{ "uniprot_canonical_ac": "P02788-1", "uniprot_ac": "P02788", "uniprot_id": "TRFL_HUMAN", "mass": { "chemical_mass": 78182.0, "monoisotopic_mass": 78182.0 }, "refseq": { "ac": "NP_001186078", "name": "lactotransferrin isoform 2", "summary": "This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an important component of the non-specific immune system. The protein demonstrates a broad spectrum of properties, including regulation of iron homeostasis, host defense against a broad range of microbial infections, anti-inflammatory activity, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Antimicrobial, antiviral, antifungal and antiparasitic activity has been found for this protein and its peptides. Activity against both DNA and RNA viruses has been found, including activity against SARS-CoV-2, and HIV. [provided by RefSeq, Jul 2021].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" }, "gene_names": [ { "name": "LTF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02788", "id": "P02788" }, { "name": "GIG12; HEL110; HLF2; LF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078", "id": "NP_001186078" }, { "name": "GIG12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02788", "id": "P02788" }, { "name": "LF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02788", "id": "P02788" }, { "name": "LTF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078", "id": "NP_001186078" } ], "protein_names": [ { "name": "Lactotransferrin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02788" }, { "name": "3.4.21.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02788" }, { "name": "Growth-inhibiting protein 12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02788" }, { "name": "Lactoferrin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02788" }, { "name": "Talalactoferrin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02788" }, { "name": "lactotransferrin isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078", "id": "NP_001186078" }, { "name": "talalactoferrin; neutrophil lactoferrin; growth-inhibiting protein 12; epididymis luminal protein 110; kaliocin-1; lactoferroxin; lactoferricin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078", "id": "NP_001186078" } ], "function": [ { "annotation": "Ceruloplasmin Reduces the Lactoferrin/Oleic Acid Antitumor Complex-Mediated Release of Heme-Containing Proteins from Blood Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" }, { "database": "PubMed", "id": "38069040", "url": "https://glygen.org/publication/PubMed/38069040" } ] }, { "annotation": "Has antimicrobial activity and is able to permeabilize different ions through liposomal membranes.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "12693969", "url": "https://glygen.org/publication/PubMed/12693969" } ] }, { "annotation": "Has opioid antagonist activity (PubMed:1369293). Shows higher degrees of preference for kappa-receptors than for mu-receptors (PubMed:1369293).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "1369293", "url": "https://glygen.org/publication/PubMed/1369293" } ] }, { "annotation": "Has opioid antagonist activity (PubMed:1369293). Shows preference for mu-receptor (PubMed:1369293).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "1369293", "url": "https://glygen.org/publication/PubMed/1369293" } ] }, { "annotation": "Lactoferricin binds to the bacterial surface and is crucial for the bactericidal functions. Has some antiviral activity against papillomavirus infection (PubMed:17481742). N-terminal region shows strong antifungal activity against C.albicans (PubMed:11083624). Contains two BBXB heparin-binding consensus sequences that appear to form the predominate functional GAG-binding site.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "17481742", "url": "https://glygen.org/publication/PubMed/17481742" }, { "database": "PubMed", "id": "11083624", "url": "https://glygen.org/publication/PubMed/11083624" } ] }, { "annotation": "Lactoferrin Modulates Induction of Transcription Factor c-Fos in Neuronal Cultures. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" }, { "database": "PubMed", "id": "37176079", "url": "https://glygen.org/publication/PubMed/37176079" } ] }, { "annotation": "Lactoferrin is an iron binding protein that also has antimicrobial, antiviral, antifungal and antiparasitic activity. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" }, { "database": "PubMed", "id": "18573312", "url": "https://glygen.org/publication/PubMed/18573312" } ] }, { "annotation": "Major iron-binding and multifunctional protein found in exocrine fluids such as breast milk and mucosal secretions (PubMed:14573629, PubMed:1599934, PubMed:6802759, PubMed:3169987, PubMed:11179314, PubMed:12693969). Has antimicrobial activity, which depends on the extracellular cation concentration (PubMed:6802759). Antimicrobial properties include bacteriostasis, which is related to its ability to sequester free iron and thus inhibit microbial growth, as well as direct bactericidal properties leading to the release of lipopolysaccharides from the bacterial outer membrane (PubMed:14573629, PubMed:1599934, PubMed:6802759, PubMed:3169987, PubMed:11179314, PubMed:12693969). Can also prevent bacterial biofilm development in P.aeruginosa infection (PubMed:12037568). Has weak antifungal activity against C.albicans (PubMed:11083624). Has anabolic, differentiating and anti-apoptotic effects on osteoblasts and can also inhibit osteoclastogenesis, possibly playing a role in the regulation of bone growth (PubMed:15166119). Promotes binding of species C adenoviruses to epithelial cells, promoting adenovirus infection (PubMed:17079302). Can inhibit papillomavirus infections (PubMed:17481742). Stimulates the TLR4 signaling pathway leading to NF-kappa-B activation and subsequent pro-inflammatory cytokine production while also interfering with the lipopolysaccharide (LPS)-stimulated TLR4 signaling (PubMed:20345905). Inhibits neutrophil granulocyte migration to sites of apoptosis, when secreted by apoptotic cells (PubMed:19033648). Stimulates VEGFA-mediated endothelial cell migration and proliferation (PubMed:16842782). Binds heparin, chondroitin sulfate and possibly other glycosaminoglycans (GAGs) (PubMed:9359845). Also binds specifically to pneumococcal surface protein A (PspA), the lipid A portion of bacterial lipopolysaccharide (LPS), lysozyme and DNA (PubMed:9359845).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "9359845", "url": "https://glygen.org/publication/PubMed/9359845" }, { "database": "PubMed", "id": "11179314", "url": "https://glygen.org/publication/PubMed/11179314" }, { "database": "PubMed", "id": "17079302", "url": "https://glygen.org/publication/PubMed/17079302" }, { "database": "PubMed", "id": "20345905", "url": "https://glygen.org/publication/PubMed/20345905" }, { "database": "PubMed", "id": "17481742", "url": "https://glygen.org/publication/PubMed/17481742" }, { "database": "PubMed", "id": "15166119", "url": "https://glygen.org/publication/PubMed/15166119" }, { "database": "PubMed", "id": "3169987", "url": "https://glygen.org/publication/PubMed/3169987" }, { "database": "PubMed", "id": "16842782", "url": "https://glygen.org/publication/PubMed/16842782" }, { "database": "PubMed", "id": "12037568", "url": "https://glygen.org/publication/PubMed/12037568" }, { "database": "PubMed", "id": "6802759", "url": "https://glygen.org/publication/PubMed/6802759" }, { "database": "PubMed", "id": "11083624", "url": "https://glygen.org/publication/PubMed/11083624" }, { "database": "PubMed", "id": "19033648", "url": "https://glygen.org/publication/PubMed/19033648" }, { "database": "PubMed", "id": "1599934", "url": "https://glygen.org/publication/PubMed/1599934" }, { "database": "PubMed", "id": "12693969", "url": "https://glygen.org/publication/PubMed/12693969" }, { "database": "PubMed", "id": "14573629", "url": "https://glygen.org/publication/PubMed/14573629" } ] }, { "annotation": "Results identify the transcription start sites of the Delta lactoferrin (delta LF) in mammary gland and bone marrow and demonstrated that delta LF is the product of an alternative promoter present in the first intron of the lactoferrin gene.", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" }, { "database": "PubMed", "id": "12565886", "url": "https://glygen.org/publication/PubMed/12565886" } ] }, { "annotation": "The lactotransferrin transferrin-like domain 1 functions as a serine protease of the peptidase S60 family that cuts arginine rich regions (PubMed:12535064). This function contributes to the antimicrobial activity (PubMed:12535064). Shows a preferential cleavage at -Arg-Ser-Arg-Arg-|- and -Arg-Arg-Ser-Arg-|-, and of Z-Phe-Arg-|-aminomethylcoumarin sites (PubMed:12535064).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "12535064", "url": "https://glygen.org/publication/PubMed/12535064" } ] }, { "annotation": "This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an important component of the non-specific immune system. The protein demonstrates a broad spectrum of properties, including regulation of iron homeostasis, host defense against a broad range of microbial infections, anti-inflammatory activity, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Antimicrobial, antiviral, antifungal and antiparasitic activity has been found for this protein and its peptides. Activity against both DNA and RNA viruses has been found, including activity against SARS-CoV-2, and HIV. [provided by RefSeq, Jul 2021].", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" } ] }, { "annotation": "Transcription factor with antiproliferative properties and ability to induce cell cycle arrest (PubMed:15222485). Binds to the DeltaLf response element found in the SKP1, BAX, DCPS, and SELENOH promoters (PubMed:22320386).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "22320386", "url": "https://glygen.org/publication/PubMed/22320386" }, { "database": "PubMed", "id": "15222485", "url": "https://glygen.org/publication/PubMed/15222485" } ] }, { "annotation": "Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate.", "evidence": [ { "database": "UniProtKB", "id": "E7ER44", "url": "https://www.uniprot.org/uniprot/E7ER44#function" }, { "database": "UniProtKB", "id": "ARBA00002831", "url": "https://www.uniprot.org/uniprot/ARBA00002831#function" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#function" }, { "database": "PubMed", "id": "22900286", "url": "https://glygen.org/publication/PubMed/22900286" }, { "database": "UniProtKB", "id": "E7EQB2", "url": "https://www.uniprot.org/uniprot/E7EQB2#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1559602610", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1559602610" }, { "id": "rs1559602610", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1559602610" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 147, "end_pos": 147, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVP->NVS).", "chr_id": "3", "chr_pos": "46455817", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P147", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs554556520", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs554556520" }, { "id": "rs554556520", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs554556520" }, { "id": "rs554556520", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs554556520" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 156, "end_pos": 156, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->IWT).", "chr_id": "3", "chr_pos": "46455861", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N156", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745890287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745890287" }, { "id": "rs745890287", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745890287#frequency_tab" }, { "id": "rs745890287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745890287" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 156, "end_pos": 156, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "3", "chr_pos": "46455828", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N156", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs148941436", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148941436" }, { "id": "rs148941436", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148941436" }, { "id": "rs148941436", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148941436#frequency_tab" }, { "id": "rs148941436", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148941436" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->NWM).", "chr_id": "3", "chr_pos": "46455822", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1575314291", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575314291" }, { "id": "rs1575314291", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1575314291" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 236, "end_pos": 236, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "3", "chr_pos": "46450671", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D236", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs572780496", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs572780496" }, { "id": "rs572780496", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs572780496" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 320, "end_pos": 320, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KDS->NDS).", "chr_id": "3", "chr_pos": "46449951", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "K320", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs142586198", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142586198" }, { "id": "rs142586198", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142586198" }, { "id": "rs142586198", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142586198" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 387, "end_pos": 387, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).", "chr_id": "3", "chr_pos": "46448915", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S387", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1323583017", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1323583017" }, { "id": "rs1323583017", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1323583017#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 466, "end_pos": 466, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLT->NLT).", "chr_id": "3", "chr_pos": "46445397", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S466", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760857395", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760857395" }, { "id": "rs760857395", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760857395" }, { "id": "rs760857395", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760857395" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 491, "end_pos": 491, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIP->NIS).", "chr_id": "3", "chr_pos": "46445323", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P491", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777559903", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777559903" }, { "id": "rs777559903", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777559903" }, { "id": "rs777559903", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777559903#frequency_tab" }, { "id": "rs777559903", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777559903" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 499, "end_pos": 499, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->NQM).", "chr_id": "3", "chr_pos": "46445298", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T499", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P02788", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02788" } ], "glycoeffect": [], "start_pos": 49, "end_pos": 49, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "46459718", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R49", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1575307978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575307978" }, { "id": "rs1575307978", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1575307978" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 507, "end_pos": 507, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YFS->NFS).", "chr_id": "3", "chr_pos": "46443577", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y507", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768065454", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768065454" }, { "id": "rs768065454", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768065454" }, { "id": "rs768065454", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768065454" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 541, "end_pos": 541, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSN->NSS).", "chr_id": "3", "chr_pos": "46443474", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N541", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1383877348", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1383877348" }, { "id": "rs1383877348", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1383877348#frequency_tab" }, { "id": "rs1383877348", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1383877348" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 578, "end_pos": 578, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNN->NNS).", "chr_id": "3", "chr_pos": "46439471", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N578", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757373669", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757373669" }, { "id": "rs757373669", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757373669" }, { "id": "rs757373669", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757373669#frequency_tab" }, { "id": "rs757373669", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757373669" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 580, "end_pos": 580, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEA->NES).", "chr_id": "3", "chr_pos": "46439466", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A580", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757373669", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757373669" }, { "id": "rs757373669", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757373669" }, { "id": "rs757373669", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757373669#frequency_tab" }, { "id": "rs757373669", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757373669" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 580, "end_pos": 580, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEA->NET).", "chr_id": "3", "chr_pos": "46439466", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A580", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746996787", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746996787" }, { "id": "rs746996787", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746996787" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 642, "end_pos": 642, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->KGS).", "chr_id": "3", "chr_pos": "46438112", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N642", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1471047941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1471047941" }, { "id": "rs1471047941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1471047941#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 642, "end_pos": 642, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "3", "chr_pos": "46438113", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N642", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770672407", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770672407" }, { "id": "rs770672407", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770672407" }, { "id": "rs770672407", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770672407" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 644, "end_pos": 644, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGF).", "chr_id": "3", "chr_pos": "46438107", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S644", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747980963", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747980963" }, { "id": "rs747980963", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747980963" }, { "id": "rs747980963", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747980963" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 695, "end_pos": 695, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KCS->NCS).", "chr_id": "3", "chr_pos": "46437953", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K695", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P02788", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02788" } ], "glycoeffect": [], "start_pos": 69, "end_pos": 69, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "V", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "46459657", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A69", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 140, "end_pos": 140, "sequence_org": "R", "sequence_mut": "D", "comment": "Disrupts anion binding site and destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "8931543", "url": "https://glygen.org/publication/PubMed/8931543" }, { "database": "PubMed", "id": "12037297", "url": "https://glygen.org/publication/PubMed/12037297" } ] }, { "start_pos": 140, "end_pos": 140, "sequence_org": "R", "sequence_mut": "E", "comment": "Disrupts anion binding site and destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "8931543", "url": "https://glygen.org/publication/PubMed/8931543" }, { "database": "PubMed", "id": "12037297", "url": "https://glygen.org/publication/PubMed/12037297" } ] }, { "start_pos": 140, "end_pos": 140, "sequence_org": "R", "sequence_mut": "S", "comment": "Disrupts anion binding site and destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "8931543", "url": "https://glygen.org/publication/PubMed/8931543" }, { "database": "PubMed", "id": "12037297", "url": "https://glygen.org/publication/PubMed/12037297" } ] }, { "start_pos": 20, "end_pos": 21, "sequence_org": "GR", "sequence_mut": "", "comment": "Impairs binding to heparin, lipid A, lysozyme and DNA.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ] }, { "start_pos": 20, "end_pos": 22, "sequence_org": "GRR", "sequence_mut": "", "comment": "Greatly impairs binding to heparin, lipid A, lysozyme and DNA. Impairs antibacterial activity.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "11179314", "url": "https://glygen.org/publication/PubMed/11179314" } ] }, { "start_pos": 20, "end_pos": 23, "sequence_org": "GRRR", "sequence_mut": "", "comment": "Abolishes binding to heparin, lipid A, lysozyme and DNA.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9359845", "url": "https://glygen.org/publication/PubMed/9359845" } ] }, { "start_pos": 229, "end_pos": 229, "sequence_org": "R", "sequence_mut": "E", "comment": "Destabilizes iron binding slightly.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12450380", "url": "https://glygen.org/publication/PubMed/12450380" }, { "database": "PubMed", "id": "10828980", "url": "https://glygen.org/publication/PubMed/10828980" } ] }, { "start_pos": 229, "end_pos": 229, "sequence_org": "R", "sequence_mut": "G", "comment": "Destabilizes iron binding slightly.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12450380", "url": "https://glygen.org/publication/PubMed/12450380" }, { "database": "PubMed", "id": "10828980", "url": "https://glygen.org/publication/PubMed/10828980" } ] }, { "start_pos": 229, "end_pos": 229, "sequence_org": "R", "sequence_mut": "K", "comment": "Destabilizes iron binding significantly.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12450380", "url": "https://glygen.org/publication/PubMed/12450380" }, { "database": "PubMed", "id": "10828980", "url": "https://glygen.org/publication/PubMed/10828980" } ] }, { "start_pos": 229, "end_pos": 229, "sequence_org": "R", "sequence_mut": "L", "comment": "Destabilizes iron binding significantly.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12450380", "url": "https://glygen.org/publication/PubMed/12450380" }, { "database": "PubMed", "id": "10828980", "url": "https://glygen.org/publication/PubMed/10828980" } ] }, { "start_pos": 270, "end_pos": 270, "sequence_org": "P", "sequence_mut": "V", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12535064", "url": "https://glygen.org/publication/PubMed/12535064" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "A", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "C", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "E", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "F", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "G", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "L", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "M", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "P", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "Q", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "T", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "H", "sequence_mut": "Y", "comment": "Destabilizes iron binding.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "start_pos": 278, "end_pos": 278, "sequence_org": "S", "sequence_mut": "A", "comment": "No protease activity.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12535064", "url": "https://glygen.org/publication/PubMed/12535064" } ] }, { "start_pos": 79, "end_pos": 79, "sequence_org": "D", "sequence_mut": "S", "comment": "Impairs iron binding and changes domain closure.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "8594202", "url": "https://glygen.org/publication/PubMed/8594202" } ] }, { "start_pos": 92, "end_pos": 92, "sequence_org": "K", "sequence_mut": "A", "comment": "Almost no protease activity.", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "12535064", "url": "https://glygen.org/publication/PubMed/12535064" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "76.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "82.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "68.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "72.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "53.2", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "80.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "86.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "63.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "85.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02788" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "common_name": "Human" } ], "gene": [ { "name": "LTF", "url": "https://www.uniprot.org/uniprot/P02788", "locus": { "chromosome": "3", "start_pos": 46435645, "end_pos": 46485234, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000012223", "url": "https://www.ensembl.org/id/ENSG00000012223" } ] } } ], "crossref": [ { "id": "ENSG00000012223", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000012223", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P02788", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02788", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd13617", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd13617", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd13618", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd13618", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4523161", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4523161", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "LTF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LTF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4057", "url": "https://www.ncbi.nlm.nih.gov/gene/4057", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2842", "url": "https://glyconnect.expasy.org/browser/proteins/2842", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6720", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6720", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "E7EQB2", "url": "https://www.ebi.ac.uk/intact/interactors/id:E7EQB2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P02788", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02788*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018195", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018195", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030684", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030684", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4057", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4057", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "150210", "url": "http://www.omim.org/entry/150210", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02788", "url": "https://www.nextprot.org/entry/NX_P02788", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "EAQPRTH", "url": "https://omabrowser.org/oma/group/EAQPRTH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2906687at2759", "url": "http://www.orthodb.org/?query=2906687at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11485", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11485", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11485:SF55", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11485:SF55", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1B0L", "url": "https://www.rcsb.org/structure/1B0L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BKA", "url": "https://www.rcsb.org/structure/1BKA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CB6", "url": "https://www.rcsb.org/structure/1CB6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1DSN", "url": "https://www.rcsb.org/structure/1DSN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EH3", "url": "https://www.rcsb.org/structure/1EH3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FCK", "url": "https://www.rcsb.org/structure/1FCK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H43", "url": "https://www.rcsb.org/structure/1H43", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H44", "url": "https://www.rcsb.org/structure/1H44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H45", "url": "https://www.rcsb.org/structure/1H45", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HSE", "url": "https://www.rcsb.org/structure/1HSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1L5T", "url": "https://www.rcsb.org/structure/1L5T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LCF", "url": "https://www.rcsb.org/structure/1LCF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LCT", "url": "https://www.rcsb.org/structure/1LCT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LFG", "url": "https://www.rcsb.org/structure/1LFG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LFH", "url": "https://www.rcsb.org/structure/1LFH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LFI", "url": "https://www.rcsb.org/structure/1LFI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LGB", "url": "https://www.rcsb.org/structure/1LGB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1N76", "url": "https://www.rcsb.org/structure/1N76", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SQY", "url": "https://www.rcsb.org/structure/1SQY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U62", "url": "https://www.rcsb.org/structure/1U62", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VFD", "url": "https://www.rcsb.org/structure/1VFD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VFE", "url": "https://www.rcsb.org/structure/1VFE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XV4", "url": "https://www.rcsb.org/structure/1XV4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XV7", "url": "https://www.rcsb.org/structure/1XV7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z6V", "url": "https://www.rcsb.org/structure/1Z6V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z6W", "url": "https://www.rcsb.org/structure/1Z6W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BJJ", "url": "https://www.rcsb.org/structure/2BJJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2DP4", "url": "https://www.rcsb.org/structure/2DP4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GMC", "url": "https://www.rcsb.org/structure/2GMC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GMD", "url": "https://www.rcsb.org/structure/2GMD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HD4", "url": "https://www.rcsb.org/structure/2HD4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2PMS", "url": "https://www.rcsb.org/structure/2PMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JRD", "url": "https://www.rcsb.org/structure/7JRD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7N88", "url": "https://www.rcsb.org/structure/7N88", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00405", "url": "http://pfam.xfam.org/family/PF00405", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02788", "url": "https://pharos.nih.gov/targets/P02788", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053045", "url": "https://proconsortium.org/app/entry/PR:000053045", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053046", "url": "https://proconsortium.org/app/entry/PR:000053046", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053047", "url": "https://proconsortium.org/app/entry/PR:000053047", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053048", "url": "https://proconsortium.org/app/entry/PR:000053048", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053049", "url": "https://proconsortium.org/app/entry/PR:000053049", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053050", "url": "https://proconsortium.org/app/entry/PR:000053050", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053051", "url": "https://proconsortium.org/app/entry/PR:000053051", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053052", "url": "https://proconsortium.org/app/entry/PR:000053052", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053053", "url": "https://proconsortium.org/app/entry/PR:000053053", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053054", "url": "https://proconsortium.org/app/entry/PR:000053054", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053055", "url": "https://proconsortium.org/app/entry/PR:000053055", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053056", "url": "https://proconsortium.org/app/entry/PR:000053056", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053057", "url": "https://proconsortium.org/app/entry/PR:000053057", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053058", "url": "https://proconsortium.org/app/entry/PR:000053058", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053059", "url": "https://proconsortium.org/app/entry/PR:000053059", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053060", "url": "https://proconsortium.org/app/entry/PR:000053060", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053061", "url": "https://proconsortium.org/app/entry/PR:000053061", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053062", "url": "https://proconsortium.org/app/entry/PR:000053062", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053063", "url": "https://proconsortium.org/app/entry/PR:000053063", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053064", "url": "https://proconsortium.org/app/entry/PR:000053064", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053065", "url": "https://proconsortium.org/app/entry/PR:000053065", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053066", "url": "https://proconsortium.org/app/entry/PR:000053066", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053067", "url": "https://proconsortium.org/app/entry/PR:000053067", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053068", "url": "https://proconsortium.org/app/entry/PR:000053068", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053069", "url": "https://proconsortium.org/app/entry/PR:000053069", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053070", "url": "https://proconsortium.org/app/entry/PR:000053070", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053071", "url": "https://proconsortium.org/app/entry/PR:000053071", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053072", "url": "https://proconsortium.org/app/entry/PR:000053072", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02788", "url": "http://purl.obolibrary.org/obo/PR_P02788", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1222449", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1222449", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02788", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A804HKN5", "url": "https://www.uniprot.org/uniprot/A0A804HKN5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HKN5-1", "url": "https://www.uniprot.org/uniprot/A0A804HKN5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JCF5", "url": "https://www.uniprot.org/uniprot/C9JCF5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JCF5-1", "url": "https://www.uniprot.org/uniprot/C9JCF5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQB2", "url": "https://www.uniprot.org/uniprot/E7EQB2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQB2-1", "url": "https://www.uniprot.org/uniprot/E7EQB2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ER44", "url": "https://www.uniprot.org/uniprot/E7ER44", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ER44-1", "url": "https://www.uniprot.org/uniprot/E7ER44-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02788-1", "url": "https://www.uniprot.org/uniprot/P02788-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02788-2", "url": "https://www.uniprot.org/uniprot/P02788-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK", "length": 710, "header": "sp|P02788-1|TRFL_HUMAN Isoform 1 of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6 CANONICAL=P02788-1" }, "isoforms": [ { "isoform_ac": "A0A804HKN5-1", "url": "", "sequence": { "sequence": "MGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAI", "length": 55, "header": "tr|A0A804HKN5-1|A0A804HKN5_HUMAN Computationally mapped isoform of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=1 CANONICAL=P02788-1" }, "locus": { "chromosome": "3", "start_pos": 46468255, "end_pos": 46459659, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000498301.1", "url": "https://www.ensembl.org/id/ENST00000498301.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508000.1", "url": "https://www.ensembl.org/id/ENSP00000508000.1" } ] } }, { "isoform_ac": "C9JCF5-1", "url": "", "sequence": { "sequence": "MKLVFLVLLFLGALGFLWMPFIRQPGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF", "length": 182, "header": "tr|C9JCF5-1|TRFL_HUMAN Computationally mapped isoform of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=1 CANONICAL=P02788-1" }, "locus": { "chromosome": "3", "start_pos": 46464867, "end_pos": 46455429, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000431944.1", "url": "https://www.ensembl.org/id/ENST00000431944.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000395234.1", "url": "https://www.ensembl.org/id/ENSP00000395234.1" } ] } }, { "isoform_ac": "E7EQB2-1", "url": "", "sequence": { "sequence": "MGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLR", "length": 696, "header": "tr|E7EQB2-1|TRFL_HUMAN Computationally mapped isoform of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=1 CANONICAL=P02788-1" }, "locus": { "chromosome": "3", "start_pos": 46468255, "end_pos": 46436201, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443496.5", "url": "https://www.ensembl.org/id/ENST00000443496.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000397427.1", "url": "https://www.ensembl.org/id/ENSP00000397427.1" } ] } }, { "isoform_ac": "E7ER44-1", "url": "", "sequence": { "sequence": "MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK", "length": 708, "header": "tr|E7ER44-1|TRFL_HUMAN Computationally mapped isoform of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=1 CANONICAL=P02788-1" }, "locus": { "chromosome": "3", "start_pos": 46464867, "end_pos": 46436198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000417439.5", "url": "https://www.ensembl.org/id/ENST00000417439.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000405546.1", "url": "https://www.ensembl.org/id/ENSP00000405546.1" } ] } }, { "isoform_ac": "P02788-1", "url": "", "sequence": { "sequence": "MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK", "length": 710, "header": "sp|P02788-1|TRFL_HUMAN Isoform 1 of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6 CANONICAL=P02788-1" }, "locus": { "chromosome": "3", "start_pos": 46464867, "end_pos": 46436198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000231751.9", "url": "https://www.ensembl.org/id/ENST00000231751.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000231751.4", "url": "https://www.ensembl.org/id/ENSP00000231751.4" } ] } }, { "isoform_ac": "P02788-2", "url": "", "sequence": { "sequence": "MRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK", "length": 666, "header": "sp|P02788-2|TRFL_HUMAN Isoform 2 of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6 CANONICAL=P02788-1" }, "locus": { "chromosome": "3", "start_pos": 46459730, "end_pos": 46436198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000426532.6", "url": "https://www.ensembl.org/id/ENST00000426532.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000405719.2", "url": "https://www.ensembl.org/id/ENSP00000405719.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G02628JF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G07162IJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G27516OE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G27993JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G32332VU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G33608TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44444MB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G52890YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G65540UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66766XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G74264KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G75051CY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G76613WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G77459ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81375TC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G86226EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G90348RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G91255CS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93284HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G93683YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "id": "16201406", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16201406" }, { "id": "1581307", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1581307" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "15299793", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15299793" }, { "id": "15299444", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15299444" }, { "id": "8069634", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8069634" }, { "id": "1LCF", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1LCF" }, { "id": "1LFG", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1LFG" }, { "id": "1LFI", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1LFI" }, { "id": "1SQY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1SQY" }, { "id": "2BJJ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2BJJ" }, { "id": "2PMS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2PMS" } ] }, { "glytoucan_ac": "G27945LI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 436, "start_aa": "Ser", "end_pos": 436, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser436", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 436, "start_aa": "Ser", "end_pos": 436, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser436", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G03127AL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G07162IJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G27251WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G33608TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G34105RF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44444MB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51806IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G62837OZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66676MI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G68698AP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G74264KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G77459ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82020ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G85228QD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86226EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86408JD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G89319AW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G90348RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G93284HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-157, N-498", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniCarbKB", "url": "" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P02788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16201406", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16201406" }, { "id": "1581307", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1581307" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "15299793", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15299793" }, { "id": "1LFG", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1LFG" }, { "id": "1LFI", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1LFI" }, { "id": "1SQY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1SQY" }, { "id": "2BJJ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/2BJJ" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G26421QW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "23662732", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23662732" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "P02788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G07162IJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G07392QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7060557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7060557" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "8011069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8011069" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7060557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7060557" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "8011069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8011069" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G26295XE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2842", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2842" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G33608TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G44444MB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "8011069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8011069" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7060557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7060557" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G57449OF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2842", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2842" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G68283NG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G74264KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G74587YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2842", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2842" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G75927AR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2842", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2842" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7060557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7060557" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G76478FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" }, { "id": "7060557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7060557" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "2390069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2390069" }, { "id": "8011069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8011069" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G89241QS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G90348RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7060557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7060557" }, { "id": "7068558", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "glytoucan_ac": "G90544QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2842", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2842" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G90974PL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G93284HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "7774715", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "12151713", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "320", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/320" }, { "id": "8011069", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8011069" } ] } ], "phosphorylation": [ { "start_pos": 109, "end_pos": 109, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02788", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr109" }, { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Phe", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "iPTMnet", "id": "P02788", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788" }, { "database": "PubMed", "id": "20404350", "url": "https://glygen.org/publication/PubMed/20404350" } ], "site_lbl": "Phe10" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02788", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ], "site_lbl": "Ser278" }, { "start_pos": 547, "end_pos": 547, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P02788", "url": "http://phospho.elm.eu.org/byAccession/P02788.html" }, { "database": "iPTMnet", "id": "P02788", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr547" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.", "journal": "Biochemistry", "date": "1999", "authors": "Brodersen DE, Nyborg J, Kjeldgaard M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "10026247", "url": "https://glygen.org/publication/PubMed/10026247" } ] }, { "title": "Structure of recombinant human lactoferrin expressed in Aspergillus awamori.", "journal": "Acta Crystallogr. D", "date": "1999", "authors": "Sun XL, Baker HM, Shewry SC, Jameson GB, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "10089347", "url": "https://glygen.org/publication/PubMed/10089347" } ] }, { "title": "Structure of human apolactoferrin at 2.0 A resolution. Refinement and analysis of ligand-induced conformational change.", "journal": "Acta Crystallogr. D", "date": "1998", "authors": "Jameson G B, Anderson B F, Norris G E, Thomas D H, Baker E N", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "10089508", "url": "https://glygen.org/publication/PubMed/10089508" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "Expression of lactoferrin in the kidney: implications for innate immunity and iron metabolism.", "journal": "Kidney Int.", "date": "2000", "authors": "Abrink M, Larsson E, Gobl A, Hellman L", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "10792619", "url": "https://glygen.org/publication/PubMed/10792619" } ] }, { "title": "Crystal structure and iron-binding properties of the R210K mutant of the N-lobe of human lactoferrin: implications for iron release from transferrins.", "journal": "Biochemistry", "date": "2000", "authors": "Peterson NA, Anderson BF, Jameson GB, Tweedie JW, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "10828980", "url": "https://glygen.org/publication/PubMed/10828980" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "Candidacidal activities of human lactoferrin peptides derived from the N terminus.", "journal": "Antimicrobial agents and chemotherapy", "date": "2000-12", "authors": "Lupetti A, Paulusma-Annema A, Welling M M, Senesi S, van Dissel J T, Nibbering P H", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "11083624", "url": "https://glygen.org/publication/PubMed/11083624" } ] }, { "title": "Granulysin, a T cell product, kills bacteria by altering membrane permeability.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Ernst WA, Thoma-Uszynski S, Teitelbaum R, Ko C, Hanson DA, Clayberger C, Krensky AM, Leippe M, Bloom BR, Ganz T, Modlin RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11120840", "url": "https://glygen.org/publication/PubMed/11120840" } ] }, { "title": "Metal substitution in transferrins: specific binding of cerium(IV) revealed by the crystal structure of cerium-substituted human lactoferrin.", "journal": "J. Biol. Inorg. Chem.", "date": "2000", "authors": "Baker HM, Baker CJ, Smith CA, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "11128996", "url": "https://glygen.org/publication/PubMed/11128996" } ] }, { "title": "Human lactoferrin and peptides derived from its N terminus are highly effective against infections with antibiotic-resistant bacteria.", "journal": "Infection and immunity", "date": "2001", "authors": "Nibbering PH, Ravensbergen E, Welling MM, van Berkel LA, van Berkel PH, Pauwels EK, Nuijens JH", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "11179314", "url": "https://glygen.org/publication/PubMed/11179314" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tsuji S, Uehori J, Matsumoto M, Suzuki Y, Matsuhisa A, Toyoshima K, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11313366", "url": "https://glygen.org/publication/PubMed/11313366" } ] }, { "title": "Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3.", "journal": "Blood", "date": "2001", "authors": "Sorensen OE, Follin P, Johnsen AH, Calafat J, Tjabringa GS, Hiemstra PS, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11389039", "url": "https://glygen.org/publication/PubMed/11389039" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "[cDNA cloning and sequence analysis of human lactoferrin].", "journal": "Sheng wu gong cheng xue bao = Chinese journal of biotechnology", "date": "2001", "authors": "Cheng H, Chen XZ, Huan LD", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "11702692", "url": "https://glygen.org/publication/PubMed/11702692" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.", "journal": "Human molecular genetics", "date": "2002", "authors": "Bingle CD, Craven CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11971875", "url": "https://glygen.org/publication/PubMed/11971875" } ] }, { "title": "Structure of a domain-opened mutant (R121D) of the human lactoferrin N-lobe refined from a merohedrally twinned crystal form.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Jameson GB, Anderson BF, Breyer WA, Day CL, Tweedie JW, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "12037297", "url": "https://glygen.org/publication/PubMed/12037297" } ] }, { "title": "A component of innate immunity prevents bacterial biofilm development.", "journal": "Nature", "date": "2002-05-30", "authors": "Singh Pradeep K, Parsek Matthew R, Greenberg E Peter, Welsh Michael J", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "12037568", "url": "https://glygen.org/publication/PubMed/12037568" } ] }, { "title": "N-glycosylation potential of maize: the human lactoferrin used as a model.", "journal": "Glycoconjugate journal", "date": "2001", "authors": "Samyn-Petit B, Gruber V, Flahaut C, Wajda-Dubos JP, Farrer S, Pons A, Desmaizieres G, Slomianny MC, Theisen M, Delannoy P", "evidence": [ { "database": "UniCarbKB", "id": "P02788", "url": "" }, { "database": "GlyConnect", "id": "2842", "url": "https://glyconnect.expasy.org/browser/proteins/2842" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "12151713", "url": "https://glygen.org/publication/PubMed/12151713" } ] }, { "title": "`Dilysine trigger` in transferrins probed by mutagenesis of lactoferrin: crystal structures of the R210G, R210E, and R210L mutants of human lactoferrin.", "journal": "Biochemistry", "date": "2002", "authors": "Peterson NA, Arcus VL, Anderson BF, Tweedie JW, Jameson GB, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "12450380", "url": "https://glygen.org/publication/PubMed/12450380" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver.", "journal": "Protein science : a publication of the Protein Society", "date": "2003", "authors": "Krause A, Sillard R, Kleemeier B, Kluver E, Maronde E, Conejo-Garcia JR, Forssmann WG, Schulz-Knappe P, Nehls MC, Wattler F, Wattler S, Adermann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "12493837", "url": "https://glygen.org/publication/PubMed/12493837" } ] }, { "title": "Human milk lactoferrin is a serine protease that cleaves Haemophilus surface proteins at arginine-rich sites.", "journal": "Molecular microbiology", "date": "2003", "authors": "Hendrixson DR, Qiu J, Shewry SC, Fink DL, Petty S, Baker EN, Plaut AG, St Geme JW 3rd", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "12535064", "url": "https://glygen.org/publication/PubMed/12535064" } ] }, { "title": "An intronic alternative promoter of the human lactoferrin gene is activated by Ets.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Liu D, Wang X, Zhang Z, Teng CT", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" } ], "reference": [ { "type": "PubMed", "id": "12565886", "url": "https://glygen.org/publication/PubMed/12565886" } ] }, { "title": "Potassium efflux induced by a new lactoferrin-derived peptide mimicking the effect of native human lactoferrin on the bacterial cytoplasmic membrane.", "journal": "Biochemistry. Biokhimiia", "date": "2003-02", "authors": "Viejo-D\u00edaz M, Andr\u00e9s M T, P\u00e9rez-Gil J, S\u00e1nchez M, Fierro J F", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "12693969", "url": "https://glygen.org/publication/PubMed/12693969" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "Isolation and characterization of opioid antagonist peptides derived from human lactoferrin.", "journal": "Agricultural and biological chemistry", "date": "1990-07", "authors": "Tani F, Iio K, Chiba H, Yoshikawa M", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "1369293", "url": "https://glygen.org/publication/PubMed/1369293" } ] }, { "title": "Mechanism of lysozyme catalysis: role of ground-state strain in subsite D in hen egg-white and human lysozymes.", "journal": "Biochemistry", "date": "1977", "authors": "Schindler M, Assaf Y, Sharon N, Chipman DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "13816", "url": "https://glygen.org/publication/PubMed/13816" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "Human peptidoglycan recognition protein-L is an N-acetylmuramoyl-L-alanine amidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wang ZM, Li X, Cocklin RR, Wang M, Wang M, Fukase K, Inamura S, Kusumoto S, Gupta D, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "14506276", "url": "https://glygen.org/publication/PubMed/14506276" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "One of two human lactoferrin variants exhibits increased antibacterial and transcriptional activation activities and is associated with localized juvenile periodontitis.", "journal": "Infection and immunity", "date": "2003", "authors": "Velliyagounder K, Kaplan JB, Furgang D, Legarda D, Diamond G, Parkin RE, Fine DH", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "14573629", "url": "https://glygen.org/publication/PubMed/14573629" } ] }, { "title": "Phylogenetic and evolutionary analysis of the PLUNC gene family.", "journal": "Protein science : a publication of the Protein Society", "date": "2004", "authors": "Bingle CD, LeClair EE, Havard S, Bingle L, Gillingham P, Craven CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "14739326", "url": "https://glygen.org/publication/PubMed/14739326" } ] }, { "title": "Differential molecular mechanism of the estrogen action that regulates lactoferrin gene in human and mouse.", "journal": "Mol. Endocrinol.", "date": "1992", "authors": "Teng C T, Liu Y, Yang N, Walmer D, Panella T", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "1480183", "url": "https://glygen.org/publication/PubMed/1480183" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "Lactoferrin is a potent regulator of bone cell activity and increases bone formation in vivo.", "journal": "Endocrinology", "date": "2004-09", "authors": "Cornish Jillian, Callon Karen E, Naot Dorit, Palmano Kate P, Banovic Tatjana, Bava Usha, Watson Maureen, Lin Jian-Ming, Tong P C, Chen Qi, Chan Vincent A, Reid Helen E, Fazzalari Nick, Baker Heather M, Baker Edward N, Haggarty Neill W, Grey Andrew B, Reid Ian R", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "15166119", "url": "https://glygen.org/publication/PubMed/15166119" } ] }, { "title": "Human bactericidal/permeability-increasing protein and a recombinant NH2-terminal fragment cause killing of serum-resistant gram-negative bacteria in whole blood and inhibit tumor necrosis factor release induced by the bacteria.", "journal": "The Journal of clinical investigation", "date": "1992", "authors": "Weiss J, Elsbach P, Shu C, Castillo J, Grinna L, Horwitz A, Theofan G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "1522221", "url": "https://glygen.org/publication/PubMed/1522221" } ] }, { "title": "Expression of delta-lactoferrin induces cell cycle arrest.", "journal": "Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine", "date": "2004-06", "authors": "Breton Mathilde, Mariller Christophe, Bena\u00efssa Monique, Caillaux Katia, Browaeys Edith, Masson Maryse, Vilain Jean-Pierre, Mazurier Jo\u00ebl, Pierce Annick", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "15222485", "url": "https://glygen.org/publication/PubMed/15222485" } ] }, { "title": "Antimicrobial activity of human EPPIN, an androgen-regulated, sperm-bound protein with a whey acidic protein motif.", "journal": "Biology of reproduction", "date": "2004", "authors": "Yenugu S, Richardson RT, Sivashanmugam P, Wang Z, O'rand MG, French FS, Hall SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15229136", "url": "https://glygen.org/publication/PubMed/15229136" } ] }, { "title": "Structure of copper- and oxalate-substituted human lactoferrin at 2.0 A resolution.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "1994", "authors": "Smith CA, Anderson BF, Baker HM, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "15299444", "url": "https://glygen.org/publication/PubMed/15299444" } ] }, { "title": "Structure of human diferric lactoferrin refined at 2.2 A resolution.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "1995", "authors": "Haridas M, Anderson BF, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "15299793", "url": "https://glygen.org/publication/PubMed/15299793" } ] }, { "title": "Structural origin of endotoxin neutralization and antimicrobial activity of a lactoferrin-based peptide.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Japelj Bostjan, Pristovsek Primoz, Majerle Andreja, Jerala Roman", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "15687491", "url": "https://glygen.org/publication/PubMed/15687491" } ] }, { "title": "Uptake of granulysin via lipid rafts leads to lysis of intracellular Listeria innocua.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Walch M, Eppler E, Dumrese C, Barman H, Groscurth P, Ziegler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15778384", "url": "https://glygen.org/publication/PubMed/15778384" } ] }, { "title": "Metal substitution in transferrins: the crystal structure of human copper-lactoferrin at 2.1-A resolution.", "journal": "Biochemistry", "date": "1992", "authors": "Smith CA, Anderson BF, Baker HM, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "1581307", "url": "https://glygen.org/publication/PubMed/1581307" } ] }, { "title": "Crystal structure of a peptidoglycan recognition protein (PGRP) in complex with a muramyl tripeptide from Gram-positive bacteria.", "journal": "Journal of endotoxin research", "date": "2005", "authors": "Guan R, Roychowdury A, Ember B, Kumar S, Boons GJ, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15826377", "url": "https://glygen.org/publication/PubMed/15826377" } ] }, { "title": "Human peptidoglycan recognition protein S is an effector of neutrophil-mediated innate immunity.", "journal": "Blood", "date": "2005", "authors": "Cho JH, Fraser IP, Fukase K, Kusumoto S, Fujimoto Y, Stahl GL, Ezekowitz RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15956276", "url": "https://glygen.org/publication/PubMed/15956276" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "Identification of the bactericidal domain of lactoferrin.", "journal": "Biochimica et biophysica acta", "date": "1992", "authors": "Bellamy W, Takase M, Yamauchi K, Wakabayashi H, Kawase K, Tomita M", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "1599934", "url": "https://glygen.org/publication/PubMed/1599934" } ] }, { "title": "Human lactoferricin is partially folded in aqueous solution and is better stabilized in a membrane mimetic solvent.", "journal": "Antimicrob. Agents Chemother.", "date": "2005", "authors": "Hunter Howard N, Demcoe A Ross, Jenssen H\u00e5vard, Gutteberg Tore J, Vogel Hans J", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "16048952", "url": "https://glygen.org/publication/PubMed/16048952" } ] }, { "title": "Identification of serum N-acetylmuramoyl-l-alanine amidase as liver peptidoglycan recognition protein 2.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Zhang Y, van der Fits L, Voerman JS, Melief MJ, Laman JD, Wang M, Wang H, Wang M, Li X, Walls CD, Gupta D, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16054449", "url": "https://glygen.org/publication/PubMed/16054449" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "The protein structure of recombinant human lactoferrin produced in the milk of transgenic cows closely matches the structure of human milk-derived lactoferrin.", "journal": "Transgenic research", "date": "2005", "authors": "Thomassen EA, van Veen HA, van Berkel PH, Nuijens JH, Abrahams JP", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "16201406", "url": "https://glygen.org/publication/PubMed/16201406" } ] }, { "title": "Human antimicrobial peptides: defensins, cathelicidins and histatins.", "journal": "Biotechnology letters", "date": "2005", "authors": "De Smet K, Contreras R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16215847", "url": "https://glygen.org/publication/PubMed/16215847" } ] }, { "title": "SLPI and elafin: one glove, many fingers.", "journal": "Clinical science (London, England : 1979)", "date": "2006", "authors": "Williams SE, Brown TI, Roghanian A, Sallenave JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16336202", "url": "https://glygen.org/publication/PubMed/16336202" } ] }, { "title": "Peptidoglycan recognition proteins are a new class of human bactericidal proteins.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lu X, Wang M, Qi J, Wang H, Li X, Gupta D, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16354652", "url": "https://glygen.org/publication/PubMed/16354652" } ] }, { "title": "Cathepsin D is present in human eccrine sweat and involved in the postsecretory processing of the antimicrobial peptide DCD-1L.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Baechle D, Flad T, Cansier A, Steffen H, Schittek B, Tolson J, Herrmann T, Dihazi H, Beck A, Mueller GA, Mueller M, Stevanovic S, Garbe C, Mueller CA, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16354654", "url": "https://glygen.org/publication/PubMed/16354654" } ] }, { "title": "Generation of multiple stable dermcidin-derived antimicrobial peptides in sweat of different body sites.", "journal": "The Journal of investigative dermatology", "date": "2006", "authors": "Rieg S, Seeber S, Steffen H, Humeny A, Kalbacher H, Stevanovic S, Kimura A, Garbe C, Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16374474", "url": "https://glygen.org/publication/PubMed/16374474" } ] }, { "title": "Neutrophil serine proteases: specific regulators of inflammation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Pham CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16799473", "url": "https://glygen.org/publication/PubMed/16799473" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "Human lactoferrin upregulates expression of KDR/Flk-1 and stimulates VEGF-A-mediated endothelial cell proliferation and migration.", "journal": "FEBS letters", "date": "2006-08-07", "authors": "Kim Chan Woo, Son Kyung-No, Choi Sang-Yun, Kim Jiyoung", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "16842782", "url": "https://glygen.org/publication/PubMed/16842782" } ] }, { "title": "Symbiotic bacteria direct expression of an intestinal bactericidal lectin.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Cash HL, Whitham CV, Behrendt CL, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16931762", "url": "https://glygen.org/publication/PubMed/16931762" } ] }, { "title": "Identification of RNase 8 as a novel human antimicrobial protein.", "journal": "Antimicrobial agents and chemotherapy", "date": "2006", "authors": "Rudolph B, Podschun R, Sahly H, Schubert S, Schroder JM, Harder J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16940129", "url": "https://glygen.org/publication/PubMed/16940129" } ] }, { "title": "Adenoviruses use lactoferrin as a bridge for CAR-independent binding to and infection of epithelial cells.", "journal": "Journal of virology", "date": "2007-01", "authors": "Johansson Cecilia, Jonsson Mari, Marttila Marko, Persson David, Fan Xiao-Long, Skog Johan, Fr\u00e4ngsmyr Lars, Wadell G\u00f6ran, Arnberg Niklas", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "17079302", "url": "https://glygen.org/publication/PubMed/17079302" } ] }, { "title": "The acyl group as the central element of the structural organization of antimicrobial lipopeptide.", "journal": "J. Am. Chem. Soc.", "date": "2007", "authors": "Japelj Bostjan, Zorko Mateja, Majerle Andreja, Pristovsek Primoz, Sanchez-Gomez Susana, Martinez de Tejada Guillermo, Moriyon Ignacio, Blondelle Sylvie E, Brandenburg Klaus, Andr\u00e4 J\u00f6rg, Lohner Karl, Jerala Roman", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "17263370", "url": "https://glygen.org/publication/PubMed/17263370" } ] }, { "title": "Peptidoglycan recognition proteins: pleiotropic sensors and effectors of antimicrobial defences.", "journal": "Nature reviews. Microbiology", "date": "2007", "authors": "Royet J, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17363965", "url": "https://glygen.org/publication/PubMed/17363965" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "The anti-papillomavirus activity of human and bovine lactoferricin.", "journal": "Antiviral research", "date": "2007-09", "authors": "Mistry Nitesh, Drobni Peter, N\u00e4slund Jonas, Sunkari Vivekananda Gupta, Jenssen H\u00e5vard, Evander Magnus", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "17481742", "url": "https://glygen.org/publication/PubMed/17481742" } ] }, { "title": "Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Cho S, Wang Q, Swaminathan CP, Hesek D, Lee M, Boons GJ, Mobashery S, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17502600", "url": "https://glygen.org/publication/PubMed/17502600" } ] }, { "title": "Structure of a complex of human lactoferrin N-lobe with pneumococcal surface protein a provides insight into microbial defense mechanism.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Senkovich O, Cook WJ, Mirza S, Hollingshead SK, Protasevich II, Briles DE, Chattopadhyay D", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "17543335", "url": "https://glygen.org/publication/PubMed/17543335" } ] }, { "title": "Characterization of an eppin protein complex from human semen and spermatozoa.", "journal": "Biol. Reprod.", "date": "2007", "authors": "Wang Z, Widgren EE, Richardson RT, O'Rand MG", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17567961", "url": "https://glygen.org/publication/PubMed/17567961" } ] }, { "title": "Molecular replacement solution of the structure of apolactoferrin, a protein displaying large-scale conformational change.", "journal": "Acta Crystallogr. B", "date": "1991", "authors": "Norris G E, Anderson B F, Baker E N", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "1772635", "url": "https://glygen.org/publication/PubMed/1772635" } ] }, { "title": "Multifaceted roles of human elafin and secretory leukocyte proteinase inhibitor (SLPI), two serine protease inhibitors of the chelonianin family.", "journal": "Biochimie", "date": "2008", "authors": "Moreau T, Baranger K, Dade S, Dallet-Choisy S, Guyot N, Zani ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17964057", "url": "https://glygen.org/publication/PubMed/17964057" } ] }, { "title": "Neutrophil elastase, proteinase 3 and cathepsin G: physicochemical properties, activity and physiopathological functions.", "journal": "Biochimie", "date": "2008", "authors": "Korkmaz B, Moreau T, Gauthier F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18021746", "url": "https://glygen.org/publication/PubMed/18021746" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P02788", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Expression of cathelicidin LL-37 during Mycobacterium tuberculosis infection in human alveolar macrophages, monocytes, neutrophils, and epithelial cells.", "journal": "Infection and immunity", "date": "2008", "authors": "Rivas-Santiago B, Hernandez-Pando R, Carranza C, Juarez E, Contreras JL, Aguilar-Leon D, Torres M, Sada E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18160480", "url": "https://glygen.org/publication/PubMed/18160480" } ] }, { "title": "The neuroendocrine peptide catestatin is a cutaneous antimicrobial and induced in the skin after injury.", "journal": "The Journal of investigative dermatology", "date": "2008", "authors": "Radek KA, Lopez-Garcia B, Hupe M, Niesman IR, Elias PM, Taupenot L, Mahata SK, O'Connor DT, Gallo RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18185531", "url": "https://glygen.org/publication/PubMed/18185531" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Antimicrobial properties of lactoferrin.", "journal": "Biochimie", "date": "2009", "authors": "Jenssen H, Hancock RE", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" } ], "reference": [ { "type": "PubMed", "id": "18573312", "url": "https://glygen.org/publication/PubMed/18573312" } ] }, { "title": "The antipathogen activities of eosinophil cationic protein.", "journal": "Current pharmaceutical biotechnology", "date": "2008", "authors": "Boix E, Torrent M, Sanchez D, Nogues MV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18673279", "url": "https://glygen.org/publication/PubMed/18673279" } ] }, { "title": "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.", "journal": "Proteomics", "date": "2008", "authors": "Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "18780401", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "Apoptotic human cells inhibit migration of granulocytes via release of lactoferrin.", "journal": "The Journal of clinical investigation", "date": "2009-01", "authors": "Bournazou Irini, Pound John D, Duffin Rodger, Bournazos Stylianos, Melville Lynsey A, Brown Simon B, Rossi Adriano G, Gregory Christopher D", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "19033648", "url": "https://glygen.org/publication/PubMed/19033648" } ] }, { "title": "Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Mukherjee S, Partch CL, Lehotzky RE, Whitham CV, Chu H, Bevins CL, Gardner KH, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19095652", "url": "https://glygen.org/publication/PubMed/19095652" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Lysozyme and microbiota in relation to gingivitis and periodontitis.", "journal": "Medical science monitor : international medical journal of experimental and clinical research", "date": "2009", "authors": "Surna A, Kubilius R, Sakalauskiene J, Vitkauskiene A, Jonaitis J, Saferis V, Gleiznys A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19179970", "url": "https://glygen.org/publication/PubMed/19179970" } ] }, { "title": "Proteolytic activation of human pancreatitis-associated protein is required for peptidoglycan binding and bacterial aggregation.", "journal": "The Biochemical journal", "date": "2009", "authors": "Medveczky P, Szmola R, Sahin-Toth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19254208", "url": "https://glygen.org/publication/PubMed/19254208" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "Identification and characterization of binding sites on S100A7, a participant in cancer and inflammation pathways.", "journal": "Biochemistry", "date": "2009", "authors": "Leon R, Murray JI, Cragg G, Farnell B, West NR, Pace TC, Watson PH, Bohne C, Boulanger MJ, Hof F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "19810752", "url": "https://glygen.org/publication/PubMed/19810752" } ] }, { "title": "Catalytic and non-catalytic functions of human IIA phospholipase A2.", "journal": "Trends in biochemical sciences", "date": "2010", "authors": "Birts CN, Barton CH, Wilton DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19818633", "url": "https://glygen.org/publication/PubMed/19818633" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P02788-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Membrane structure and interactions of human catestatin by multidimensional solution and solid-state NMR spectroscopy.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Sugawara M, Resende JM, Moraes CM, Marquette A, Chich JF, Metz-Boutigue MH, Bechinger B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20103720", "url": "https://glygen.org/publication/PubMed/20103720" } ] }, { "title": "Comparison of human RNase 3 and RNase 7 bactericidal action at the Gram-negative and Gram-positive bacterial cell wall.", "journal": "The FEBS journal", "date": "2010", "authors": "Torrent M, Badia M, Moussaoui M, Sanchez D, Nogues MV, Boix E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20180804", "url": "https://glygen.org/publication/PubMed/20180804" } ] }, { "title": "Human lactoferrin activates NF-kappaB through the Toll-like receptor 4 pathway while it interferes with the lipopolysaccharide-stimulated TLR4 signaling.", "journal": "The FEBS journal", "date": "2010-05", "authors": "Ando Ken, Hasegawa Keiichi, Shindo Ken-Ichi, Furusawa Tomoyasu, Fujino Tomofumi, Kikugawa Kiyomi, Nakano Hiroyasu, Takeuchi Osamu, Akira Shizuo, Akiyama Taishin, Gohda Jin, Inoue Jun-Ichiro, Hayakawa Makio", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "20345905", "url": "https://glygen.org/publication/PubMed/20345905" } ] }, { "title": "Molecular basis for peptidoglycan recognition by a bactericidal lectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Lehotzky RE, Partch CL, Mukherjee S, Cash HL, Goldman WE, Gardner KH, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20382864", "url": "https://glygen.org/publication/PubMed/20382864" } ] }, { "title": "Secretory leukocyte protease inhibitor and elafin/trappin-2: versatile mucosal antimicrobials and regulators of immunity.", "journal": "American journal of respiratory cell and molecular biology", "date": "2010", "authors": "Sallenave JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20395631", "url": "https://glygen.org/publication/PubMed/20395631" } ] }, { "title": "O-GlcNAcylation/phosphorylation cycling at Ser10 controls both transcriptional activity and stability of delta-lactoferrin.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Hardiville S, Hoedt E, Mariller C, Benaissa M, Pierce A", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "iPTMnet", "id": "P02788", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02788" } ], "reference": [ { "type": "PubMed", "id": "20404350", "url": "https://glygen.org/publication/PubMed/20404350" } ] }, { "title": "Analysis of the solution structure of the human antibiotic peptide dermcidin and its interaction with phospholipid vesicles.", "journal": "BMB reports", "date": "2010", "authors": "Jung HH, Yang ST, Sim JY, Lee S, Lee JY, Kim HH, Shin SY, Kim JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20510021", "url": "https://glygen.org/publication/PubMed/20510021" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "Structural and functional analysis of human liver-expressed antimicrobial peptide 2.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2010", "authors": "Henriques ST, Tan CC, Craik DJ, Clark RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20845358", "url": "https://glygen.org/publication/PubMed/20845358" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "Distant cousins: genomic and sequence diversity within the BPI fold-containing (BPIF)/PLUNC protein family.", "journal": "Biochemical Society transactions", "date": "2011", "authors": "Bingle CD, Bingle L, Craven CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "21787330", "url": "https://glygen.org/publication/PubMed/21787330" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "Lipidomic discovery of deoxysiderophores reveals a revised mycobactin biosynthesis pathway in Mycobacterium tuberculosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Madigan CA, Cheng TY, Layre E, Young DC, McConnell MJ, Debono CA, Murry JP, Wei JR, Barry CE 3rd, Rodriguez GM, Matsunaga I, Rubin EJ, Moody DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1222449", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1222449" } ], "reference": [ { "type": "PubMed", "id": "22232695", "url": "https://glygen.org/publication/PubMed/22232695" } ] }, { "title": "Structure-activity analysis of the dermcidin-derived peptide DCD-1L, an anionic antimicrobial peptide present in human sweat.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Paulmann M, Arnold T, Linke D, Ozdirekcan S, Kopp A, Gutsmann T, Kalbacher H, Wanke I, Schuenemann VJ, Habeck M, Burck J, Ulrich AS, Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22262861", "url": "https://glygen.org/publication/PubMed/22262861" } ] }, { "title": "Delta-lactoferrin, an intracellular lactoferrin isoform that acts as a transcription factor.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2012-06", "authors": "Mariller Christophe, Hardivill\u00e9 Stephan, Hoedt Esthelle, Huvent Isabelle, Pina-Canseco Socorro, Pierce Annick", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "22320386", "url": "https://glygen.org/publication/PubMed/22320386" } ] }, { "title": "Antimicrobial RNases in cutaneous defense.", "journal": "Journal of innate immunity", "date": "2012", "authors": "Simanski M, Koten B, Schroder JM, Glaser R, Harder J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22327069", "url": "https://glygen.org/publication/PubMed/22327069" } ] }, { "title": "Functional polymorphisms in the LTF gene and risk of coronary artery stenosis.", "journal": "Human immunology", "date": "2012", "authors": "Videm V, Dahl H, Walberg LE, Wiseth R", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "22406253", "url": "https://glygen.org/publication/PubMed/22406253" } ] }, { "title": "The multiple facets of dermcidin in cell survival and host defense.", "journal": "Journal of innate immunity", "date": "2012", "authors": "Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22455996", "url": "https://glygen.org/publication/PubMed/22455996" } ] }, { "title": "Induction of the human cathelicidin LL-37 as a novel treatment against bacterial infections.", "journal": "Journal of leukocyte biology", "date": "2012", "authors": "van der Does AM, Bergman P, Agerberth B, Lindbom L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22701042", "url": "https://glygen.org/publication/PubMed/22701042" } ] }, { "title": "Structural characterization of S100A15 reveals a novel zinc coordination site among S100 proteins and altered surface chemistry with functional implications for receptor binding.", "journal": "BMC structural biology", "date": "2012", "authors": "Murray JI, Tonkin ML, Whiting AL, Peng F, Farnell B, Cullen JT, Hof F, Boulanger MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "22747601", "url": "https://glygen.org/publication/PubMed/22747601" } ] }, { "title": "Crystal structure of human seminal diferric lactoferrin at 3.4 Angstrom resolution.", "journal": "Indian journal of biochemistry & biophysics", "date": "2003", "authors": "Kumar J, Weber W, Munchau S, Yadav S, Singh SB, Saravanan K, Paramasivam M, Sharma S, Kaur P, Bhushan A, Srinivasan A, Betzel C, Singh TP", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "22900286", "url": "https://glygen.org/publication/PubMed/22900286" } ] }, { "title": "High-affinity manganese coordination by human calprotectin is calcium-dependent and requires the histidine-rich site formed at the dimer interface.", "journal": "Journal of the American Chemical Society", "date": "2013", "authors": "Hayden JA, Brophy MB, Cunden LS, Nolan EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "23276281", "url": "https://glygen.org/publication/PubMed/23276281" } ] }, { "title": "Ribonuclease 7, an antimicrobial peptide upregulated during infection, contributes to microbial defense of the human urinary tract.", "journal": "Kidney international", "date": "2013", "authors": "Spencer JD, Schwaderer AL, Wang H, Bartz J, Kline J, Eichler T, DeSouza KR, Sims-Lucas S, Baker P, Hains DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "23302724", "url": "https://glygen.org/publication/PubMed/23302724" } ] }, { "title": "Crystal structure and functional mechanism of a human antimicrobial membrane channel.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Song C, Weichbrodt C, Salnikov ES, Dynowski M, Forsberg BO, Bechinger B, Steinem C, de Groot BL, Zachariae U, Zeth K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "23426625", "url": "https://glygen.org/publication/PubMed/23426625" } ] }, { "title": "Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Damo SM, Kehl-Fie TE, Sugitani N, Holt ME, Rathi S, Murphy WJ, Zhang Y, Betz C, Hench L, Fritz G, Skaar EP, Chazin WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "23431180", "url": "https://glygen.org/publication/PubMed/23431180" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures.", "journal": "Analytical chemistry", "date": "2013", "authors": "Strum JS, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB", "evidence": [ { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "23662732", "url": "https://glygen.org/publication/PubMed/23662732" } ] }, { "title": "Nucleotide sequence of human lactoferrin cDNA.", "journal": "Nucleic acids research", "date": "1990", "authors": "Powell MJ, Ogden JE", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "2374734", "url": "https://glygen.org/publication/PubMed/2374734" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "Primary structure of glycans isolated from human leucocyte lactotransferrin. Absence of fucose residues questions the proposed mechanism of hyposideraemia.", "journal": "The Biochemical journal", "date": "1990", "authors": "Derisbourg P, Wieruszeski JM, Montreuil J, Spik G", "evidence": [ { "database": "UniCarbKB", "id": "P02788", "url": "" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "2390069", "url": "https://glygen.org/publication/PubMed/2390069" } ] }, { "title": "Complete nucleotide sequence of human mammary gland lactoferrin.", "journal": "Nucleic acids research", "date": "1990", "authors": "Rey MW, Woloshuk SL, deBoer HA, Pieper FR", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "2402455", "url": "https://glygen.org/publication/PubMed/2402455" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "Histatins: salivary peptides with copper(II)- and zinc(II)-binding motifs: perspectives for biomedical applications.", "journal": "The FEBS journal", "date": "2014", "authors": "Melino S, Santone C, Di Nardo P, Sarkar B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "24219363", "url": "https://glygen.org/publication/PubMed/24219363" } ] }, { "title": "Antibacterial membrane attack by a pore-forming intestinal C-type lectin.", "journal": "Nature", "date": "2014", "authors": "Mukherjee S, Zheng H, Derebe MG, Callenberg KM, Partch CL, Rollins D, Propheter DC, Rizo J, Grabe M, Jiang QX, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "24256734", "url": "https://glygen.org/publication/PubMed/24256734" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract.", "journal": "Kidney international", "date": "2015", "authors": "Becknell B, Eichler TE, Beceiro S, Li B, Easterling RS, Carpenter AR, James CL, McHugh KM, Hains DS, Partida-Sanchez S, Spencer JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "25075772", "url": "https://glygen.org/publication/PubMed/25075772" } ] }, { "title": "Neutrophil serine proteases in antibacterial defense.", "journal": "Current opinion in microbiology", "date": "2015", "authors": "Stapels DA, Geisbrecht BV, Rooijakkers SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "25461571", "url": "https://glygen.org/publication/PubMed/25461571" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "The secrets of dermcidin action.", "journal": "International journal of medical microbiology : IJMM", "date": "2015", "authors": "Burian M, Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "25596890", "url": "https://glygen.org/publication/PubMed/25596890" } ] }, { "title": "Manganese binding properties of human calprotectin under conditions of high and low calcium: X-ray crystallographic and advanced electron paramagnetic resonance spectroscopic analysis.", "journal": "Journal of the American Chemical Society", "date": "2015", "authors": "Gagnon DM, Brophy MB, Bowman SE, Stich TA, Drennan CL, Britt RD, Nolan EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "25597447", "url": "https://glygen.org/publication/PubMed/25597447" } ] }, { "title": "Structure of human lactoferrin: crystallographic structure analysis and refinement at 2.8-A resolution.", "journal": "J. Mol. Biol.", "date": "1989", "authors": "Anderson B F, Baker H M, Norris G E, Rice D W, Baker E N", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "2585506", "url": "https://glygen.org/publication/PubMed/2585506" } ] }, { "title": "Human basal tear peptidome characterization by CID, HCD, and ETD followed by in silico and in vitro analyses for antimicrobial peptide identification.", "journal": "J. Proteome Res.", "date": "2015", "authors": "Azkargorta M, Soria J, Ojeda C, Guzman F, Acera A, Iloro I, Suarez T, Elortza F", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "25946035", "url": "https://glygen.org/publication/PubMed/25946035" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "Recognition of microbial glycans by human intelectin-1.", "journal": "Nature structural & molecular biology", "date": "2015", "authors": "Wesener DA, Wangkanont K, McBride R, Song X, Kraft MB, Hodges HL, Zarling LC, Splain RA, Smith DF, Cummings RD, Paulson JC, Forest KT, Kiessling LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "26148048", "url": "https://glygen.org/publication/PubMed/26148048" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02788", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Insights into the Antimicrobial Mechanism of Action of Human RNase6: Structural Determinants for Bacterial Cell Agglutination and Membrane Permeation.", "journal": "International journal of molecular sciences", "date": "2016", "authors": "Pulido D, Arranz-Trullen J, Prats-Ejarque G, Velazquez D, Torrent M, Moussaoui M, Boix E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "27089320", "url": "https://glygen.org/publication/PubMed/27089320" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Ultrastructural localization of lactoferrin and myeloperoxidase in human neutrophils by immunogold.", "journal": "Blood", "date": "1985", "authors": "Cramer E, Pryzwansky KB, Villeval JL, Testa U, Breton-Gorius J", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "2981589", "url": "https://glygen.org/publication/PubMed/2981589" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "Damage of the outer membrane of enteric gram-negative bacteria by lactoferrin and transferrin.", "journal": "Infection and immunity", "date": "1988-11", "authors": "Ellison R T, Giehl T J, LaForce F M", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "3169987", "url": "https://glygen.org/publication/PubMed/3169987" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Histatins, a novel family of histidine-rich proteins in human parotid secretion. Isolation, characterization, primary structure, and fungistatic effects on Candida albicans.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Oppenheim FG, Xu T, McMillian FM, Levitz SM, Diamond RD, Offner GD, Troxler RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "3286634", "url": "https://glygen.org/publication/PubMed/3286634" } ] }, { "title": "Isolation of lactoferrin cDNA from a human myeloid library and expression of mRNA during normal and leukemic myelopoiesis.", "journal": "Blood", "date": "1987", "authors": "Rado T A, Wei X P, Benz E J", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "3477300", "url": "https://glygen.org/publication/PubMed/3477300" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "Lactoferrin Modulates Induction of Transcription Factor c-Fos in Neuronal Cultures.", "journal": "International journal of molecular sciences", "date": "2023-05-06", "authors": "Kopaeva Marina Yu, Azieva Asya M, Cherepov Anton B, Zarayskaya Irina Yu", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" } ], "reference": [ { "type": "PubMed", "id": "37176079", "url": "https://glygen.org/publication/PubMed/37176079" } ] }, { "title": "Ceruloplasmin Reduces the Lactoferrin/Oleic Acid Antitumor Complex-Mediated Release of Heme-Containing Proteins from Blood Cells.", "journal": "International journal of molecular sciences", "date": "2023-11-24", "authors": "Elizarova Anna Yu, Sokolov Alexey V, Vasilyev Vadim B", "evidence": [ { "database": "RefSeq", "id": "NP_001186078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186078" } ], "reference": [ { "type": "PubMed", "id": "38069040", "url": "https://glygen.org/publication/PubMed/38069040" } ] }, { "title": "Human lactotransferrin: amino acid sequence and structural comparisons with other transferrins.", "journal": "Eur. J. Biochem.", "date": "1984", "authors": "Metz-Boutigue M H, Joll\u00e8s J, Mazurier J, Schoentgen F, Legrand D, Spik G, Montreuil J, Joll\u00e8s P", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "6510420", "url": "https://glygen.org/publication/PubMed/6510420" } ] }, { "title": "The present state of the human lactotransferrin sequence. Study and alignment of the cyanogen bromide fragments and characterization of N- and C-terminal domains.", "journal": "Biochim. Biophys. Acta", "date": "1981", "authors": "Metz-Boutigue M H, Mazurier J, Joll\u00e8s J, Spik G, Montreuil J, Joll\u00e8s P", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "6794640", "url": "https://glygen.org/publication/PubMed/6794640" } ] }, { "title": "Bactericidal activity of human lactoferrin: differentiation from the stasis of iron deprivation.", "journal": "Infection and immunity", "date": "1982-03", "authors": "Arnold R R, Russell J E, Champion W J, Brewer M, Gauthier J J", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "6802759", "url": "https://glygen.org/publication/PubMed/6802759" } ] }, { "title": "An 88 amino acid long C-terminal sequence of human lactotransferrin.", "journal": "FEBS Lett.", "date": "1982", "authors": "Metz-Boutigue M H, Joll\u00e8s J, Mazurier J, Spik G, Montreuil J, Joll\u00e8s P", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "7049727", "url": "https://glygen.org/publication/PubMed/7049727" } ] }, { "title": "Primary structure of the glycans from human lactotransferrin.", "journal": "European journal of biochemistry", "date": "1982", "authors": "Spik G, Strecker G, Fournet B, Bouquelet S, Montreuil J, Dorland L, van Halbeek H, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "7060557", "url": "https://glygen.org/publication/PubMed/7060557" } ] }, { "title": "Structural study of the sugar chains of human lactoferrin: finding of four novel complex-type asparagine-linked sugar chains.", "journal": "Journal of biochemistry", "date": "1982", "authors": "Matsumoto A, Yoshima H, Takasaki S, Kobata A", "evidence": [ { "database": "UniCarbKB", "id": "P02788", "url": "" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "7068558", "url": "https://glygen.org/publication/PubMed/7068558" } ] }, { "title": "Structural determination of two N-linked glycans isolated from recombinant human lactoferrin expressed in BHK cells.", "journal": "FEBS letters", "date": "1995", "authors": "Legrand D, Salmon V, Coddeville B, Benaissa M, Plancke Y, Spik G", "evidence": [ { "database": "UniCarbKB", "id": "P02788", "url": "" }, { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "7774715", "url": "https://glygen.org/publication/PubMed/7774715" } ] }, { "title": "Primary structure of the major glycan from human seminal transferrin.", "journal": "Journal of protein chemistry", "date": "1994", "authors": "D'Andrea G, D'Alessandro AM, Salucci ML, Oratore A", "evidence": [ { "database": "GlyConnect", "id": "320", "url": "https://glyconnect.expasy.org/browser/proteins/320" } ], "reference": [ { "type": "PubMed", "id": "8011069", "url": "https://glygen.org/publication/PubMed/8011069" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety.", "journal": "Structure (London, England : 1993)", "date": "1994", "authors": "Bourne Y, Mazurier J, Legrand D, Rouge P, Montreuil J, Spik G, Cambillau C", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788#ptm_processing" }, { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8069634", "url": "https://glygen.org/publication/PubMed/8069634" } ] }, { "title": "Delineation of the glycosaminoglycan-binding site in the human inflammatory response protein lactoferrin.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Mann D M, Romm E, Migliorini M", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8089135", "url": "https://glygen.org/publication/PubMed/8089135" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Structure of the recombinant N-terminal lobe of human lactoferrin at 2.0 A resolution.", "journal": "J. Mol. Biol.", "date": "1993", "authors": "Day CL, Anderson BF, Tweedie JW, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8371268", "url": "https://glygen.org/publication/PubMed/8371268" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "Characterization of the 84-kDa protein with ABH activity in human seminal plasma.", "journal": "Nihon Hoigaku Zasshi", "date": "1995", "authors": "Sato I", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8551695", "url": "https://glygen.org/publication/PubMed/8551695" } ] }, { "title": "Altered domain closure and iron binding in transferrins: the crystal structure of the Asp60Ser mutant of the amino-terminal half-molecule of human lactoferrin.", "journal": "Journal of molecular biology", "date": "1996", "authors": "Faber HR, Bland T, Day CL, Norris GE, Tweedie JW, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8594202", "url": "https://glygen.org/publication/PubMed/8594202" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Anion binding by transferrins: importance of second-shell effects revealed by the crystal structure of oxalate-substituted diferric lactoferrin.", "journal": "Biochemistry", "date": "1996", "authors": "Baker HM, Anderson BF, Brodie AM, Shongwe MS, Smith CA, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8703903", "url": "https://glygen.org/publication/PubMed/8703903" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "Mutation of arginine 121 in lactoferrin destabilizes iron binding by disruption of anion binding: crystal structures of R121S and R121E mutants.", "journal": "Biochemistry", "date": "1996", "authors": "Faber HR, Baker CJ, Day CL, Tweedie JW, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "8931543", "url": "https://glygen.org/publication/PubMed/8931543" } ] }, { "title": "Mutagenesis of the histidine ligand in human lactoferrin: iron binding properties and crystal structure of the histidine-253-->methionine mutant.", "journal": "Biochemistry", "date": "1997", "authors": "Nicholson H, Anderson BF, Bland T, Shewry SC, Tweedie JW, Baker EN", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "9003186", "url": "https://glygen.org/publication/PubMed/9003186" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "Identification of an alternative form of human lactoferrin mRNA that is expressed differentially in normal tissues and tumor-derived cell lines.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Siebert PD, Huang BC", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "9122171", "url": "https://glygen.org/publication/PubMed/9122171" } ] }, { "title": "N-terminal stretch Arg2, Arg3, Arg4 and Arg5 of human lactoferrin is essential for binding to heparin, bacterial lipopolysaccharide, human lysozyme and DNA.", "journal": "The Biochemical journal", "date": "1997", "authors": "van Berkel PH, Geerts ME, van Veen HA, Mericskay M, de Boer HA, Nuijens JH", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "9359845", "url": "https://glygen.org/publication/PubMed/9359845" } ] }, { "title": "Role of the bactericidal/permeability-increasing protein in host defence.", "journal": "Current opinion in immunology", "date": "1998", "authors": "Elsbach P, Weiss J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "9523110", "url": "https://glygen.org/publication/PubMed/9523110" } ] }, { "title": "The bactericidal/permeability-increasing protein (BPI) in antibacterial host defense.", "journal": "Journal of leukocyte biology", "date": "1998", "authors": "Elsbach P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "9665269", "url": "https://glygen.org/publication/PubMed/9665269" } ] }, { "title": "An antimicrobial activity of cytolytic T cells mediated by granulysin.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Stenger S, Hanson DA, Teitelbaum R, Dewan P, Niazi KR, Froelich CJ, Ganz T, Thoma-Uszynski S, Melian A, Bogdan C, Porcelli SA, Bloom BR, Krensky AM, Modlin RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "9756476", "url": "https://glygen.org/publication/PubMed/9756476" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Familial subepithelial corneal amyloidosis (gelatinous drop-like corneal dystrophy): exclusion of linkage to lactoferrin gene.", "journal": "Molecular vision", "date": "1998", "authors": "Klintworth GK, Sommer JR, Obrian G, Han L, Ahmed MN, Qumsiyeh MB, Lin PY, Basti S, Reddy MK, Kanai A, Hotta Y, Sugar J, Kumaramanickavel G, Munier F, Schorderet DF, El Matri L, Iwata F, Kaiser-Kupfer M, Nagata M, Nakayasu K, Hejtmancik JF, Teng CT", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "reference": [ { "type": "PubMed", "id": "9873069", "url": "https://glygen.org/publication/PubMed/9873069" } ] } ], "pathway": [ { "id": "hsa:4057", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4057", "resource": "KEGG Pathway" }, { "id": "R-HSA-1222449", "name": "Mtb iron assimilation by chelation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1222449", "resource": "Reactome", "description": "Mtb iron assimilation by chelation" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-6799990", "name": "Metal sequestration by antimicrobial proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990", "resource": "Reactome", "description": "Metal sequestration by antimicrobial proteins" }, { "id": "R-HSA-6803157", "name": "Antimicrobial peptides", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157", "resource": "Reactome", "description": "Antimicrobial peptides" }, { "id": "R-HSA-977225", "name": "Amyloid fiber formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZAB1-1", "protein_name": "Lactotransferrin", "gene_name": "Ltf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRPFITVLMFLGVLGPFLARIDTVVRWCTISRNEAQKCFMWQEMLNKAGVPKLRCARKYFMPHCIQEIMMRRADAMTLSGSAIFDFYFPYKLQPIAAEVYGTKEKPRIHYYAVAVVKNSSDIRLNQLQGLKSCHAGFDTSAGWIAPLGALRPYLNWDEKSVSLEEAVSKFFSQSCVPGISKSRFPRLCSLCAGKGEHICDFSPQEPYAGYAGAFRCLRDNAGDVAFIRESTIFEELPNEAEWDQYKLLCPDNTWKPVTEYKECHLAQIPSRAVVAHVRSEKDSAIWELLHLSQEMFGKNKTSKFELFGSYLGQKDLLFKDSVIGFVRVPFTVNVWLYLTFSYIMALKSLKESKENVMALRARITWCAVGSEEKLKCDQWSRVSVGKITCISCTTTEQCIFSITMGDADAMNLDGGYIYSAGKCGLVPVLAEIQKSPNSNGSDCVDRPAEGYLAVAAVRKEDTGFTWSTVRGKKSCHTAVDRTAGWNIPMGLLVNQTNSCQFKEFFNKSCAPGSFLYSNLCALCIGDENGKDKCNPNSQERYQGYVGAFRCLAEKAGNVAFLKDATVLQNTDGKNADKWAKNLKLDDFELLCLDDTRKPVTEAKNCHLAVAPNHAVVARKDKARLVQQELLYQQVQFGRNGCRCPEEFCLFRSETKNLLFNDNTECLAKLPSKITWEEYLGKEYVVAIAHLRQCSNITQEAYNFLALRNS", "length": 709 }, "evidence": [ { "id": "45918146", "url": "http://www.informatics.jax.org/homology/45918146", "database": "MGI" }, { "id": "P02788", "url": "https://omabrowser.org/oma/group/P02788/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P08071-1", "protein_name": "Lactotransferrin", "gene_name": "Ltf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRLLIPSLIFLEALGLCLAKATTVQWCAVSNSEEEKCLRWQNEMRKVGGPPLSCVKKSSTRQCIQAIVTNRADAMTLDGGTMFDAGKPPYKLRPVAAEVYGTKEQPRTHYYAVAVVKNSSNFHLNQLQGLRSCHTGIGRSAGWKIPIGTLRPYLNWNGPPASLEEAVSKFFSKSCVPGAQKDRFPNLCSSCAGTGANKCASSPEEPYSGYAGALRCLRDNAGDVAFTRGSTVFEELPNKAERDQYKLLCPDNTWKPVTEYKECHLAQVPSHAVVSRSTNDKEEAIWELLRQSQEKFGKKQASGFQLFASPSGQKDLLFKESAIGFVRVPQKVDVGLYLTFSYTTSIQNLNKKQQDVIASKARVTWCAVGSEEKRKCDQWNRASRGRVTCISFPTTEDCIVAIMKGDADAMSLDGGYIYTAGKCGLVPVLAENQKSSKSNGLDCVNRPVEGYLAVAAVRREDAGFTWSSLRGKKSCHTAVDRTAGWNIPMGLLANQTRSCKFNEFFSQSCAPGADPKSNLCALCIGDEKGENKCAPNSKERYQGYTGALRCLAEKAGNVAFLKDSTVLQNTDGKNTEEWARNLKLKDFELLCLDDTRKPVTEAKNCHLAIAPNHAVVSRTDKVEVLQQVLLDQQVQFGRNGQRCPGEFCLFQSKTKNLLFNDNTECLAKIPGKTTSEKYLGKEYVIATERLKQCSSSPLLEACAFLTQ", "length": 707 }, "evidence": [ { "id": "45918146", "url": "http://www.informatics.jax.org/homology/45918146", "database": "MGI" }, { "id": "P02788", "url": "https://omabrowser.org/oma/group/P02788/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6YT39-1", "protein_name": "Lactotransferrin", "gene_name": "LTF", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKLFIPALLFLGTLGLCLAAPKKGVRWCVISTAEYSKCRQWQSKIRRTNPIFCIRRASPTDCIRAIAAKRADAVTLDGGLVFEADQYKLRPVAAEIYGTEENPQTYYYAVAVVKKGFNFQLNQLQGRKSCHTGLGRSAGWNIPIGLLRRFLDWAGPPEPLQKAVAKFFSQSCVPCADGNAYPNLCQLCIGKGKDKCACSSQEPYFGYSGAFNCLHKGIGDVAFVKESTVFENLPQKADRDKYELLCPDNTRKPVEAFRECHLARVPSHAVVARSVNGKENSIWELLYQSQKKFGKSNPQEFQLFGSPGQQKDLLFRDATIGFLKIPSKIDSKLYLGLPYLTAIQGLRETAAEVEARQAKVVWCAVGPEELRKCRQWSSQSSQNLNCSLASTTEDCIVQVLKGEADAMSLDGGFIYTAGKCGLVPVLAENQKSRQSSSSDCVHRPTQGYFAVAVVRKANGGITWNSVRGTKSCHTAVDRTAGWNIPMGLLVNQTGSCKFDEFFSQSCAPGSQPGSNLCALCVGNDQGVDKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLDNTNGQNTEEWARELRSDDFELLCLDGTRKPVTEAQNCHLAVAPSHAVVSRKEKAAQVEQVLLTEQAQFGRYGKDCPDKFCLFRSETKNLLFNDNTECLAQLQGKTTYEKYLGSEYVTAIANLKQCSVSPLLEACAFMMR", "length": 704 }, "evidence": [ { "id": "P02788", "url": "https://omabrowser.org/oma/group/P02788/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "serine-type endopeptidase activity", "id": "GO:0004252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "lipopolysaccharide binding", "id": "GO:0001530", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001530", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "protein serine/threonine kinase activator activity", "id": "GO:0043539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043539", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase inhibitor activity", "id": "GO:0004869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004869", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "membrane destabilizing activity", "id": "GO:0140912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140912", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 15, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "secretory granule", "id": "GO:0030141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030141", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "specific granule", "id": "GO:0042581", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042581", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "specific granule lumen", "id": "GO:0035580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035580", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "tertiary granule lumen", "id": "GO:1904724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904724", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "phagocytic vesicle lumen", "id": "GO:0097013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097013", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 31, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "antifungal humoral response", "id": "GO:0019732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019732", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "regulation of cytokine production", "id": "GO:0001817", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001817", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "ossification", "id": "GO:0001503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001503", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of osteoblast proliferation", "id": "GO:0033690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033690", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of viral process", "id": "GO:0048525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048525", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of protein serine/threonine kinase activity", "id": "GO:0071902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071902", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "bone morphogenesis", "id": "GO:0060349", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060349", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "innate immune response in mucosa", "id": "GO:0002227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002227", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of osteoblast differentiation", "id": "GO:0045669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045669", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "killing of cells of another organism", "id": "GO:0031640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031640", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "regulation of tumor necrosis factor production", "id": "GO:0032680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032680", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of ATP-dependent activity", "id": "GO:0032780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032780", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of single-species biofilm formation in or on host organism", "id": "GO:1900229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900229", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "iron ion transport", "id": "GO:0006826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006826", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of toll-like receptor 4 signaling pathway", "id": "GO:0034145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034145", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of osteoclast development", "id": "GO:2001205", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001205", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of chondrocyte proliferation", "id": "GO:1902732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902732", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation by host of viral process", "id": "GO:0044793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044793", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "positive regulation of bone mineralization involved in bone maturation", "id": "GO:1900159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900159", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor (ligand) superfamily member 11 production", "id": "GO:2000308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000308", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of lipopolysaccharide-mediated signaling pathway", "id": "GO:0031665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031665", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" }, { "name": "negative regulation of cysteine-type endopeptidase activity", "id": "GO:2000117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000117", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "lactotransferrin N-glycosylated 1 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G07162IJ. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G07162IJ. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053045", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053045" } ] }, { "name": "lactotransferrin N-glycosylated 2 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053046", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053046" } ] }, { "name": "lactotransferrin N-glycosylated 3 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053047", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053047" } ] }, { "name": "lactotransferrin N-glycosylated 4 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G33608TH. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G33608TH. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053048", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053048" } ] }, { "name": "lactotransferrin N-glycosylated 5 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G44444MB. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G44444MB. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053049", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053049" } ] }, { "name": "lactotransferrin N-glycosylated 6 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G56749GV. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G56749GV. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053050", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053050" } ] }, { "name": "lactotransferrin N-glycosylated 7 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G74264KM. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G74264KM. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053051", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053051" } ] }, { "name": "lactotransferrin N-glycosylated 8 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053052", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053052" } ] }, { "name": "lactotransferrin N-glycosylated 9 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053053", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053053" } ] }, { "name": "lactotransferrin N-glycosylated 10 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053054", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053054" } ] }, { "name": "lactotransferrin N-glycosylated 11 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053055", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053055" } ] }, { "name": "lactotransferrin N-glycosylated 12 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053056", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053056" } ] }, { "name": "lactotransferrin N-glycosylated 13 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053057", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053057" } ] }, { "name": "lactotransferrin N-glycosylated 14 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G90348RI. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G90348RI. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053058", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053058" } ] }, { "name": "lactotransferrin N-glycosylated 15 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-156 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G93284HQ. Example: UniProtKB:P02788-1, Asn-156, MOD:00160~GNO:G93284HQ. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053059", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053059" } ] }, { "name": "lactotransferrin N-glycosylated 16 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G07162IJ. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G07162IJ. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053060", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053060" } ] }, { "name": "lactotransferrin N-glycosylated 17 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053061", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053061" } ] }, { "name": "lactotransferrin N-glycosylated 18 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053062", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053062" } ] }, { "name": "lactotransferrin N-glycosylated 19 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G33608TH. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G33608TH. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053063", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053063" } ] }, { "name": "lactotransferrin N-glycosylated 20 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G44444MB. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G44444MB. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053064", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053064" } ] }, { "name": "lactotransferrin N-glycosylated 21 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G56749GV. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G56749GV. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053065", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053065" } ] }, { "name": "lactotransferrin N-glycosylated 22 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053066", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053066" } ] }, { "name": "lactotransferrin N-glycosylated 23 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G74264KM. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G74264KM. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053067", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053067" } ] }, { "name": "lactotransferrin N-glycosylated 24 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053068", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053068" } ] }, { "name": "lactotransferrin N-glycosylated 25 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053069", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053069" } ] }, { "name": "lactotransferrin N-glycosylated 26 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053070", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053070" } ] }, { "name": "lactotransferrin N-glycosylated 27 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G90348RI. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G90348RI. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053071", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053071" } ] }, { "name": "lactotransferrin N-glycosylated 28 (human)", "definition": "A lactotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-497 of the amino acid sequence represented by UniProtKB:P02788-1, in which the glycan structure is represented by GlyTouCan:G93284HQ. Example: UniProtKB:P02788-1, Asn-497, MOD:00160~GNO:G93284HQ. [PRO:DNx, PMID:12151713, PMID:2390069, PMID:7068558, PMID:7774715]", "evidence": [ { "id": "PR:000053072", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053072" } ] } ], "site_annotation": [ { "start_pos": 156, "end_pos": 158, "annotation": "n_glycosylation_sequon" }, { "start_pos": 497, "end_pos": 499, "annotation": "n_glycosylation_sequon" }, { "start_pos": 642, "end_pos": 644, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "O-GlcNAcylation at Ser-10 inhibits DNA binding and negatively regulates the transcriptional activity (PubMed:20404350). Alternatively can undergo phosphorylation at Ser-10 (PubMed:20404350).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "20404350", "url": "https://glygen.org/publication/PubMed/20404350" } ] }, { "annotation": "Phosphorylation at Ser-10 activates the transcriptional activity (PubMed:20404350). Phosphorylation at Ser-10 also promotes proteasomal degradation (PubMed:20404350). Alternatively can undergo O-GlcNAcylation at Ser-10 (PubMed:20404350).", "evidence": [ { "database": "UniProtKB", "id": "P02788", "url": "https://www.uniprot.org/uniprot/P02788" }, { "database": "PubMed", "id": "20404350", "url": "https://glygen.org/publication/PubMed/20404350" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-1222491", "name": "Lactoferrin scavenges iron ions", "equation": "", "summary": "Lactoferrin is secreted from many tissues to collect stray iron ions that can catalyze unwanted reactions, and to starve microorganisms of this important metal. One molecule of lactoferrin can load two ferric (Fe(3+)) ions together with two carbonate (CO3(2-)) anions (Haridas et al. 1995).", "cellular_location": "phagocytic vesicle lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P02788-1" ], "evidence": [ { "id": "R-HSA-1222491", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1222491" } ] }, { "id": "R-HSA-1222641", "name": "Carboxymycobactin binds LTF:2xFe3+:2xCO3(2-)", "equation": "", "summary": "Since bacterial siderophores bind iron with much greater affinity, they can scavenge iron ions from loaded lactoferrin (Madigan et al. 2012).", "cellular_location": "phagocytic vesicle lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P02788-1" ], "evidence": [ { "id": "R-HSA-1222641", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1222641" } ] }, { "id": "R-HSA-6798745", "name": "Exocytosis of tertiary granule lumen proteins", "equation": "", "summary": "Tertiary (gelatinase) granules are part of a continuum of peroxidase-negative granules formed in myelocytes, metamyelocytes, band cells and segmented neutrophils. They differ from secondary granules by having a low content of antimicrobial substances, and are more readily exocytosed (Sengelov et al. 1995). Tertiary granules are primarily a reservoir of extracellular matrix degrading enzymes and membrane receptors that are needed for neutrophil extravasation and diapedesis (Faurschou & Borregaard 2003).", "cellular_location": "extracellular region, tertiary granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P32320-1", "Q92820-1", "Q9NQR4-1", "P36871-1", "P07339-1", "P04075-1", "P09972-1", "Q13510-1", "Q8WVQ1-1", "P29350-1", "Q13231-1", "P14780-1", "Q16769-1", "P61626-1", "P02788-1", "P02794-1", "P98066-1", "P25774-1", "Q9H8H3-1", "P09960-1", "P35030-1", "O75874-1", "P22894-1", "O00391-1" ], "evidence": [ { "id": "R-HSA-6798745", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798745" } ] }, { "id": "R-HSA-6798749", "name": "Exocytosis of specific granule lumen proteins", "equation": "", "summary": "Secondary (specific) granules are peroxidase-negative and rich in antimicrobial substances (Joiner et al. 1989, Rorvig et al. 2012). They are more irregular and elongated in form than azurophil granules (Bainton et al. 1971). This might reflect volume adjustment in azurophil granules, which are known to proteolytically process a significant fraction of the proteins that are targeted to them, while little or no processing and therefore no increase in osmotic activity due to proteolysis has been observed in secondary granules (Borregaard & Cowland 1997). Secondary and tertiary granules have overlapping contents but can be discriminated by their intrinsic buoyant densities when centrifuged on gradient media (Kjeldsen et al. 1994).", "cellular_location": "extracellular region, specific granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBR2-1", "P09110-1", "P49184-1", "Q92820-1", "Q99519-1", "P08246-1", "P51159-1", "Q9NQR4-1", "P07339-1", "P19801-1", "P05089-1", "Q8WVQ1-1", "P29350-1", "Q13231-1", "Q16769-1", "P61626-1", "P02788-1", "P42685-1", "P22894-1", "Q9Y251-1", "O00764-1", "O00391-1" ], "evidence": [ { "id": "R-HSA-6798749", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798749" } ] }, { "id": "R-HSA-6810643", "name": "EPPIN protein complex binds bacteria", "equation": "", "summary": "Epididymal protease inhibitor (EPPIN) is an androgen-regulated sperm-binding protein (Yenugu S et al. 2004). EPPIN is expressed specifically in the testis and epididymis (Richardson RT et al. 2001). EPPIN coats the surface of human testicular and epididymal spermatozoa as part of a protein complex containing lactotransferrin (LTF) and clusterin (CLU) (Wang Z et al. 2007; Paasch U et al. 2011). During ejaculation, semenogelin 1 (SEMG1) binds to EPPIN in the complex (Wang Z et al. 2005; 2007; O'Rand MG et al, 2009; 2011; Silva EJ et al. 2012). The components of the complex, EPPIN, LTF and SEMG1-derived peptides have been shown to possess microbicidal activity. EPPIN exhibited dose- and time-dependent antibacterial activity against E. coli (Yenugu S et al. 2004). While the activity of EPPIN was relatively insensitive to salt, it was completely lost on reduction and alkylation of Cys residues of EPPIN, indicating the importance of disulfide bonds (Yenugu S et al. 2004). Furthermore, EPPIN was able to induce morphological alterations of E. coli membranes as shown by scanning electron microscopy and measuring bacterial respiratory electron transport (Yenugu S et al. 2004; McCrudden MT et al. 2008). LTF is a multifunctional protein that is best known for its ability to bind iron, which eventually led to the discovery of its antibacterial activity. In addition, LTF has demonstrated potent antiviral, antifungal and antiparasitic activity towards a broad spectrum of species (Legrand D et al. 2008). SEMG1-derived peptides were found in the cationic fraction of seminal plasma and showed high levels of antibacterial activity against E. coli and B. megaterium (Bourgeon F et al. 2004; Edstrom AM et al. 2008). The EPPIN protein complex provides antimicrobial activity on the sperm surface. In addition, the binding of SEMG1 to EPPIN during ejaculation inhibits sperm progressive motility, possibly by disturbing the regulation of intracellular pH, resulting in the loss of calcium (O'Rand MG et al, 2009; O'Rand MG & Widgren EE 2012). In parallel, EPPIN inhibits the digestion of SEMG1 by the serine protease prostate specific antigen (PSA), which results in the modulation of semen liquefaction, further prolonging the inhibitory effects of SEMG1 on sperm motility (Wang Z et al. 2005; Wang ZJ et al. 2008; Silva EJ et al. 2013).

EPPIN has two potential protease inhibitory domains: a whey acid protein (WAP)-type four disulfide core (WFDC) domain and a Kunitz domain (Richardson RT et al. 2001; McCrudden MT et al. 2008). While both domains of EPPIN are involved in the protein's antibacterial activity, only the Kunitz domain is required for selective protease inhibition (McCrudden MT et al. 2008).", "cellular_location": "sperm plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P02788-1" ], "evidence": [ { "id": "R-HSA-6810643", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6810643" } ] }, { "id": "R-HSA-8951549", "name": "Carbocymycobactin binds Fe3+ from LTF:2xFe3+:2xCO3(2-)", "equation": "", "summary": "Since bacterial siderophores bind iron with much greater affinity, they can scavenge iron ions from loaded lactoferrin (Madigan et al. 2012).", "cellular_location": "phagocytic vesicle lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P02788-1" ], "evidence": [ { "id": "R-HSA-8951549", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951549" } ] }, { "id": "R-HSA-8951552", "name": "LTF:2xCO3(2-) dissociates from Carbocymycobactin:Fe3+", "equation": "", "summary": "Since bacterial siderophores bind iron with much greater affinity, they can scavenge iron ions from loaded lactoferrin (Madigan et al. 2012).", "cellular_location": "phagocytic vesicle lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P02788-1" ], "evidence": [ { "id": "R-HSA-8951552", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951552" } ] }, { "id": "R-HSA-976734", "name": "Amyloid fibrils have additional components", "equation": "", "summary": "In addition to the main fibril peptide, mature amyloid fibrils have additional components. Serum amyloid P component (SAP) binds to all types of amyloid fibrils and is a universal constituent of amyloid deposits. SAP binding protects amyloid fibrils from proteolytic degradation (Tennent et al. 1995, Westermark 2005). SAP may function as a chaperone for amyloid formation (Coker et al. 2000).

Glycosaminoglycans (GAGs) and proteoglycans are found associated with all types of amyloid deposits (Alexandrescu 2005). Of the different types of GAG heparan sulfate and dermatan sulfate are the most prominent in amyloid deposits (Hirschfield & Hawkins, 2003). GAGs have been implicated in the nucleation of fibrils, they can also stabilize mature fibrils against dissociation (Yamaguchi et al. 2003) and proteolytic degradation (Gupta-Bansal et al. 1995).

Perlecan coimmunolocalizes with all types of amyloids (Snow & Wright 1989), accelerating fibril formation (Castillo et al. 1998), stabilizing them once formed (Castillo et al. 1997), and protecting them from proteolytic degradation (Gupta-Bansal et al. 1995).

APOE isoform 4 binds tightly to soluble ABeta peptide forming complexes that resist dissociation; it also binds to ABeta in its fibril form (Bales et al. 2002).", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61626-1", "P02788-1" ], "evidence": [ { "id": "R-HSA-976734", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-976734" } ] }, { "id": "R-HSA-977136", "name": "Amyloid precursor proteins form ordered fibrils", "equation": "", "summary": "Amyloid fibril formation is associated with a wide range of diseases (Chiti & Dobson 2006), though the accumulation and deposition of fibrillar material does not correlate well with disease pathogenesis and it is now widely believed that oligomeric amyloid forms are largely responsible for the cytotoxic effects of amyloid (Glabe 2009). Fibrils have been described as more like crystalline polymer structures than the protein monomers they are derived from (Wetzel et al. 2007). In vitro, fibril formation is usually preceded by the association of monomers into oligomeric structures (Kodali & Wetzel 2007), though this remains to be established in vivo. Amyloid-beta forms spherical structures with around 12 units (Bernstein et al. 2005). Larger structures called protofibrils are also observed, non-spherical filamentous structures lacking a periodic substructure (Goldsbury 2005).", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61626-1", "P02788-1" ], "evidence": [ { "id": "R-HSA-977136", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977136" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O00391", "gene_name": "QSOX1", "activity": [ { "ec_number": "1.8.3.2", "activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.", "evidence": [ { "id": "O00391", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00391" } ] }, { "ec_number": "1.8.3.2", "activity": "", "evidence": [ { "id": "O00391", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00391" } ] } ] }, { "uniprot_ac": "O00764", "gene_name": "PDXK", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] } ] }, { "uniprot_ac": "O75874", "gene_name": "IDH1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] } ] }, { "uniprot_ac": "P02788", "gene_name": "LTF", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "P02788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02788" } ] } ] }, { "uniprot_ac": "P02794", "gene_name": "FTH1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P02794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02794" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P02794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02794" } ] } ] }, { "uniprot_ac": "P04075", "gene_name": "ALDOA", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P04075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04075" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P04075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04075" } ] } ] }, { "uniprot_ac": "P05089", "gene_name": "ARG1", "activity": [ { "ec_number": "3.5.3.1", "activity": "H2O + L-arginine = L-ornithine + urea.", "evidence": [ { "id": "P05089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05089" } ] }, { "ec_number": "3.5.3.1", "activity": "", "evidence": [ { "id": "P05089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05089" } ] } ] }, { "uniprot_ac": "P07339", "gene_name": "CTSD", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] } ] }, { "uniprot_ac": "P08246", "gene_name": "ELANE", "activity": [ { "ec_number": "3.4.21.37", "activity": "Hydrolysis of proteins, including elastin. Preferential cleavage: Val-|-Xaa > Ala-|-Xaa.", "evidence": [ { "id": "P08246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08246" } ] }, { "ec_number": "3.4.21.37", "activity": "", "evidence": [ { "id": "P08246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08246" } ] } ] }, { "uniprot_ac": "P09110", "gene_name": "ACAA1", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] } ] }, { "uniprot_ac": "P09960", "gene_name": "LTA4H", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] } ] }, { "uniprot_ac": "P09972", "gene_name": "ALDOC", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P09972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09972" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P09972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09972" } ] } ] }, { "uniprot_ac": "P14780", "gene_name": "MMP9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P14780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14780" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P14780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14780" } ] } ] }, { "uniprot_ac": "P19801", "gene_name": "AOC1", "activity": [ { "ec_number": "1.4.3.22", "activity": "H2O + histamine + O2 = H2O2 + imidazole-4-acetaldehyde + NH4(+).", "evidence": [ { "id": "P19801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19801" } ] }, { "ec_number": "1.4.3.22", "activity": "", "evidence": [ { "id": "P19801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19801" } ] }, { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "P19801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19801" } ] } ] }, { "uniprot_ac": "P22894", "gene_name": "MMP8", "activity": [ { "ec_number": "3.4.24.34", "activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.", "evidence": [ { "id": "P22894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22894" } ] }, { "ec_number": "3.4.24.34", "activity": "", "evidence": [ { "id": "P22894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22894" } ] } ] }, { "uniprot_ac": "P25774", "gene_name": "CTSS", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "P25774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25774" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "P25774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25774" } ] } ] }, { "uniprot_ac": "P29350", "gene_name": "PTPN6", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P29350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29350" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29350" } ] } ] }, { "uniprot_ac": "P32320", "gene_name": "CDA", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "P32320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32320" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "P32320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32320" } ] } ] }, { "uniprot_ac": "P35030", "gene_name": "PRSS3", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "P35030", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35030" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "P35030", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35030" } ] } ] }, { "uniprot_ac": "P36871", "gene_name": "PGM1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "P36871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36871" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "P36871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36871" } ] } ] }, { "uniprot_ac": "P42685", "gene_name": "FRK", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P42685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42685" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P42685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42685" } ] } ] }, { "uniprot_ac": "P49184", "gene_name": "DNASE1L1", "activity": [ { "ec_number": "3.1.21.-", "activity": "", "evidence": [ { "id": "P49184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49184" } ] } ] }, { "uniprot_ac": "P51159", "gene_name": "RAB27A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] } ] }, { "uniprot_ac": "P61626", "gene_name": "LYZ", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P61626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61626" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P61626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61626" } ] } ] }, { "uniprot_ac": "P98066", "gene_name": "TNFAIP6", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "P98066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98066" } ] } ] }, { "uniprot_ac": "Q13231", "gene_name": "CHIT1", "activity": [ { "ec_number": "3.2.1.14", "activity": "Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.", "evidence": [ { "id": "Q13231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13231" } ] }, { "ec_number": "3.2.1.14", "activity": "", "evidence": [ { "id": "Q13231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13231" } ] } ] }, { "uniprot_ac": "Q13510", "gene_name": "ASAH1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] } ] }, { "uniprot_ac": "Q16769", "gene_name": "QPCT", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] } ] }, { "uniprot_ac": "Q8WVQ1", "gene_name": "CANT1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] } ] }, { "uniprot_ac": "Q92820", "gene_name": "GGH", "activity": [ { "ec_number": "3.4.19.9", "activity": "(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + (n-1) H2O = (6S)-5,6,7,8-tetrahydrofolate + (n-1) L-glutamate.", "evidence": [ { "id": "Q92820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92820" } ] }, { "ec_number": "3.4.19.9", "activity": "", "evidence": [ { "id": "Q92820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92820" } ] } ] }, { "uniprot_ac": "Q99519", "gene_name": "NEU1", "activity": [ { "ec_number": "3.2.1.18", "activity": "Hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.", "evidence": [ { "id": "Q99519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99519" } ] }, { "ec_number": "3.2.1.18", "activity": "", "evidence": [ { "id": "Q99519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99519" } ] } ] }, { "uniprot_ac": "Q9H8H3", "gene_name": "TMT1A", "activity": [ { "ec_number": "2.1.1.348", "activity": "an adenosine in mRNA + S-adenosyl-L-methionine = an N(6)-methyladenosine in mRNA + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9H8H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8H3" } ] }, { "ec_number": "2.1.1.9", "activity": "a thiol + S-adenosyl-L-methionine = a methyl thioether + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9H8H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8H3" } ] }, { "ec_number": "2.1.1.9", "activity": "", "evidence": [ { "id": "Q9H8H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H8H3" } ] } ] }, { "uniprot_ac": "Q9NQR4", "gene_name": "NIT2", "activity": [ { "ec_number": "3.5.1.3", "activity": "a monoamide of a dicarboxylate + H2O = a dicarboxylate + NH4(+).", "evidence": [ { "id": "Q9NQR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR4" } ] }, { "ec_number": "3.5.1.3", "activity": "", "evidence": [ { "id": "Q9NQR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR4" } ] } ] }, { "uniprot_ac": "Q9UBR2", "gene_name": "CTSZ", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] } ] }, { "uniprot_ac": "Q9Y251", "gene_name": "HPSE", "activity": [ { "ec_number": "3.2.1.166", "activity": "endohydrolysis of (1->4)-beta-D-glycosidic bonds of heparan sulfate chains in heparan sulfate proteoglycan.", "evidence": [ { "id": "Q9Y251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y251" } ] }, { "ec_number": "3.2.1.166", "activity": "", "evidence": [ { "id": "Q9Y251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y251" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 156, 497, 642 ], "o_linked_sites": [ 436 ], "snv_sites": [ 49, 69, 147, 156, 158, 236, 320, 387, 466, 491, 499, 507, 541, 578, 580, 642, 644, 695 ], "glycation_sites": [], "phosphorylation_sites": [ 10, 109, 278, 547 ], "sequon_annotation_sites": [ { "start_pos": 156, "end_pos": 158 }, { "start_pos": 497, "end_pos": 499 }, { "start_pos": 642, "end_pos": 644 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 260 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 158 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 257 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 158 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 19 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 208 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }