{ "uniprot_canonical_ac": "P03901-1", "uniprot_ac": "P03901", "uniprot_id": "NU4LM_HUMAN", "mass": { "chemical_mass": 10741.0, "monoisotopic_mass": 10741.0 }, "refseq": { "ac": "YP_003024034", "name": "NADH dehydrogenase subunit 4L", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024034" }, "gene_names": [ { "name": "MT-ND4L", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P03901", "id": "P03901" }, { "name": "MTND4L", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024034", "id": "YP_003024034" }, { "name": "MTND4L", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03901", "id": "P03901" }, { "name": "NADH4L", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03901", "id": "P03901" }, { "name": "ND4L", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024034", "id": "YP_003024034" }, { "name": "ND4L", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03901", "id": "P03901" } ], "protein_names": [ { "name": "NADH-ubiquinone oxidoreductase chain 4L", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P03901" }, { "name": "7.1.1.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03901" }, { "name": "NADH dehydrogenase subunit 4L", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024034", "id": "YP_003024034" }, { "name": "NADH dehydrogenase subunit 4L", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03901" }, { "name": "ND4L", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03901" } ], "function": [ { "annotation": "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor (PubMed:28844695). Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation (PubMed:28844695).", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901#function" }, { "database": "PubMed", "id": "28844695", "url": "https://glygen.org/publication/PubMed/28844695" } ] } ], "disease": [ { "disease_id": "DOID:705", "recommended_name": { "id": "DOID:705", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:705", "name": "Leber hereditary optic neuropathy", "description": "" }, "synonyms": [ { "id": "DOID:705", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:705", "name": "Leber's hereditary optic neuropathy", "description": "" }, { "id": "DOID:705", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:705", "name": "Leber's optic atrophy", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Leber hereditary optic neuropathy", "description": "Leber's hereditary optic neuropathy (LHON) is a mitochondrial neurodegenerative disease affecting the optic nerve and often characterized by sudden vision loss in young adult carriers." }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "LHON", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Leber Hereditary optic atrophy", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Leber hereditary optic neuropathy", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Leber optic atrophy", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Leber's hereditary optic neuropathy", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Leber's optic atrophy", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "Lebers disease", "description": "" }, { "id": "MONDO:0010788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010788", "name": "optic atrophy, Leber type", "description": "" }, { "id": "MIM:535000", "resource": "MIM", "url": "https://www.omim.org/entry/535000", "name": "Leber hereditary optic neuropathy", "description": "Leber hereditary optic neuropathy" } ], "evidence": [ { "id": "535000", "database": "MIM", "url": "https://www.omim.org/entry/535000" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P03901", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03901" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "common_name": "Human" } ], "gene": [ { "name": "MT-ND4L", "url": "https://www.uniprot.org/uniprot/P03901", "locus": { "chromosome": "Mitochondrion", "start_pos": 10766, "end_pos": 10470, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000212907", "url": "https://www.ensembl.org/id/ENSG00000212907" } ] } } ], "crossref": [ { "id": "ENSG00000212907", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000212907", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL2363065", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2363065", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MT-ND4L", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MT-ND4L", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4539", "url": "https://www.ncbi.nlm.nih.gov/gene/4539", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7460", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7460", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P03901", "url": "https://www.ebi.ac.uk/intact/interactors/id:P03901*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001133", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001133", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039428", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039428", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4539", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4539", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "516004", "url": "http://www.omim.org/entry/516004", "database": "MIM", "categories": [ "Other" ] }, { "id": "535000", "url": "http://www.omim.org/entry/535000", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P03901", "url": "https://www.nextprot.org/entry/NX_P03901", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MYRSHLM", "url": "https://omabrowser.org/oma/group/MYRSHLM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11434", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11434", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11434:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11434:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5XTC", "url": "https://www.rcsb.org/structure/5XTC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTD", "url": "https://www.rcsb.org/structure/5XTD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00420", "url": "http://pfam.xfam.org/family/PF00420", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P03901", "url": "https://pharos.nih.gov/targets/P03901", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P03901", "url": "http://purl.obolibrary.org/obo/PR_P03901", "database": "PRO", "categories": [ "Protein" ] }, { "id": "YP_003024034", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_003024034", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "29091", "url": "https://www.rhea-db.org/rhea/29091", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P03901-1", "url": "https://www.uniprot.org/uniprot/P03901-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC", "length": 98, "header": "sp|P03901-1|NU4LM_HUMAN Isoform 1 of NADH-ubiquinone oxidoreductase chain 4L OS=Homo sapiens OX=9606 GN=MT-ND4L PE=1 SV=1 CANONICAL=P03901-1" }, "isoforms": [ { "isoform_ac": "P03901-1", "url": "", "sequence": { "sequence": "MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC", "length": 98, "header": "sp|P03901-1|NU4LM_HUMAN Isoform 1 of NADH-ubiquinone oxidoreductase chain 4L OS=Homo sapiens OX=9606 GN=MT-ND4L PE=1 SV=1 CANONICAL=P03901-1" }, "locus": { "chromosome": "Mitochondrion", "start_pos": 10763, "end_pos": 10470, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000361335.1", "url": "https://www.ensembl.org/id/ENST00000361335.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000354728.1", "url": "https://www.ensembl.org/id/ENSP00000354728.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Mitochondrial genome variation and the origin of modern humans.", "journal": "Nature", "date": "2000", "authors": "Ingman M, Kaessmann H, Paabo S, Gyllensten U", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "11130070", "url": "https://glygen.org/publication/PubMed/11130070" } ] }, { "title": "Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines.", "journal": "Genome Res.", "date": "2003", "authors": "Ingman Max, Gyllensten Ulf", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "12840039", "url": "https://glygen.org/publication/PubMed/12840039" } ] }, { "title": "Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J.", "journal": "Mol. Biol. Evol.", "date": "2003", "authors": "Moilanen Jukka S, Finnila Saara, Majamaa Kari", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "12949126", "url": "https://glygen.org/publication/PubMed/12949126" } ] }, { "title": "Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians.", "journal": "Int. J. Legal Med.", "date": "2004", "authors": "Coble Michael D, Just Rebecca S, O'Callaghan Jennifer E, Letmanyi Ilona H, Peterson Christine T, Irwin Jodi A, Parsons Thomas J", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "14760490", "url": "https://glygen.org/publication/PubMed/14760490" } ] }, { "title": "Normal variants of human mitochondrial DNA and translation products: the building of a reference data base.", "journal": "Hum. Genet.", "date": "1991", "authors": "Marzuki S, Noer A S, Lertrit P, Thyagarajan D, Kapsa R, Utthanaphol P, Byrne E", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "1757091", "url": "https://glygen.org/publication/PubMed/1757091" } ] }, { "title": "Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.", "journal": "Cell", "date": "2017", "authors": "Guo R, Zong S, Wu M, Gu J, Yang M", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "28844695", "url": "https://glygen.org/publication/PubMed/28844695" } ] }, { "title": "Six unidentified reading frames of human mitochondrial DNA encode components of the respiratory-chain NADH dehydrogenase.", "journal": "Nature", "date": "1985", "authors": "Chomyn A, Mariottini P, Cleeter M W, Ragan C I, Matsuno-Yagi A, Hatefi Y, Doolittle R F, Attardi G", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "3921850", "url": "https://glygen.org/publication/PubMed/3921850" } ] }, { "title": "Sequence and organization of the human mitochondrial genome.", "journal": "Nature", "date": "1981", "authors": "Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "7219534", "url": "https://glygen.org/publication/PubMed/7219534" } ] }, { "title": "Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Horai S, Hayasaka K, Kondo R, Tsugane K, Takahata N", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "7530363", "url": "https://glygen.org/publication/PubMed/7530363" } ] }, { "title": "Phylogenetic analysis of Leber's hereditary optic neuropathy mitochondrial DNA's indicates multiple independent occurrences of the common mutations.", "journal": "Human mutation", "date": "1995", "authors": "Brown MD, Torroni A, Reckord CL, Wallace DC", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "8680405", "url": "https://glygen.org/publication/PubMed/8680405" } ] }, { "title": "Comparison between the complete mitochondrial DNA sequences of Homo and the common chimpanzee based on nonchimeric sequences.", "journal": "J. Mol. Evol.", "date": "1996", "authors": "Arnason U, Xu X, Gullberg A", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "8919866", "url": "https://glygen.org/publication/PubMed/8919866" } ] }, { "title": "Somatic mutations of the mitochondrial genome in human colorectal tumours.", "journal": "Nature genetics", "date": "1998", "authors": "Polyak K, Li Y, Zhu H, Lengauer C, Willson JK, Markowitz SD, Trush MA, Kinzler KW, Vogelstein B", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "reference": [ { "type": "PubMed", "id": "9806551", "url": "https://glygen.org/publication/PubMed/9806551" } ] } ], "pathway": [ { "id": "hsa:4539", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4539", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P03903-1", "protein_name": "NADH-ubiquinone oxidoreductase chain 4L", "gene_name": "Mtnd4l", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPSTFFNLTMAFSLSLLGTLMFRSHLMSTLLCLEGMVLSLFIMTSVTSLNSNSMSSMPIPITILVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC", "length": 98 }, "evidence": [ { "id": "45916517", "url": "http://www.informatics.jax.org/homology/45916517", "database": "MGI" }, { "id": "P03901", "url": "https://omabrowser.org/oma/group/P03901/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P05507-1", "protein_name": "NADH-ubiquinone oxidoreductase chain 4L", "gene_name": "Mtnd4l", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTSAFLNLTMAFTLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMTSTSTLNSNSMISMTIPITILVFAACEAAVGLALLVKISNTYGTDYVQNLNLLQC", "length": 98 }, "evidence": [ { "id": "45916517", "url": "http://www.informatics.jax.org/homology/45916517", "database": "MGI" }, { "id": "P03901", "url": "https://omabrowser.org/oma/group/P03901/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P18934-1", "protein_name": "NADH-ubiquinone oxidoreductase chain 4L", "gene_name": "mt:ND4L", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MIMILYWSLPMILFILGLFCFVSNRKHLLSMLLSLEFIVLMLFFMLFIYLNMLNYESYFSMMFLTFSVCEGALGLSILVSMIRTHGNDYFQSFSIM", "length": 96 }, "evidence": [ { "id": "P03901", "url": "https://omabrowser.org/oma/group/P03901/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P56632-1", "protein_name": "NADH-ubiquinone oxidoreductase chain 4L", "gene_name": "MT-ND4L", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MPLVYMNIIMAFAIALAGLLMYRSHLMSSLLCLEGMMLSLFIMSTLIILNTHFTLANMMPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC", "length": 98 }, "evidence": [ { "id": "P03901", "url": "https://omabrowser.org/oma/group/P03901/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex I", "id": "GO:0005747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "mitochondrial electron transport, NADH to ubiquinone", "id": "GO:0006120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006120", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "pmid": "" }, { "name": "proton motive force-driven mitochondrial ATP synthesis", "id": "GO:0042776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042776", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "pmid": "" }, { "name": "aerobic respiration", "id": "GO:0009060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009060", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "NADH dehydrogenase (ubiquinone) activity", "id": "GO:0008137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008137", "evidence": [ { "database": "UniProtKB", "id": "P03901", "url": "https://www.uniprot.org/uniprot/P03901" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "29091", "name": "", "equation": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P03889-1", "P11662-1", "P19234-1", "P05507-1", "Q66HF1-1", "P05506-1", "P05508-1", "P11661-1", "Q641Y2-1", "P03926-1", "Q5XIH3-1", "P03897-1", "P03915-1", "P03923-1", "P03891-1", "P03905-1", "P03886-1", "P28331-1", "O00217-1", "O75306-1", "O75489-1", "O75251-1", "P49821-1", "P19404-1", "P03901-1", "P03888-1", "Q91VD9-1", "Q91WD5-1", "Q8K3J1-1", "P03899-1", "P03921-1", "P03893-1", "P03911-1", "P03925-1", "Q9DCT2-1", "Q9DC70-1", "P03903-1", "Q91YT0-1", "Q9D6J6-1", "Q55CD9-1", "O21047-1", "O21048-1", "P22237-1", "Q34313-1", "Q37312-1", "Q37313-1", "Q37314-1", "Q54F10-1", "Q9XK79-1", "Q23883-1", "Q34312-1", "Q54I90-1", "P18930-1", "P18931-1", "P18932-1", "P18934-1", "Q94511-1", "Q9VF27-1", "Q9VZU4-1", "P03896-1", "P18929-1", "P18933-1", "Q9VMI3-1" ], "evidence": [ { "id": "29091", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/29091" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O00217", "gene_name": "NDUFS8", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "O00217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00217" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "O00217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00217" } ] } ] }, { "uniprot_ac": "O21047", "gene_name": "nad4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "O21047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21047" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "O21047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21047" } ] } ] }, { "uniprot_ac": "O21048", "gene_name": "nad2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "O21048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21048" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "O21048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21048" } ] } ] }, { "uniprot_ac": "O75251", "gene_name": "NDUFS7", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "O75251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75251" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "O75251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75251" } ] } ] }, { "uniprot_ac": "O75306", "gene_name": "NDUFS2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "O75306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75306" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "O75306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75306" } ] } ] }, { "uniprot_ac": "O75489", "gene_name": "NDUFS3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "O75489", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75489" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "O75489", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75489" } ] } ] }, { "uniprot_ac": "P03886", "gene_name": "MT-ND1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03886" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03886" } ] } ] }, { "uniprot_ac": "P03888", "gene_name": "Mtnd1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03888", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03888" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03888", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03888" } ] } ] }, { "uniprot_ac": "P03889", "gene_name": "Mtnd1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03889", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03889" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03889", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03889" } ] } ] }, { "uniprot_ac": "P03891", "gene_name": "MT-ND2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03891" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03891" } ] } ] }, { "uniprot_ac": "P03893", "gene_name": "mt-Nd2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03893", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03893" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03893", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03893" } ] } ] }, { "uniprot_ac": "P03896", "gene_name": "mt:ND2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03896", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03896" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03896", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03896" } ] } ] }, { "uniprot_ac": "P03897", "gene_name": "MT-ND3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03897" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03897" } ] } ] }, { "uniprot_ac": "P03899", "gene_name": "mt-Nd3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03899" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03899" } ] } ] }, { "uniprot_ac": "P03901", "gene_name": "MT-ND4L", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03901" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03901" } ] } ] }, { "uniprot_ac": "P03903", "gene_name": "Mtnd4l", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03903" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03903" } ] } ] }, { "uniprot_ac": "P03905", "gene_name": "MT-ND4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03905" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03905" } ] } ] }, { "uniprot_ac": "P03911", "gene_name": "Mtnd4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03911" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03911" } ] } ] }, { "uniprot_ac": "P03915", "gene_name": "MT-ND5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03915" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03915" } ] } ] }, { "uniprot_ac": "P03921", "gene_name": "Mtnd5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03921" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03921" } ] } ] }, { "uniprot_ac": "P03923", "gene_name": "MT-ND6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03923" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03923" } ] } ] }, { "uniprot_ac": "P03925", "gene_name": "Mtnd6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03925", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03925" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03925", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03925" } ] } ] }, { "uniprot_ac": "P03926", "gene_name": "Mtnd6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P03926", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03926" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P03926", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03926" } ] } ] }, { "uniprot_ac": "P05506", "gene_name": "mt-Nd3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P05506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05506" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P05506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05506" } ] } ] }, { "uniprot_ac": "P05507", "gene_name": "Mtnd4l", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P05507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05507" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P05507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05507" } ] } ] }, { "uniprot_ac": "P05508", "gene_name": "Mtnd4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P05508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05508" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P05508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05508" } ] } ] }, { "uniprot_ac": "P11661", "gene_name": "Mtnd5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P11661", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11661" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P11661", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11661" } ] } ] }, { "uniprot_ac": "P11662", "gene_name": "mt-Nd2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P11662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11662" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P11662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11662" } ] } ] }, { "uniprot_ac": "P18929", "gene_name": "mt:ND1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18929" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18929" } ] } ] }, { "uniprot_ac": "P18930", "gene_name": "mt:ND3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18930" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18930" } ] } ] }, { "uniprot_ac": "P18931", "gene_name": "mt:ND4", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18931", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18931" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18931", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18931" } ] } ] }, { "uniprot_ac": "P18932", "gene_name": "mt:ND5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18932" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18932" } ] } ] }, { "uniprot_ac": "P18933", "gene_name": "mt:ND6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18933" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18933" } ] } ] }, { "uniprot_ac": "P18934", "gene_name": "mt:ND4L", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P18934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18934" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P18934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18934" } ] } ] }, { "uniprot_ac": "P19234", "gene_name": "Ndufv2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P19234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19234" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P19234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19234" } ] } ] }, { "uniprot_ac": "P19404", "gene_name": "NDUFV2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P19404", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19404" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P19404", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19404" } ] } ] }, { "uniprot_ac": "P22237", "gene_name": "nad9", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P22237", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22237" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P22237", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22237" } ] } ] }, { "uniprot_ac": "P28331", "gene_name": "NDUFS1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P28331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28331" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P28331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28331" } ] } ] }, { "uniprot_ac": "P49821", "gene_name": "NDUFV1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "P49821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49821" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "P49821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49821" } ] } ] }, { "uniprot_ac": "Q23883", "gene_name": "nad7", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q23883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23883" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q23883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23883" } ] } ] }, { "uniprot_ac": "Q34312", "gene_name": "nad11", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q34312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q34312" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q34312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q34312" } ] } ] }, { "uniprot_ac": "Q34313", "gene_name": "nad5", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q34313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q34313" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q34313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q34313" } ] } ] }, { "uniprot_ac": "Q37312", "gene_name": "nad3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q37312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q37312" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q37312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q37312" } ] } ] }, { "uniprot_ac": "Q37313", "gene_name": "nad1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q37313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q37313" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q37313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q37313" } ] } ] }, { "uniprot_ac": "Q37314", "gene_name": "nad6", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q37314", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q37314" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q37314", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q37314" } ] } ] }, { "uniprot_ac": "Q54F10", "gene_name": "ndufv2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q54F10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54F10" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q54F10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54F10" } ] } ] }, { "uniprot_ac": "Q54I90", "gene_name": "ndufv1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q54I90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54I90" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q54I90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54I90" } ] } ] }, { "uniprot_ac": "Q55CD9", "gene_name": "", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q55CD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CD9" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q55CD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CD9" } ] } ] }, { "uniprot_ac": "Q5XIH3", "gene_name": "Ndufv1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q5XIH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIH3" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q5XIH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIH3" } ] } ] }, { "uniprot_ac": "Q641Y2", "gene_name": "Ndufs2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q641Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Y2" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q641Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Y2" } ] } ] }, { "uniprot_ac": "Q66HF1", "gene_name": "Ndufs1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q66HF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HF1" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q66HF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HF1" } ] } ] }, { "uniprot_ac": "Q8K3J1", "gene_name": "Ndufs8", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q8K3J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3J1" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q8K3J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3J1" } ] } ] }, { "uniprot_ac": "Q91VD9", "gene_name": "Ndufs1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q91VD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VD9" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q91VD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VD9" } ] } ] }, { "uniprot_ac": "Q91WD5", "gene_name": "Ndufs2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q91WD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WD5" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q91WD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WD5" } ] } ] }, { "uniprot_ac": "Q91YT0", "gene_name": "Ndufv1", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q91YT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YT0" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q91YT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YT0" } ] } ] }, { "uniprot_ac": "Q94511", "gene_name": "ND-75", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q94511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94511" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q94511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94511" } ] } ] }, { "uniprot_ac": "Q9D6J6", "gene_name": "Ndufv2", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9D6J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6J6" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9D6J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6J6" } ] } ] }, { "uniprot_ac": "Q9DC70", "gene_name": "Ndufs7", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9DC70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DC70" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9DC70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DC70" } ] } ] }, { "uniprot_ac": "Q9DCT2", "gene_name": "Ndufs3", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9DCT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCT2" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9DCT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCT2" } ] } ] }, { "uniprot_ac": "Q9VF27", "gene_name": "ND-23", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9VF27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF27" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9VF27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF27" } ] } ] }, { "uniprot_ac": "Q9VMI3", "gene_name": "ND-51", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9VMI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMI3" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9VMI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMI3" } ] } ] }, { "uniprot_ac": "Q9VZU4", "gene_name": "ND-30", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9VZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZU4" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9VZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VZU4" } ] } ] }, { "uniprot_ac": "Q9XK79", "gene_name": "nad4L", "activity": [ { "ec_number": "7.1.1.2", "activity": "a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+).", "evidence": [ { "id": "Q9XK79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9XK79" } ] }, { "ec_number": "7.1.1.2", "activity": "", "evidence": [ { "id": "Q9XK79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9XK79" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }