] }, { "uniprot_ac": "P36860", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36860" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36860" } ] } ] }, { "uniprot_ac": "P38297", "gene_name": "FZO1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P38297", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38297" } ] } ] }, { "uniprot_ac": "P39052", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39052" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39052" } ] } ] }, { "uniprot_ac": "P39053", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] } ] }, { "uniprot_ac": "P39054", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] } ] }, { "uniprot_ac": "P39730", "gene_name": "FUN12", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39730" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P39730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39730" } ] } ] }, { "uniprot_ac": "P40793", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P40793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40793" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P40793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40793" } ] } ] }, { "uniprot_ac": "P41091", "gene_name": "EIF2S3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] } ] }, { "uniprot_ac": "P46638", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] } ] }, { "uniprot_ac": "P46943", "gene_name": "GUF1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P46943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46943" } ] } ] }, { "uniprot_ac": "P48555", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P48555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48555" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P48555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48555" } ] } ] }, { "uniprot_ac": "P49961", "gene_name": "ENTPD1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P49961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49961" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P49961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49961" } ] } ] }, { "uniprot_ac": "P50570", "gene_name": "DNM2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] } ] }, { "uniprot_ac": "P51146", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51146" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51146" } ] } ] }, { "uniprot_ac": "P51148", "gene_name": "RAB5C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] } ] }, { "uniprot_ac": "P51149", "gene_name": "RAB7A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51149" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51149" } ] } ] }, { "uniprot_ac": "P51150", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] } ] }, { "uniprot_ac": "P51159", "gene_name": "RAB27A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] } ] }, { "uniprot_ac": "P53290", "gene_name": "GTR2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P53290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53290" } ] } ] }, { "uniprot_ac": "P53729", "gene_name": "ZNG1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P53729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53729" } ] } ] }, { "uniprot_ac": "P53893", "gene_name": "RIA1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P53893", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53893" } ] } ] }, { "uniprot_ac": "P53994", "gene_name": "Rab2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P53994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53994" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P53994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53994" } ] } ] }, { "uniprot_ac": "P54861", "gene_name": "DNM1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P54861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54861" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P54861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54861" } ] } ] }, { "uniprot_ac": "P55039", "gene_name": "DRG2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P55039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55039" } ] } ] }, { "uniprot_ac": "P55258", "gene_name": "Rab8a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P55258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55258" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P55258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55258" } ] } ] }, { "uniprot_ac": "P55772", "gene_name": "Entpd1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P55772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55772" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P55772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55772" } ] } ] }, { "uniprot_ac": "P56371", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] } ] }, { "uniprot_ac": "P58252", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P58252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58252" } ] } ] }, { "uniprot_ac": "P58281", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] } ] }, { "uniprot_ac": "P59279", "gene_name": "Rab2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P59279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59279" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P59279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59279" } ] } ] }, { "uniprot_ac": "P60763", "gene_name": "RAC3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60763" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60763" } ] } ] }, { "uniprot_ac": "P60764", "gene_name": "Rac3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] } ] }, { "uniprot_ac": "P60766", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] } ] }, { "uniprot_ac": "P60953", "gene_name": "CDC42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60953" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60953" } ] } ] }, { "uniprot_ac": "P61006", "gene_name": "RAB8A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61006" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61006" } ] } ] }, { "uniprot_ac": "P61011", "gene_name": "SRP54", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] }, { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] } ] }, { "uniprot_ac": "P61018", "gene_name": "RAB4B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61018" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61018" } ] } ] }, { "uniprot_ac": "P61019", "gene_name": "RAB2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61019" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61019" } ] } ] }, { "uniprot_ac": "P61020", "gene_name": "RAB5B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61020" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61020" } ] } ] }, { "uniprot_ac": "P61021", "gene_name": "Rab5b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] } ] }, { "uniprot_ac": "P61026", "gene_name": "RAB10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61026" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61026" } ] } ] }, { "uniprot_ac": "P61027", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] } ] }, { "uniprot_ac": "P61209", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61209" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61209" } ] } ] }, { "uniprot_ac": "P61221", "gene_name": "ABCE1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61221", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61221" } ] } ] }, { "uniprot_ac": "P61222", "gene_name": "Abce1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61222" } ] } ] }, { "uniprot_ac": "P61224", "gene_name": "RAP1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] } ] }, { "uniprot_ac": "P61225", "gene_name": "RAP2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P61227", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] } ] }, { "uniprot_ac": "P61294", "gene_name": "Rab6b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61294", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61294" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61294", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61294" } ] } ] }, { "uniprot_ac": "P61586", "gene_name": "RHOA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61586" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61586" } ] } ] }, { "uniprot_ac": "P61589", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61589" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61589" } ] } ] }, { "uniprot_ac": "P62070", "gene_name": "RRAS2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62070" } ] } ] }, { "uniprot_ac": "P62071", "gene_name": "Rras2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62071" } ] } ] }, { "uniprot_ac": "P62330", "gene_name": "ARF6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62330" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62330" } ] } ] }, { "uniprot_ac": "P62331", "gene_name": "Arf6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62331" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62331" } ] } ] }, { "uniprot_ac": "P62332", "gene_name": "Arf6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62332" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62332" } ] } ] }, { "uniprot_ac": "P62491", "gene_name": "RAB11A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62491" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62491" } ] } ] }, { "uniprot_ac": "P62492", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] } ] }, { "uniprot_ac": "P62494", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62494" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62494" } ] } ] }, { "uniprot_ac": "P62630", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62630" } ] } ] }, { "uniprot_ac": "P62820", "gene_name": "RAB1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62820" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62820" } ] } ] }, { "uniprot_ac": "P62821", "gene_name": "Rab1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] } ] }, { "uniprot_ac": "P62826", "gene_name": "RAN", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62826", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62826" } ] } ] }, { "uniprot_ac": "P62827", "gene_name": "Ran", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62827" } ] } ] }, { "uniprot_ac": "P62828", "gene_name": "Ran", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62828" } ] } ] }, { "uniprot_ac": "P62834", "gene_name": "RAP1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P62836", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] } ] }, { "uniprot_ac": "P63000", "gene_name": "RAC1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63000" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63000" } ] } ] }, { "uniprot_ac": "P63001", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] } ] }, { "uniprot_ac": "P63321", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] } ] }, { "uniprot_ac": "P63322", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63322" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63322" } ] } ] }, { "uniprot_ac": "P68104", "gene_name": "EEF1A1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68104" } ] } ] }, { "uniprot_ac": "P68363", "gene_name": "TUBA1B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68363", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68363" } ] } ] }, { "uniprot_ac": "P68366", "gene_name": "TUBA4A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68366", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68366" } ] } ] }, { "uniprot_ac": "P68368", "gene_name": "Tuba4a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68368" } ] } ] }, { "uniprot_ac": "P68369", "gene_name": "Tuba1a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68369" } ] } ] }, { "uniprot_ac": "P68370", "gene_name": "Tuba1a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68370" } ] } ] }, { "uniprot_ac": "P68373", "gene_name": "Tuba1c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68373" } ] } ] }, { "uniprot_ac": "P70425", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] } ] }, { "uniprot_ac": "P70426", "gene_name": "Rit1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] } ] }, { "uniprot_ac": "P81795", "gene_name": "Eif2s3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P81795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81795" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P81795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81795" } ] } ] }, { "uniprot_ac": "P84077", "gene_name": "ARF1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] } ] }, { "uniprot_ac": "P84078", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84078" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84078" } ] } ] }, { "uniprot_ac": "P84079", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84079" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84079" } ] } ] }, { "uniprot_ac": "P97538", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P97538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97538" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P97538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97538" } ] } ] }, { "uniprot_ac": "P97687", "gene_name": "Entpd1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P97687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97687" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P97687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97687" } ] } ] }, { "uniprot_ac": "Q00246", "gene_name": "RHO4", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q00246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00246" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q00246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00246" } ] } ] }, { "uniprot_ac": "Q00582", "gene_name": "GTR1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q00582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00582" } ] } ] }, { "uniprot_ac": "Q01514", "gene_name": "Gbp1", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] } ] }, { "uniprot_ac": "Q04970", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] } ] }, { "uniprot_ac": "Q05193", "gene_name": "DNM1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q05193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05193" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q05193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05193" } ] } ] }, { "uniprot_ac": "Q05D44", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] } ] }, { "uniprot_ac": "Q08877", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q08877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08877" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q08877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08877" } ] } ] }, { "uniprot_ac": "Q08AT1", "gene_name": "Rasl12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] } ] }, { "uniprot_ac": "Q0GUM3", "gene_name": "Gm12250", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q0GUM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0GUM3" } ] } ] }, { "uniprot_ac": "Q149F3", "gene_name": "Gspt2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q149F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q149F3" } ] } ] }, { "uniprot_ac": "Q15382", "gene_name": "RHEB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q15382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15382" } ] } ] }, { "uniprot_ac": "Q15907", "gene_name": "RAB11B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q15907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15907" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q15907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15907" } ] } ] }, { "uniprot_ac": "Q24208", "gene_name": "eIF2gamma", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q24208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24208" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q24208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24208" } ] } ] }, { "uniprot_ac": "Q2TA68", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q2TA68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TA68" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q2TA68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TA68" } ] } ] }, { "uniprot_ac": "Q2VIR3", "gene_name": "EIF2S3B", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q2VIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2VIR3" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q2VIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2VIR3" } ] } ] }, { "uniprot_ac": "Q3T9E4", "gene_name": "Tgtp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3T9E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T9E4" } ] } ] }, { "uniprot_ac": "Q3TCT4", "gene_name": "Entpd7", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] } ] }, { "uniprot_ac": "Q3UX10", "gene_name": "Tubal3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3UX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UX10" } ] } ] }, { "uniprot_ac": "Q4V339", "gene_name": "ZNG1F", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q4V339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V339" } ] } ] }, { "uniprot_ac": "Q54MH8", "gene_name": "dlpB", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54MH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MH8" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q54MH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MH8" } ] } ] }, { "uniprot_ac": "Q54XD8", "gene_name": "eif2s3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54XD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XD8" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q54XD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XD8" } ] } ] }, { "uniprot_ac": "Q54XP6", "gene_name": "eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54XP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XP6" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q54XP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XP6" } ] } ] }, { "uniprot_ac": "Q54Y30", "gene_name": "rsmC", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54Y30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y30" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q54Y30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y30" } ] } ] }, { "uniprot_ac": "Q55AX0", "gene_name": "dlpC", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55AX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AX0" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q55AX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AX0" } ] } ] }, { "uniprot_ac": "Q55BW0", "gene_name": "rapC", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55BW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BW0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55BW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BW0" } ] } ] }, { "uniprot_ac": "Q55CA9", "gene_name": "rasZ", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CA9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CA9" } ] } ] }, { "uniprot_ac": "Q55CB0", "gene_name": "rasU", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB0" } ] } ] }, { "uniprot_ac": "Q55CB7", "gene_name": "rasY", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB7" } ] } ] }, { "uniprot_ac": "Q55CB8", "gene_name": "rasX", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB8" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB8" } ] } ] }, { "uniprot_ac": "Q55CB9", "gene_name": "rasV", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB9" } ] } ] }, { "uniprot_ac": "Q55CC0", "gene_name": "rasW", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CC0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CC0" } ] } ] }, { "uniprot_ac": "Q55F94", "gene_name": "dlpA", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55F94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F94" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q55F94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F94" } ] } ] }, { "uniprot_ac": "Q5BJP6", "gene_name": "Gfm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5BJP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJP6" } ] } ] }, { "uniprot_ac": "Q5BJQ5", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q5BJQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJQ5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5BJQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJQ5" } ] } ] }, { "uniprot_ac": "Q5JTY5", "gene_name": "ZNG1C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5JTY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JTY5" } ] } ] }, { "uniprot_ac": "Q5RIA9", "gene_name": "ZNG1E", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5RIA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RIA9" } ] } ] }, { "uniprot_ac": "Q5S006", "gene_name": "Lrrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] } ] }, { "uniprot_ac": "Q5S007", "gene_name": "LRRK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] } ] }, { "uniprot_ac": "Q5SSG5", "gene_name": "Rasl10b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] } ] }, { "uniprot_ac": "Q5VZM2", "gene_name": "RRAGB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5VZM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZM2" } ] } ] }, { "uniprot_ac": "Q5XIF6", "gene_name": "Tuba4a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5XIF6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF6" } ] } ] }, { "uniprot_ac": "Q60766", "gene_name": "Irgm1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60766" } ] } ] }, { "uniprot_ac": "Q61107", "gene_name": "Gbp3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61107" } ] } ] }, { "uniprot_ac": "Q61411", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] } ] }, { "uniprot_ac": "Q61820", "gene_name": "Rasl2-9", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61820" } ] } ] }, { "uniprot_ac": "Q62293", "gene_name": "Tgtp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q62293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62293" } ] } ] }, { "uniprot_ac": "Q62636", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q62636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62636" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q62636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62636" } ] } ] }, { "uniprot_ac": "Q62639", "gene_name": "Rheb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q62639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62639" } ] } ] }, { "uniprot_ac": "Q63486", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63486" } ] } ] }, { "uniprot_ac": "Q63487", "gene_name": "RragB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63487" } ] } ] }, { "uniprot_ac": "Q63663", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63663", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63663" } ] } ] }, { "uniprot_ac": "Q66HA6", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q66HA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q66HA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA6" } ] } ] }, { "uniprot_ac": "Q68FR8", "gene_name": "Tuba3a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q68FR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FR8" } ] } ] }, { "uniprot_ac": "Q69ZS7", "gene_name": "Hbs1l", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q69ZS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZS7" } ] } ] }, { "uniprot_ac": "Q6AXM7", "gene_name": "Hbs1l", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AXM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM7" } ] } ] }, { "uniprot_ac": "Q6AY56", "gene_name": "Tuba8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AY56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AY56" } ] } ] }, { "uniprot_ac": "Q6AYB5", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] } ] }, { "uniprot_ac": "Q6AYC2", "gene_name": "Irgm", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYC2" } ] } ] }, { "uniprot_ac": "Q6AYF9", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYF9" } ] } ] }, { "uniprot_ac": "Q6AYZ1", "gene_name": "Tuba1c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYZ1" } ] } ] }, { "uniprot_ac": "Q6IMA3", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA3" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA3" } ] } ] }, { "uniprot_ac": "Q6IMA7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA7" } ] } ] }, { "uniprot_ac": "Q6IMB1", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] } ] }, { "uniprot_ac": "Q6NTA4", "gene_name": "Rragb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NTA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NTA4" } ] } ] }, { "uniprot_ac": "Q6NXR0", "gene_name": "IRGC", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NXR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NXR0" } ] } ] }, { "uniprot_ac": "Q6NYB7", "gene_name": "Rab1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6NYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NYB7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6NYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NYB7" } ] } ] }, { "uniprot_ac": "Q6P9V9", "gene_name": "Tuba1b", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6P9V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P9V9" } ] } ] }, { "uniprot_ac": "Q6PEY2", "gene_name": "TUBA3E", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6PEY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PEY2" } ] } ] }, { "uniprot_ac": "Q6RUV5", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6RUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6RUV5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6RUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6RUV5" } ] } ] }, { "uniprot_ac": "Q6T310", "gene_name": "RASL11A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6T310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6T310" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6T310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6T310" } ] } ] }, { "uniprot_ac": "Q6ZN66", "gene_name": "GBP6", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6ZN66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZN66" } ] } ] }, { "uniprot_ac": "Q71U36", "gene_name": "TUBA1A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q71U36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71U36" } ] } ] }, { "uniprot_ac": "Q75K18", "gene_name": "srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q75K18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75K18" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "Q75K18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75K18" } ] } ] }, { "uniprot_ac": "Q7L523", "gene_name": "RRAGA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7L523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L523" } ] } ] }, { "uniprot_ac": "Q7TN89", "gene_name": "Eras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] } ] }, { "uniprot_ac": "Q7TQD2", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TQD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQD2" } ] } ] }, { "uniprot_ac": "Q7TT45", "gene_name": "Rragd", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TT45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT45" } ] } ] }, { "uniprot_ac": "Q7YU24", "gene_name": "Marf", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7YU24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7YU24" } ] } ] }, { "uniprot_ac": "Q7Z444", "gene_name": "ERAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q7Z444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z444" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7Z444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z444" } ] } ] }, { "uniprot_ac": "Q80U63", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80U63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U63" } ] } ] }, { "uniprot_ac": "Q80X95", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80X95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X95" } ] } ] }, { "uniprot_ac": "Q80ZJ1", "gene_name": "Rap2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] } ] }, { "uniprot_ac": "Q811U4", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q811U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811U4" } ] } ] }, { "uniprot_ac": "Q869Q0", "gene_name": "", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q869Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869Q0" } ] } ] }, { "uniprot_ac": "Q86L51", "gene_name": "rapB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q86L51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86L51" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q86L51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86L51" } ] } ] }, { "uniprot_ac": "Q8BU31", "gene_name": "Rap2c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] } ] }, { "uniprot_ac": "Q8BZ98", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] } ] }, { "uniprot_ac": "Q8C262", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C262" } ] } ] }, { "uniprot_ac": "Q8C3X4", "gene_name": "Guf1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C3X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C3X4" } ] } ] }, { "uniprot_ac": "Q8C7H1", "gene_name": "Mmaa", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8C7H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7H1" } ] } ] }, { "uniprot_ac": "Q8CFB4", "gene_name": "Gbp5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8CFB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFB4" } ] } ] }, { "uniprot_ac": "Q8CFN2", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8CFN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFN2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8CFN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFN2" } ] } ] }, { "uniprot_ac": "Q8IUF1", "gene_name": "ZNG1B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IUF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUF1" } ] } ] }, { "uniprot_ac": "Q8IVH4", "gene_name": "MMAA", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8IVH4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVH4" } ] } ] }, { "uniprot_ac": "Q8IWA4", "gene_name": "MFN1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IWA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWA4" } ] } ] }, { "uniprot_ac": "Q8IYD1", "gene_name": "GSPT2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IYD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYD1" } ] } ] }, { "uniprot_ac": "Q8K1M6", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] } ] }, { "uniprot_ac": "Q8K586", "gene_name": "Rasl2-9", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8K586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K586" } ] } ] }, { "uniprot_ac": "Q8K5A4", "gene_name": "Rasl10a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] } ] }, { "uniprot_ac": "Q8N442", "gene_name": "GUF1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8N442", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N442" } ] } ] }, { "uniprot_ac": "Q8N8V2", "gene_name": "GBP7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q8N8V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N8V2" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8N8V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N8V2" } ] } ] }, { "uniprot_ac": "Q8R050", "gene_name": "Gspt1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R050" } ] } ] }, { "uniprot_ac": "Q8R2Q4", "gene_name": "Gfm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R2Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Q4" } ] } ] }, { "uniprot_ac": "Q8R367", "gene_name": "Rerg", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] } ] }, { "uniprot_ac": "Q8R4Z9", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R4Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4Z9" } ] } ] }, { "uniprot_ac": "Q8R500", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R500", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R500" } ] } ] }, { "uniprot_ac": "Q8VEH6", "gene_name": "Zng1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8VEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEH6" } ] } ] }, { "uniprot_ac": "Q8WUD1", "gene_name": "RAB2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8WUD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUD1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8WUD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUD1" } ] } ] }, { "uniprot_ac": "Q91Z40", "gene_name": "Gbp7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q91Z40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z40" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q91Z40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z40" } ] } ] }, { "uniprot_ac": "Q91ZR1", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] } ] }, { "uniprot_ac": "Q921J2", "gene_name": "Rheb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q921J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921J2" } ] } ] }, { "uniprot_ac": "Q922H7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] } ] }, { "uniprot_ac": "Q92737", "gene_name": "RASL10A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q92737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92737" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92737" } ] } ] }, { "uniprot_ac": "Q92928", "gene_name": "RAB1C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q92928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92928" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92928" } ] } ] }, { "uniprot_ac": "Q92963", "gene_name": "RIT1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q92963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92963" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92963" } ] } ] }, { "uniprot_ac": "Q969S9", "gene_name": "GFM2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q969S9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969S9" } ] } ] }, { "uniprot_ac": "Q96A58", "gene_name": "RERG", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q96A58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q96A58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A58" } ] } ] }, { "uniprot_ac": "Q96PP8", "gene_name": "GBP5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP8" } ] } ] }, { "uniprot_ac": "Q96PP9", "gene_name": "GBP4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP9" } ] } ] }, { "uniprot_ac": "Q96S79", "gene_name": "RASL10B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q96S79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S79" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q96S79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S79" } ] } ] }, { "uniprot_ac": "Q99578", "gene_name": "RIT2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99578" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99578" } ] } ] }, { "uniprot_ac": "Q99JI6", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] } ] }, { "uniprot_ac": "Q99K70", "gene_name": "Rragc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99K70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99K70" } ] } ] }, { "uniprot_ac": "Q99MB4", "gene_name": "Zng1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99MB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MB4" } ] } ] }, { "uniprot_ac": "Q99P58", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] } ] }, { "uniprot_ac": "Q99P74", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99P74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P74" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P74" } ] } ] }, { "uniprot_ac": "Q9BPW5", "gene_name": "RASL11B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9BPW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BPW5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9BPW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BPW5" } ] } ] }, { "uniprot_ac": "Q9BQE3", "gene_name": "TUBA1C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9BQE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQE3" } ] } ] }, { "uniprot_ac": "Q9BRT8", "gene_name": "ZNG1A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9BRT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRT8" } ] } ] }, { "uniprot_ac": "Q9BSD7", "gene_name": "NTPCR", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9BSD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BSD7" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9BSD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BSD7" } ] } ] }, { "uniprot_ac": "Q9CQA9", "gene_name": "Ntpcr", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9CQA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQA9" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9CQA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQA9" } ] } ] }, { "uniprot_ac": "Q9CQD1", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] } ] }, { "uniprot_ac": "Q9CQW2", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] } ] }, { "uniprot_ac": "Q9D1G1", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] } ] }, { "uniprot_ac": "Q9DCE9", "gene_name": "Igtp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9DCE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCE9" } ] } ] }, { "uniprot_ac": "Q9ERI2", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] } ] }, { "uniprot_ac": "Q9H0R5", "gene_name": "GBP3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9H0R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0R5" } ] } ] }, { "uniprot_ac": "Q9H0U4", "gene_name": "RAB1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9H0U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0U4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9H0U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0U4" } ] } ] }, { "uniprot_ac": "Q9H628", "gene_name": "RERGL", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9H628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H628" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9H628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H628" } ] } ] }, { "uniprot_ac": "Q9H853", "gene_name": "TUBA4B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9H853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H853" } ] } ] }, { "uniprot_ac": "Q9HB90", "gene_name": "RRAGC", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9HB90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB90" } ] } ] }, { "uniprot_ac": "Q9JIW9", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] } ] }, { "uniprot_ac": "Q9JJZ2", "gene_name": "Tuba8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9JJZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJZ2" } ] } ] }, { "uniprot_ac": "Q9NQL2", "gene_name": "RRAGD", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9NQL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQL2" } ] } ] }, { "uniprot_ac": "Q9NQZ7", "gene_name": "ENTPD7", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9NQZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQZ7" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9NQZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQZ7" } ] } ] }, { "uniprot_ac": "Q9NRW1", "gene_name": "RAB6B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9NRW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NRW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW1" } ] } ] }, { "uniprot_ac": "Q9NVJ2", "gene_name": "ARL8B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9NVJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVJ2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NVJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVJ2" } ] } ] }, { "uniprot_ac": "Q9NY65", "gene_name": "TUBA8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9NY65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NY65" } ] } ] }, { "uniprot_ac": "Q9NYN1", "gene_name": "RASL12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9NYN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYN1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NYN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYN1" } ] } ] }, { "uniprot_ac": "Q9QUI0", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] } ] }, { "uniprot_ac": "Q9QXB9", "gene_name": "Drg2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXB9" } ] } ] }, { "uniprot_ac": "Q9QZ85", "gene_name": "Iigp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QZ85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZ85" } ] } ] }, { "uniprot_ac": "Q9UQ16", "gene_name": "DNM3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9UQ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ16" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q9UQ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ16" } ] } ] }, { "uniprot_ac": "Q9V3I2", "gene_name": "Rab5", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9V3I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3I2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9V3I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3I2" } ] } ] }, { "uniprot_ac": "Q9VM20", "gene_name": "Dmel\\CG5160", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9VM20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VM20" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9VM20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VM20" } ] } ] }, { "uniprot_ac": "Q9VRH6", "gene_name": "waw", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9VRH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRH6" } ] } ] }, { "uniprot_ac": "Q9VRY2", "gene_name": "Dmel\\CG8519", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9VRY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRY2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9VRY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRY2" } ] } ] }, { "uniprot_ac": "Q9W074", "gene_name": "HBS1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9W074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W074" } ] } ] }, { "uniprot_ac": "Q9Y227", "gene_name": "ENTPD4", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.42", "activity": "GDP + H2O = GMP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] } ] }, { "uniprot_ac": "Q9Y295", "gene_name": "DRG1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Y295", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y295" } ] } ] }, { "uniprot_ac": "Q9Y3L5", "gene_name": "RAP2C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] } ] }, { "uniprot_ac": "Q9Y450", "gene_name": "HBS1L", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Y450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y450" } ] } ] }, { "uniprot_ac": "Q9Z0E6", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Z0E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0E6" } ] } ] }, { "uniprot_ac": "Q9Z0N1", "gene_name": "Eif2s3x", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] } ] }, { "uniprot_ac": "Q9Z0N2", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }