{ "uniprot_canonical_ac": "P02724-1", "uniprot_ac": "P02724", "uniprot_id": "GLPA_HUMAN", "mass": { "chemical_mass": 16331.0, "monoisotopic_mass": 16331.0 }, "refseq": { "ac": "NP_001295119", "name": "glycophorin-A isoform 3 precursor", "summary": "Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" }, "gene_names": [ { "name": "GYPA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02724", "id": "P02724" }, { "name": "CD235a; GPA; GPErik; GPSAT; HGpMiV; HGpMiXI; HGpSta(C); MN; MNS; PAS-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119", "id": "NP_001295119" }, { "name": "GPA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02724", "id": "P02724" }, { "name": "GPErik", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02724", "id": "P02724" }, { "name": "GYPA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119", "id": "NP_001295119" }, { "name": "hCG_2026259", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02724", "id": "P02724" } ], "protein_names": [ { "name": "Glycophorin-A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02724" }, { "name": "MN sialoglycoprotein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02724" }, { "name": "PAS-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02724" }, { "name": "Sialoglycoprotein alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02724" }, { "name": "glycophorin A (MN blood group); glycophorin A transcript; glycophorin SAT; glycophorin A, GPA; erythroid-lineage-specific membrane sialoglycoprotein; glycophorin MiI; glycophorin MiV; glycophorin Erik; glycophorin Sta type C; recombinant glycophorin A-B Miltenberger-DR; Mi.V glycoprotein (24 AA); MN sialoglycoprotein; sialoglycoprotein alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119", "id": "NP_001295119" }, { "name": "glycophorin-A isoform 3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119", "id": "NP_001295119" } ], "function": [ { "annotation": "(Microbial infection) Appears to be a receptor for Hepatitis A virus (HAV).", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724#function" }, { "database": "PubMed", "id": "15331714", "url": "https://glygen.org/publication/PubMed/15331714" } ] }, { "annotation": "(Microbial infection) Receptor for P.falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724#function" }, { "database": "PubMed", "id": "8009226", "url": "https://glygen.org/publication/PubMed/8009226" } ] }, { "annotation": "Characterization of alternatively spliced transcript variants of glycophorin A and glycophorin B genes in Chinese blood donors.", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" }, { "database": "PubMed", "id": "35138639", "url": "https://glygen.org/publication/PubMed/35138639" } ] }, { "annotation": "Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed:35835865). Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724#function" }, { "database": "PubMed", "id": "10926825", "url": "https://glygen.org/publication/PubMed/10926825" }, { "database": "PubMed", "id": "12813056", "url": "https://glygen.org/publication/PubMed/12813056" }, { "database": "PubMed", "id": "14604989", "url": "https://glygen.org/publication/PubMed/14604989" }, { "database": "PubMed", "id": "19438409", "url": "https://glygen.org/publication/PubMed/19438409" }, { "database": "PubMed", "id": "35835865", "url": "https://glygen.org/publication/PubMed/35835865" } ] }, { "annotation": "Diagnostic value of glycophorin-A in comparison with P57 immunohistochemical staining method in differentiating complete and partial molar pregnancies.", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" }, { "database": "PubMed", "id": "34146830", "url": "https://glygen.org/publication/PubMed/34146830" } ] }, { "annotation": "Fatal haemolytic transfusion reaction due to anti-En[a] and identification of a novel GYPA c.295delG variant in a Thai family.", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" }, { "database": "PubMed", "id": "36102166", "url": "https://glygen.org/publication/PubMed/36102166" } ] }, { "annotation": "Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" } ] } ], "disease": [ { "disease_id": "MONDO:0020616", "recommended_name": { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "obsolete blood group, mn", "description": "" }, "synonyms": [ { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "blood group, MNSs system", "description": "" }, { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "BLOOD GROUP, MN", "description": "" }, { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "Blood Group, Mnss System", "description": "" }, { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "MN", "description": "" }, { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "Mn Blood Group", "description": "" }, { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "Mns Blood Group Systed", "description": "" }, { "id": "MONDO:0020616", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0020616", "name": "Mnss Blood Group System", "description": "" } ], "evidence": [ { "id": "111300", "database": "MIM", "url": "https://www.omim.org/entry/111300" } ] }, { "disease_id": "MONDO:0021024", "recommended_name": { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, susceptibility to", "description": "" }, "synonyms": [ { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, Severe, resistance to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, Severe, susceptibility to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, cerebral, reduced risk of", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, cerebral, resistance to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, cerebral, susceptibility to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, protection against", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, resistance to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, susceptibility to", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "malaria, vivax, protection against", "description": "" }, { "id": "MONDO:0021024", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021024", "name": "resistance to malaria due to G6PD deficiency", "description": "" } ], "evidence": [ { "id": "611162", "database": "MIM", "url": "https://www.omim.org/entry/611162" } ] } ], "snv": [ { "evidence": [ { "id": "rs1057077083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1057077083" }, { "id": "rs1057077083", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1057077083#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 119, "end_pos": 119, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "4", "chr_pos": "144116854", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K119", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770975475", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770975475" }, { "id": "rs770975475", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770975475" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 16, "end_pos": 16, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).", "chr_id": "4", "chr_pos": "144120579", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S16", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781475939", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781475939" }, { "id": "rs781475939", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781475939" }, { "id": "rs781475939", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781475939" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 21, "end_pos": 21, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "4", "chr_pos": "144120565", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S21", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746705478", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746705478" }, { "id": "rs746705478", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746705478" }, { "id": "rs746705478", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746705478" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "4", "chr_pos": "144120561", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T22", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746705478", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746705478" }, { "id": "rs746705478", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746705478" }, { "id": "rs746705478", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746705478" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "4", "chr_pos": "144120561", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T22", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753693249", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753693249" }, { "id": "rs753693249", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753693249" }, { "id": "rs753693249", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753693249#frequency_tab" }, { "id": "rs753693249", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753693249" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 23, "end_pos": 23, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "4", "chr_pos": "144120558", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T23", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753693249", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753693249" }, { "id": "rs753693249", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753693249" }, { "id": "rs753693249", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753693249#frequency_tab" }, { "id": "rs753693249", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753693249" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 23, "end_pos": 23, "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "4", "chr_pos": "144120558", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T23", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs749915460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749915460" }, { "id": "rs749915460", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749915460" }, { "id": "rs749915460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749915460" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 23, "end_pos": 23, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "4", "chr_pos": "144120559", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T23", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762975385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762975385" }, { "id": "rs762975385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762975385" }, { "id": "rs762975385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762975385" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 30, "end_pos": 30, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "4", "chr_pos": "144120531", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S30", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762975385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762975385" }, { "id": "rs762975385", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762975385" }, { "id": "rs762975385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762975385" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "4", "chr_pos": "144120531", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1176709985", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1176709985" }, { "id": "rs1176709985", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1176709985" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "144119713", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T36", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1579140274", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1579140274" }, { "id": "rs1579140274", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1579140274" }, { "id": "24145436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24145436" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "4", "chr_pos": "144120519", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T36", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs770296478", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770296478" }, { "id": "rs770296478", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770296478" }, { "id": "rs770296478", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770296478" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 42, "end_pos": 42, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "4", "chr_pos": "144120502", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S42", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762240480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762240480" }, { "id": "rs762240480", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762240480" }, { "id": "rs762240480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762240480#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 44, "end_pos": 44, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "144120496", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T44", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs56172553", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56172553" }, { "id": "rs56172553", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs56172553" }, { "id": "rs56172553", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56172553" }, { "id": "rs56172553", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs56172553#frequency_tab" }, { "id": "rs56172553", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs56172553" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 44, "end_pos": 44, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "4", "chr_pos": "144119688", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T44", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs56172553", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56172553" }, { "id": "rs56172553", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs56172553" }, { "id": "rs56172553", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56172553" }, { "id": "rs56172553", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs56172553#frequency_tab" }, { "id": "rs56172553", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs56172553" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 44, "end_pos": 44, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "4", "chr_pos": "144119688", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T44", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs144802902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144802902" }, { "id": "rs144802902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144802902" }, { "id": "rs144802902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144802902#frequency_tab" }, { "id": "rs144802902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144802902" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 47, "end_pos": 47, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDK).", "chr_id": "4", "chr_pos": "144119778", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T47", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs144802902", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144802902" }, { "id": "rs144802902", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144802902" }, { "id": "rs144802902", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144802902#frequency_tab" }, { "id": "rs144802902", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144802902" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 47, "end_pos": 47, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDM).", "chr_id": "4", "chr_pos": "144119778", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T47", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149400689", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149400689" }, { "id": "rs149400689", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149400689#frequency_tab" }, { "id": "rs149400689", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149400689" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 52, "end_pos": 52, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "4", "chr_pos": "144119763", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T52", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs56077914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56077914" }, { "id": "rs56077914", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs56077914" }, { "id": "rs56077914", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56077914" }, { "id": "rs56077914", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56077914" }, { "id": "rs56077914", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs56077914#frequency_tab" }, { "id": "rs56077914", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs56077914" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 66, "end_pos": 66, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "4", "chr_pos": "144119721", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "S66", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1176709985", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1176709985" }, { "id": "rs1176709985", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1176709985" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 69, "end_pos": 69, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "144119713", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T69", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 102, "end_pos": 102, "sequence_org": "G", "sequence_mut": "L", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "10926825", "url": "https://glygen.org/publication/PubMed/10926825" } ] }, { "start_pos": 87, "end_pos": 87, "sequence_org": "F", "sequence_mut": "C", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "12813056", "url": "https://glygen.org/publication/PubMed/12813056" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "S", "sequence_mut": "C", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "12813056", "url": "https://glygen.org/publication/PubMed/12813056" } ] }, { "start_pos": 90, "end_pos": 90, "sequence_org": "P", "sequence_mut": "C", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "12813056", "url": "https://glygen.org/publication/PubMed/12813056" } ] }, { "start_pos": 91, "end_pos": 91, "sequence_org": "E", "sequence_mut": "C", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "12813056", "url": "https://glygen.org/publication/PubMed/12813056" } ] }, { "start_pos": 94, "end_pos": 94, "sequence_org": "L", "sequence_mut": "I", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "10926825", "url": "https://glygen.org/publication/PubMed/10926825" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "I", "sequence_mut": "A", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "10926825", "url": "https://glygen.org/publication/PubMed/10926825" } ] }, { "start_pos": 98, "end_pos": 98, "sequence_org": "G", "sequence_mut": "L", "comment": "Diminishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "10926825", "url": "https://glygen.org/publication/PubMed/10926825" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "58.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "48.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "45.98", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "40.08", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "41.39", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "46.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "48.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "44.82", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "47.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02724", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02724" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "common_name": "Human" } ], "gene": [ { "name": "GYPA", "url": "https://www.uniprot.org/uniprot/P02724", "locus": { "chromosome": "4", "start_pos": 36438, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_793", "url": "https://www.ensembl.org/id/LRG_793" } ] } } ], "crossref": [ { "id": "ENSG00000170180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170180", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL5806", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5806", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "GYPA", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GYPA", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2993", "url": "https://www.ncbi.nlm.nih.gov/gene/2993", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "188", "url": "https://glyconnect.expasy.org/browser/proteins/188", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "4702", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4702", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02724", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02724*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001195", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001195", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018938", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018938", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2993", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2993", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "111300", "url": "http://www.omim.org/entry/111300", "database": "MIM", "categories": [ "Other" ] }, { "id": "611162", "url": "http://www.omim.org/entry/611162", "database": "MIM", "categories": [ "Other" ] }, { "id": "617922", "url": "http://www.omim.org/entry/617922", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02724", "url": "https://www.nextprot.org/entry/NX_P02724", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P02724", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02724", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MYEKIVI", "url": "https://omabrowser.org/oma/group/MYEKIVI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5232857at2759", "url": "http://www.orthodb.org/?query=5232857at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13813", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13813", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13813:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13813:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1AFO", "url": "https://www.rcsb.org/structure/1AFO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KPE", "url": "https://www.rcsb.org/structure/2KPE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KPF", "url": "https://www.rcsb.org/structure/2KPF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EH4", "url": "https://www.rcsb.org/structure/5EH4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EH6", "url": "https://www.rcsb.org/structure/5EH6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UZ3", "url": "https://www.rcsb.org/structure/7UZ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V07", "url": "https://www.rcsb.org/structure/7V07", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V0K", "url": "https://www.rcsb.org/structure/7V0K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V19", "url": "https://www.rcsb.org/structure/7V19", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CRQ", "url": "https://www.rcsb.org/structure/8CRQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CRR", "url": "https://www.rcsb.org/structure/8CRR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CRT", "url": "https://www.rcsb.org/structure/8CRT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CS9", "url": "https://www.rcsb.org/structure/8CS9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CSL", "url": "https://www.rcsb.org/structure/8CSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CT3", "url": "https://www.rcsb.org/structure/8CT3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CTE", "url": "https://www.rcsb.org/structure/8CTE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01102", "url": "http://pfam.xfam.org/family/PF01102", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02724", "url": "https://pharos.nih.gov/targets/P02724", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052547", "url": "https://proconsortium.org/app/entry/PR:000052547", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052548", "url": "https://proconsortium.org/app/entry/PR:000052548", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052549", "url": "https://proconsortium.org/app/entry/PR:000052549", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052550", "url": "https://proconsortium.org/app/entry/PR:000052550", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052551", "url": "https://proconsortium.org/app/entry/PR:000052551", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052552", "url": "https://proconsortium.org/app/entry/PR:000052552", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052553", "url": "https://proconsortium.org/app/entry/PR:000052553", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052554", "url": "https://proconsortium.org/app/entry/PR:000052554", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052555", "url": "https://proconsortium.org/app/entry/PR:000052555", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052556", "url": "https://proconsortium.org/app/entry/PR:000052556", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052557", "url": "https://proconsortium.org/app/entry/PR:000052557", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052558", "url": "https://proconsortium.org/app/entry/PR:000052558", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052559", "url": "https://proconsortium.org/app/entry/PR:000052559", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052560", "url": "https://proconsortium.org/app/entry/PR:000052560", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052561", "url": "https://proconsortium.org/app/entry/PR:000052561", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052562", "url": "https://proconsortium.org/app/entry/PR:000052562", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052563", "url": "https://proconsortium.org/app/entry/PR:000052563", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052564", "url": "https://proconsortium.org/app/entry/PR:000052564", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052565", "url": "https://proconsortium.org/app/entry/PR:000052565", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052566", "url": "https://proconsortium.org/app/entry/PR:000052566", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052567", "url": "https://proconsortium.org/app/entry/PR:000052567", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052568", "url": "https://proconsortium.org/app/entry/PR:000052568", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052569", "url": "https://proconsortium.org/app/entry/PR:000052569", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052570", "url": "https://proconsortium.org/app/entry/PR:000052570", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052571", "url": "https://proconsortium.org/app/entry/PR:000052571", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052572", "url": "https://proconsortium.org/app/entry/PR:000052572", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052573", "url": "https://proconsortium.org/app/entry/PR:000052573", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052574", "url": "https://proconsortium.org/app/entry/PR:000052574", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052575", "url": "https://proconsortium.org/app/entry/PR:000052575", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052576", "url": "https://proconsortium.org/app/entry/PR:000052576", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052577", "url": "https://proconsortium.org/app/entry/PR:000052577", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052578", "url": "https://proconsortium.org/app/entry/PR:000052578", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052579", "url": "https://proconsortium.org/app/entry/PR:000052579", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052580", "url": "https://proconsortium.org/app/entry/PR:000052580", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052581", "url": "https://proconsortium.org/app/entry/PR:000052581", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052582", "url": "https://proconsortium.org/app/entry/PR:000052582", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052583", "url": "https://proconsortium.org/app/entry/PR:000052583", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052584", "url": "https://proconsortium.org/app/entry/PR:000052584", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052585", "url": "https://proconsortium.org/app/entry/PR:000052585", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052586", "url": "https://proconsortium.org/app/entry/PR:000052586", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052587", "url": "https://proconsortium.org/app/entry/PR:000052587", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052588", "url": "https://proconsortium.org/app/entry/PR:000052588", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052589", "url": "https://proconsortium.org/app/entry/PR:000052589", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052590", "url": "https://proconsortium.org/app/entry/PR:000052590", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052591", "url": "https://proconsortium.org/app/entry/PR:000052591", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052592", "url": "https://proconsortium.org/app/entry/PR:000052592", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052593", "url": "https://proconsortium.org/app/entry/PR:000052593", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052594", "url": "https://proconsortium.org/app/entry/PR:000052594", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052595", "url": "https://proconsortium.org/app/entry/PR:000052595", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052596", "url": "https://proconsortium.org/app/entry/PR:000052596", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052597", "url": "https://proconsortium.org/app/entry/PR:000052597", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052598", "url": "https://proconsortium.org/app/entry/PR:000052598", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052599", "url": "https://proconsortium.org/app/entry/PR:000052599", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052600", "url": "https://proconsortium.org/app/entry/PR:000052600", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052601", "url": "https://proconsortium.org/app/entry/PR:000052601", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052602", "url": "https://proconsortium.org/app/entry/PR:000052602", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052603", "url": "https://proconsortium.org/app/entry/PR:000052603", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052604", "url": "https://proconsortium.org/app/entry/PR:000052604", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052605", "url": "https://proconsortium.org/app/entry/PR:000052605", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052606", "url": "https://proconsortium.org/app/entry/PR:000052606", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052607", "url": "https://proconsortium.org/app/entry/PR:000052607", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052608", "url": "https://proconsortium.org/app/entry/PR:000052608", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052609", "url": "https://proconsortium.org/app/entry/PR:000052609", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052610", "url": "https://proconsortium.org/app/entry/PR:000052610", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052611", "url": "https://proconsortium.org/app/entry/PR:000052611", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052612", "url": "https://proconsortium.org/app/entry/PR:000052612", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052613", "url": "https://proconsortium.org/app/entry/PR:000052613", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052614", "url": "https://proconsortium.org/app/entry/PR:000052614", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052615", "url": "https://proconsortium.org/app/entry/PR:000052615", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052616", "url": "https://proconsortium.org/app/entry/PR:000052616", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052617", "url": "https://proconsortium.org/app/entry/PR:000052617", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052618", "url": "https://proconsortium.org/app/entry/PR:000052618", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052619", "url": "https://proconsortium.org/app/entry/PR:000052619", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052620", "url": "https://proconsortium.org/app/entry/PR:000052620", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052621", "url": "https://proconsortium.org/app/entry/PR:000052621", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052622", "url": "https://proconsortium.org/app/entry/PR:000052622", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052623", "url": "https://proconsortium.org/app/entry/PR:000052623", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052624", "url": "https://proconsortium.org/app/entry/PR:000052624", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052625", "url": "https://proconsortium.org/app/entry/PR:000052625", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052626", "url": "https://proconsortium.org/app/entry/PR:000052626", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052627", "url": "https://proconsortium.org/app/entry/PR:000052627", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052628", "url": "https://proconsortium.org/app/entry/PR:000052628", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052629", "url": "https://proconsortium.org/app/entry/PR:000052629", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052630", "url": "https://proconsortium.org/app/entry/PR:000052630", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052631", "url": "https://proconsortium.org/app/entry/PR:000052631", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052632", "url": "https://proconsortium.org/app/entry/PR:000052632", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052633", "url": "https://proconsortium.org/app/entry/PR:000052633", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052634", "url": "https://proconsortium.org/app/entry/PR:000052634", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052635", "url": "https://proconsortium.org/app/entry/PR:000052635", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052636", "url": "https://proconsortium.org/app/entry/PR:000052636", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052637", "url": "https://proconsortium.org/app/entry/PR:000052637", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052638", "url": "https://proconsortium.org/app/entry/PR:000052638", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052639", "url": "https://proconsortium.org/app/entry/PR:000052639", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052640", "url": "https://proconsortium.org/app/entry/PR:000052640", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052641", "url": "https://proconsortium.org/app/entry/PR:000052641", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052642", "url": "https://proconsortium.org/app/entry/PR:000052642", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052643", "url": "https://proconsortium.org/app/entry/PR:000052643", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052644", "url": "https://proconsortium.org/app/entry/PR:000052644", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052645", "url": "https://proconsortium.org/app/entry/PR:000052645", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052646", "url": "https://proconsortium.org/app/entry/PR:000052646", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052647", "url": "https://proconsortium.org/app/entry/PR:000052647", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052648", "url": "https://proconsortium.org/app/entry/PR:000052648", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052649", "url": "https://proconsortium.org/app/entry/PR:000052649", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052650", "url": "https://proconsortium.org/app/entry/PR:000052650", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052651", "url": "https://proconsortium.org/app/entry/PR:000052651", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052652", "url": "https://proconsortium.org/app/entry/PR:000052652", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052653", "url": "https://proconsortium.org/app/entry/PR:000052653", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052654", "url": "https://proconsortium.org/app/entry/PR:000052654", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052655", "url": "https://proconsortium.org/app/entry/PR:000052655", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052656", "url": "https://proconsortium.org/app/entry/PR:000052656", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052657", "url": "https://proconsortium.org/app/entry/PR:000052657", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052658", "url": "https://proconsortium.org/app/entry/PR:000052658", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052659", "url": "https://proconsortium.org/app/entry/PR:000052659", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052660", "url": "https://proconsortium.org/app/entry/PR:000052660", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052661", "url": "https://proconsortium.org/app/entry/PR:000052661", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052662", "url": "https://proconsortium.org/app/entry/PR:000052662", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052663", "url": "https://proconsortium.org/app/entry/PR:000052663", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052664", "url": "https://proconsortium.org/app/entry/PR:000052664", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052665", "url": "https://proconsortium.org/app/entry/PR:000052665", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052666", "url": "https://proconsortium.org/app/entry/PR:000052666", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052667", "url": "https://proconsortium.org/app/entry/PR:000052667", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052668", "url": "https://proconsortium.org/app/entry/PR:000052668", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052669", "url": "https://proconsortium.org/app/entry/PR:000052669", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052670", "url": "https://proconsortium.org/app/entry/PR:000052670", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052671", "url": "https://proconsortium.org/app/entry/PR:000052671", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052672", "url": "https://proconsortium.org/app/entry/PR:000052672", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052673", "url": "https://proconsortium.org/app/entry/PR:000052673", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052674", "url": "https://proconsortium.org/app/entry/PR:000052674", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052675", "url": "https://proconsortium.org/app/entry/PR:000052675", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052676", "url": "https://proconsortium.org/app/entry/PR:000052676", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052677", "url": "https://proconsortium.org/app/entry/PR:000052677", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052678", "url": "https://proconsortium.org/app/entry/PR:000052678", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052679", "url": "https://proconsortium.org/app/entry/PR:000052679", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052680", "url": "https://proconsortium.org/app/entry/PR:000052680", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052681", "url": "https://proconsortium.org/app/entry/PR:000052681", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052682", "url": "https://proconsortium.org/app/entry/PR:000052682", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052683", "url": "https://proconsortium.org/app/entry/PR:000052683", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052684", "url": "https://proconsortium.org/app/entry/PR:000052684", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052685", "url": "https://proconsortium.org/app/entry/PR:000052685", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052686", "url": "https://proconsortium.org/app/entry/PR:000052686", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052687", "url": "https://proconsortium.org/app/entry/PR:000052687", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052688", "url": "https://proconsortium.org/app/entry/PR:000052688", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052689", "url": "https://proconsortium.org/app/entry/PR:000052689", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052690", "url": "https://proconsortium.org/app/entry/PR:000052690", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052691", "url": "https://proconsortium.org/app/entry/PR:000052691", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052692", "url": "https://proconsortium.org/app/entry/PR:000052692", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052693", "url": "https://proconsortium.org/app/entry/PR:000052693", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052694", "url": "https://proconsortium.org/app/entry/PR:000052694", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052695", "url": "https://proconsortium.org/app/entry/PR:000052695", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052696", "url": "https://proconsortium.org/app/entry/PR:000052696", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052697", "url": "https://proconsortium.org/app/entry/PR:000052697", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052698", "url": "https://proconsortium.org/app/entry/PR:000052698", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052699", "url": "https://proconsortium.org/app/entry/PR:000052699", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052700", "url": "https://proconsortium.org/app/entry/PR:000052700", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052701", "url": "https://proconsortium.org/app/entry/PR:000052701", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052702", "url": "https://proconsortium.org/app/entry/PR:000052702", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052703", "url": "https://proconsortium.org/app/entry/PR:000052703", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052704", "url": "https://proconsortium.org/app/entry/PR:000052704", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052705", "url": "https://proconsortium.org/app/entry/PR:000052705", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052706", "url": "https://proconsortium.org/app/entry/PR:000052706", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052707", "url": "https://proconsortium.org/app/entry/PR:000052707", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052708", "url": "https://proconsortium.org/app/entry/PR:000052708", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052709", "url": "https://proconsortium.org/app/entry/PR:000052709", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052710", "url": "https://proconsortium.org/app/entry/PR:000052710", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052711", "url": "https://proconsortium.org/app/entry/PR:000052711", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052712", "url": "https://proconsortium.org/app/entry/PR:000052712", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052713", "url": "https://proconsortium.org/app/entry/PR:000052713", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052714", "url": "https://proconsortium.org/app/entry/PR:000052714", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052715", "url": "https://proconsortium.org/app/entry/PR:000052715", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052716", "url": "https://proconsortium.org/app/entry/PR:000052716", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052717", "url": "https://proconsortium.org/app/entry/PR:000052717", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052718", "url": "https://proconsortium.org/app/entry/PR:000052718", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052719", "url": "https://proconsortium.org/app/entry/PR:000052719", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052720", "url": "https://proconsortium.org/app/entry/PR:000052720", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052721", "url": "https://proconsortium.org/app/entry/PR:000052721", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052722", "url": "https://proconsortium.org/app/entry/PR:000052722", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052723", "url": "https://proconsortium.org/app/entry/PR:000052723", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052724", "url": "https://proconsortium.org/app/entry/PR:000052724", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02724", "url": "http://purl.obolibrary.org/obo/PR_P02724", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02724", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A087WU29", "url": "https://www.uniprot.org/uniprot/A0A087WU29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WU29-1", "url": "https://www.uniprot.org/uniprot/A0A087WU29-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DFT7", "url": "https://www.uniprot.org/uniprot/A0A0C4DFT7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DFT7-1", "url": "https://www.uniprot.org/uniprot/A0A0C4DFT7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y7F9", "url": "https://www.uniprot.org/uniprot/A0A2R8Y7F9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y7F9-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y7F9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RJD8", "url": "https://www.uniprot.org/uniprot/D6RJD8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RJD8-1", "url": "https://www.uniprot.org/uniprot/D6RJD8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQF3", "url": "https://www.uniprot.org/uniprot/E7EQF3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQF3-1", "url": "https://www.uniprot.org/uniprot/E7EQF3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PD10", "url": "https://www.uniprot.org/uniprot/E9PD10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PD10-1", "url": "https://www.uniprot.org/uniprot/E9PD10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PH25", "url": "https://www.uniprot.org/uniprot/E9PH25", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PH25-1", "url": "https://www.uniprot.org/uniprot/E9PH25-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K9JI14", "url": "https://www.uniprot.org/uniprot/K9JI14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K9JI14-1", "url": "https://www.uniprot.org/uniprot/K9JI14-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K9JIK7", "url": "https://www.uniprot.org/uniprot/K9JIK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K9JIK7-1", "url": "https://www.uniprot.org/uniprot/K9JIK7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02724-1", "url": "https://www.uniprot.org/uniprot/P02724-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02724-2", "url": "https://www.uniprot.org/uniprot/P02724-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02724-3", "url": "https://www.uniprot.org/uniprot/P02724-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13030", "url": "https://www.uniprot.org/uniprot/Q13030", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13030-1", "url": "https://www.uniprot.org/uniprot/Q13030-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 150, "header": "sp|P02724-1|GLPA_HUMAN Isoform 1 of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=2 CANONICAL=P02724-1" }, "isoforms": [ { "isoform_ac": "A0A087WU29-1", "url": "", "sequence": { "sequence": "MLDTSFITPQEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 148, "header": "tr|A0A087WU29-1|A0A087WU29_HUMAN Computationally mapped isoform of Glycophorin OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144127908, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000535709.6", "url": "https://www.ensembl.org/id/ENST00000535709.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000445398.2", "url": "https://www.ensembl.org/id/ENSP00000445398.2" } ] } }, { "isoform_ac": "A0A0C4DFT7-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 150, "header": "tr|A0A0C4DFT7-1|GLPA_HUMAN Computationally mapped isoform of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000360771.8", "url": "https://www.ensembl.org/id/ENST00000360771.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000354003.4", "url": "https://www.ensembl.org/id/ENSP00000354003.4" } ] } }, { "isoform_ac": "A0A2R8Y7F9-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKRQVINENLFTKPNVERTQRRHKTSVK", "length": 145, "header": "tr|A0A2R8Y7F9-1|GLPA_HUMAN Computationally mapped isoform of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111333, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000642295.1", "url": "https://www.ensembl.org/id/ENST00000642295.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496079.1", "url": "https://www.ensembl.org/id/ENSP00000496079.1" } ] } }, { "isoform_ac": "D6RJD8-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSGDGANPENSGKRGQKAEGRARAKILKQQKL", "length": 42, "header": "tr|D6RJD8-1|GLPA_HUMAN Computationally mapped isoform of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144120583, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000508337.1", "url": "https://www.ensembl.org/id/ENST00000508337.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000425719.1", "url": "https://www.ensembl.org/id/ENSP00000425719.1" } ] } }, { "isoform_ac": "E7EQF3-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 118, "header": "tr|E7EQF3-1|E7EQF3_HUMAN Computationally mapped isoform of Glycophorin OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000504786.5", "url": "https://www.ensembl.org/id/ENST00000504786.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000425549.1", "url": "https://www.ensembl.org/id/ENSP00000425549.1" } ] } }, { "isoform_ac": "E9PD10-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 137, "header": "tr|E9PD10-1|E9PD10_HUMAN Computationally mapped isoform of Glycophorin OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000512064.5", "url": "https://www.ensembl.org/id/ENST00000512064.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000426130.1", "url": "https://www.ensembl.org/id/ENSP00000426130.1" } ] } }, { "isoform_ac": "E9PH25-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 105, "header": "tr|E9PH25-1|E9PH25_HUMAN Computationally mapped isoform of Glycophorin A (MNS blood group) OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000503627.2", "url": "https://www.ensembl.org/id/ENST00000503627.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000421243.1", "url": "https://www.ensembl.org/id/ENSP00000421243.1" } ] } }, { "isoform_ac": "K9JI14-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKRQVINENLFTKPNVERTQ", "length": 104, "header": "tr|K9JI14-1|GLPA_HUMAN Computationally mapped isoform of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111357, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000642738.1", "url": "https://www.ensembl.org/id/ENST00000642738.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000494322.1", "url": "https://www.ensembl.org/id/ENSP00000494322.1" } ] } }, { "isoform_ac": "K9JIK7-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 72, "header": "tr|K9JIK7-1|GLPA_HUMAN Computationally mapped isoform of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000643148.1", "url": "https://www.ensembl.org/id/ENST00000643148.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495505.1", "url": "https://www.ensembl.org/id/ENSP00000495505.1" } ] } }, { "isoform_ac": "P02724-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 150, "header": "sp|P02724-1|GLPA_HUMAN Isoform 1 of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=2 CANONICAL=P02724-1" }, "locus": {} }, { "isoform_ac": "P02724-2", "url": "", "sequence": { "sequence": "MHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 124, "header": "sp|P02724-2|GLPA_HUMAN Isoform 2 of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=2 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144120547, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000642713.1", "url": "https://www.ensembl.org/id/ENST00000642713.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000494092.1", "url": "https://www.ensembl.org/id/ENSP00000494092.1" } ] } }, { "isoform_ac": "P02724-3", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 117, "header": "sp|P02724-3|GLPA_HUMAN Isoform 3 of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=2 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000324022.14", "url": "https://www.ensembl.org/id/ENST00000324022.14" }, { "database": "Ensembl Peptide", "id": "ENSP00000324483.10", "url": "https://www.ensembl.org/id/ENSP00000324483.10" } ] } }, { "isoform_ac": "Q13030-1", "url": "", "sequence": { "sequence": "MYGKIIFVLLLSGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ", "length": 85, "header": "tr|Q13030-1|GLPA_HUMAN Computationally mapped isoform of Glycophorin-A OS=Homo sapiens OX=9606 GN=GYPA PE=1 SV=1 CANONICAL=P02724-1" }, "locus": { "chromosome": "4", "start_pos": 144140635, "end_pos": 144111397, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000512789.5", "url": "https://www.ensembl.org/id/ENST00000512789.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000425193.1", "url": "https://www.ensembl.org/id/ENSP00000425193.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 21, "start_aa": "Ser", "end_pos": 21, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser21", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 38, "start_aa": "Ser", "end_pos": 38, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser38", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 41, "start_aa": "Ser", "end_pos": 41, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser41", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 42, "start_aa": "Ser", "end_pos": 42, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser42", "evidence": [ { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 45, "start_aa": "Asn", "end_pos": 45, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn45", "evidence": [ { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 52, "start_aa": "Thr", "end_pos": 52, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02724" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 56, "start_aa": "Thr", "end_pos": 56, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr56", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "AHEVSEISVR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 59, "start_aa": "Ala", "end_pos": 68, "end_aa": "Arg", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "AHEVSEISVRTVYPPEEET", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 59, "start_aa": "Ala", "end_pos": 77, "end_aa": "Thr", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02724" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 66, "start_aa": "Ser", "end_pos": 66, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser66", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-21, T-22, T-23, T-29, S-30, T-31, S-32, T-36, S-38, S-41, T-44, N-45, T-52, T-56, S-63, S-66, T-69", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" }, { "id": "P02724", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "id": "1059087", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1059087" }, { "id": "8286855", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TVYPPEEETGER", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 69, "start_aa": "Thr", "end_pos": 80, "end_aa": "Arg", "evidence": [ { "id": "P02724", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "3967649", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3967649" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" }, { "id": "3305497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3305497" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G09480OP", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G16370GQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "3967649", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3967649" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "6190803", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "glytoucan_ac": "G19399OS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G31916IQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G32948PW", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G33350UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G33947BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G36123IU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G42797SX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "3967649", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3967649" } ] }, { "glytoucan_ac": "G47180UC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G56245IE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "3967649", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3967649" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" }, { "id": "3305497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3305497" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G71814NS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "3967649", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3967649" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" }, { "id": "3305497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3305497" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G76163CP", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "3967649", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3967649" }, { "id": "4091823", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4091823" }, { "id": "3514617", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3514617" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" }, { "id": "188", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/188" }, { "id": "1421410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1421410" }, { "id": "3305497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3305497" }, { "id": "189", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/189" }, { "id": "3624241", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "glytoucan_ac": "G85608AG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "7430095", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "glytoucan_ac": "G94217FB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "6619126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/187" }, { "id": "8384526", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8384526" } ] } ], "phosphorylation": [ { "start_pos": 133, "end_pos": 133, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P02724", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02724" } ], "site_lbl": "Thr133" }, { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P02724", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02724" } ], "site_lbl": "Ser138" }, { "start_pos": 148, "end_pos": 148, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P02724", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02724" } ], "site_lbl": "Ser148" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Glycophorin A mutation Ala65 --> Pro gives rise to a novel pair of MNS alleles ENEP (MNS39) and HAG (MNS41) and altered Wrb expression: direct evidence for GPA/band 3 interaction necessary for normal Wrb expression.", "journal": "Transfusion medicine (Oxford, England)", "date": "1999", "authors": "Poole J, Banks J, Bruce LJ, Ring SM, Levene C, Stern H, Overbeeke MA, Tanner MJ", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "10354388", "url": "https://glygen.org/publication/PubMed/10354388" } ] }, { "title": "Amino-acid sequence and oligosaccharide attachment sites of human erythrocyte glycophorin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1975", "authors": "Tomita M, Marchesi VT", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "1059087", "url": "https://glygen.org/publication/PubMed/1059087" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "The MNS blood group antigens, Vr (MNS12) and Mt(a) (MNS14), each arise from an amino acid substitution on glycophorin A.", "journal": "Vox sanguinis", "date": "2000", "authors": "Storry JR, Coghlan G, Poole J, Figueroa D, Reid ME", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "10729812", "url": "https://glygen.org/publication/PubMed/10729812" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "The low-frequency MNS blood group antigens Ny(a) (MNS18) and Os(a) (MNS38) are associated with GPA amino acid substitutions.", "journal": "Transfusion", "date": "2000", "authors": "Daniels GL, Bruce LJ, Mawby WJ, Green CA, Petty A, Okubo Y, Kornstad L, Tanner MJ", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "10827258", "url": "https://glygen.org/publication/PubMed/10827258" } ] }, { "title": "Identification of blood group A and B antigens in human glycophorin.", "journal": "Archivum immunologiae et therapiae experimentalis", "date": "2000", "authors": "Podbielska M, Krotkiewski H", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "10912628", "url": "https://glygen.org/publication/PubMed/10912628" } ] }, { "title": "Red-cell glycophorin A-band 3 interactions associated with the movement of band 3 to the cell surface.", "journal": "The Biochemical journal", "date": "2000", "authors": "Young MT, Beckmann R, Toye AM, Tanner MJ", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "10926825", "url": "https://glygen.org/publication/PubMed/10926825" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Glycophorin A dimerization and band 3 interaction during erythroid membrane biogenesis: in vivo studies in human glycophorin A transgenic mice.", "journal": "Blood", "date": "2001", "authors": "Auffray I, Marfatia S, de Jong K, Lee G, Huang C H, Paszty C, Tanner M J, Mohandas N, Chasis J A", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "11313283", "url": "https://glygen.org/publication/PubMed/11313283" } ] }, { "title": "In vivo detection of hetero-association of glycophorin-A and its mutants within the membrane.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Gerber D, Shai Y", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "11402026", "url": "https://glygen.org/publication/PubMed/11402026" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "Distinct regions of human glycophorin A enhance human red cell anion exchanger (band 3; AE1) transport function and surface trafficking.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Young MT, Tanner MJ", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "12813056", "url": "https://glygen.org/publication/PubMed/12813056" } ] }, { "title": "Molecular analysis of human glycophorin MiIX gene shows a silent segment transfer and untemplated mutation resulting from gene conversion via sequence repeats.", "journal": "Blood", "date": "1992", "authors": "Huang CH, Skov F, Daniels G, Tippett P, Blumenfeld OO", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "1421409", "url": "https://glygen.org/publication/PubMed/1421409" } ] }, { "title": "O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome.", "journal": "Blood", "date": "1992", "authors": "Blumenfeld OO, Lalezari P, Khorshidi M, Puglia K, Fukuda M", "evidence": [ { "database": "GlyConnect", "id": "188", "url": "https://glyconnect.expasy.org/browser/proteins/188" } ], "reference": [ { "type": "PubMed", "id": "1421410", "url": "https://glygen.org/publication/PubMed/1421410" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Altered structure and anion transport properties of band 3 (AE1, SLC4A1) in human red cells lacking glycophorin A.", "journal": "The Journal of biological chemistry", "date": "2004-01-23", "authors": "Bruce Lesley J, Pan Rui-jun, Cope Diane L, Uchikawa Makoto, Gunn Robert B, Cherry Richard J, Tanner Michael J A", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "14604989", "url": "https://glygen.org/publication/PubMed/14604989" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "The glycophorin A transmembrane domain dimer: sequence-specific propensity for a right-handed supercoil of helices.", "journal": "Biochemistry", "date": "1992", "authors": "Treutlein H R, Lemmon M A, Engelman D M, Br\u00fcnger A T", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "1463744", "url": "https://glygen.org/publication/PubMed/1463744" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "ABH blood group antigens in O-glycans of human glycophorin A.", "journal": "Archives of biochemistry and biophysics", "date": "2004", "authors": "Podbielska M, Fredriksson SA, Nilsson B, Lisowska E, Krotkiewski H", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "15313217", "url": "https://glygen.org/publication/PubMed/15313217" } ] }, { "title": "Capsid region involved in hepatitis A virus binding to glycophorin A of the erythrocyte membrane.", "journal": "Journal of virology", "date": "2004-09", "authors": "S\u00e1nchez Gl\u00f2ria, Aragon\u00e8s Llu\u00eds, Costafreda M Isabel, Ribes Enric, Bosch Albert, Pint\u00f3 Rosa M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "15331714", "url": "https://glygen.org/publication/PubMed/15331714" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Molecular basis for the human erythrocyte glycophorin specifying the Miltenberger class I (MiI) phenotype.", "journal": "Blood", "date": "1992", "authors": "Huang CH, Spruell P, Moulds JJ, Blumenfeld OO", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "1611092", "url": "https://glygen.org/publication/PubMed/1611092" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "Hsa, an adhesin of Streptococcus gordonii DL1, binds to alpha2-3-linked sialic acid on glycophorin A of the erythrocyte membrane.", "journal": "Microbiol. Immunol.", "date": "2008", "authors": "Yajima Ayako, Urano-Tashiro Yumiko, Shimazu Kisaki, Takashima Eizo, Takahashi Yukihiro, Konishi Kiyoshi", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "18380804", "url": "https://glygen.org/publication/PubMed/18380804" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Interaction of anion exchanger 1 and glycophorin A in human erythroleukaemic K562 cells.", "journal": "The Biochemical journal", "date": "2009-07-15", "authors": "Pang Allison J, Reithmeier Reinhart A F", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "19438409", "url": "https://glygen.org/publication/PubMed/19438409" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "The mechanism of production of multiple mRNAs for human glycophorin A.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Hamid J, Burness A T", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "2216775", "url": "https://glygen.org/publication/PubMed/2216775" } ] }, { "title": "Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G", "evidence": [ { "database": "GlyConnect", "id": "189", "url": "https://glyconnect.expasy.org/browser/proteins/189" } ], "reference": [ { "type": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "One- and two-dimensional NMR studies of the N-terminal portion of glycophorin A at 11.7 Tesla.", "journal": "J. Protein Chem.", "date": "1990", "authors": "Dill K, Hu S H, Berman E, Pavia A A, Lacombe J M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "2386609", "url": "https://glygen.org/publication/PubMed/2386609" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "Landscape of somatic mutations and clonal evolution in mantle cell lymphoma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bea S, Valdes-Mas R, Navarro A, Salaverria I, Martin-Garcia D, Jares P, Gine E, Pinyol M, Royo C, Nadeu F, Conde L, Juan M, Clot G, Vizan P, Di Croce L, Puente DA, Lopez-Guerra M, Moros A, Roue G, Aymerich M, Villamor N, Colomo L, Martinez A, Valera A, Martin-Subero JI, Amador V, Hernandez L, Rozman M, Enjuanes A, Forcada P, Muntanola A, Hartmann EM, Calasanz MJ, Rosenwald A, Ott G, Hernandez-Rivas JM, Klapper W, Siebert R, Wiestner A, Wilson WH, Colomer D, Lopez-Guillermo A, Lopez-Otin C, Puente XS, Campo E", "evidence": [ { "database": "dbSNP", "id": "rs1579140274", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1579140274" } ], "reference": [ { "type": "PubMed", "id": "24145436", "url": "https://glygen.org/publication/PubMed/24145436" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "iPTMnet", "id": "P02724", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02724" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Merozoite surface protein 1 recognition of host glycophorin A mediates malaria parasite invasion of red blood cells.", "journal": "Blood", "date": "2015", "authors": "Baldwin MR, Li X, Hanada T, Liu SC, Chishti AH", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "25778531", "url": "https://glygen.org/publication/PubMed/25778531" } ] }, { "title": "Structural organization of glycophorin A and B genes: glycophorin B gene evolved by homologous recombination at Alu repeat sequences.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Kudo S, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "2734312", "url": "https://glygen.org/publication/PubMed/2734312" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Isolation of cDNA clones for human erythrocyte membrane sialoglycoproteins alpha and delta.", "journal": "The Biochemical journal", "date": "1988", "authors": "Tate CG, Tanner MJ", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "3196288", "url": "https://glygen.org/publication/PubMed/3196288" } ] }, { "title": "Membrane glycophorins of Dantu blood group erythrocytes.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Blumenfeld OO, Smith AJ, Moulds JJ", "evidence": [ { "database": "GlyConnect", "id": "188", "url": "https://glyconnect.expasy.org/browser/proteins/188" } ], "reference": [ { "type": "PubMed", "id": "3305497", "url": "https://glygen.org/publication/PubMed/3305497" } ] }, { "title": "Characterization of cDNA clones for human glycophorin A. Use for gene localization and for analysis of normal of glycophorin-A-deficient (Finnish type) genomic DNA.", "journal": "Eur. J. Biochem.", "date": "1988", "authors": "Rahuel C, London J, d'Auriol L, Mattei M G, Tournamille C, Skrzynia C, Lebouc Y, Galibert F, Cartron J P", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "3345758", "url": "https://glygen.org/publication/PubMed/3345758" } ] }, { "title": "Diagnostic value of glycophorin-A in comparison with P57 immunohistochemical staining method in differentiating complete and partial molar pregnancies.", "journal": "Annals of diagnostic pathology", "date": "2021", "authors": "Nili F, Babazadeh S, Sarmadi S, Ameli F, Saffar H", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" } ], "reference": [ { "type": "PubMed", "id": "34146830", "url": "https://glygen.org/publication/PubMed/34146830" } ] }, { "title": "Isolation and characterization of human glycophorin A cDNA clones by a synthetic oligonucleotide approach: nucleotide sequence and mRNA structure.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Siebert P D, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "3456608", "url": "https://glygen.org/publication/PubMed/3456608" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02724", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02724" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Characterization of alternatively spliced transcript variants of glycophorin A and glycophorin B genes in Chinese blood donors.", "journal": "Vox sanguinis", "date": "2022", "authors": "Liang Y, Ren J, Zhong F, Hong W, Su Y, Wu F, Liang S, Liu J, Fang S, Liang Y, Fan X, Lin J, Liu Y, Feng B, Xu Y", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" } ], "reference": [ { "type": "PubMed", "id": "35138639", "url": "https://glygen.org/publication/PubMed/35138639" } ] }, { "title": "Membrane glycophorins in Sta blood group erythrocytes.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Blumenfeld OO, Adamany AM, Kikuchi M, Sabo B, McCreary J", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" }, { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "3514617", "url": "https://glygen.org/publication/PubMed/3514617" } ] }, { "title": "Architecture of the human erythrocyte ankyrin-1 complex.", "journal": "Nature structural & molecular biology", "date": "2022-07", "authors": "Vallese Francesca, Kim Kookjoo, Yen Laura Y, Johnston Jake D, Noble Alex J, Cal\u00ec Tito, Clarke Oliver Biggs", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "35835865", "url": "https://glygen.org/publication/PubMed/35835865" } ] }, { "title": "Fatal haemolytic transfusion reaction due to anti-Ena and identification of a novel GYPA c.295delG variant in a Thai family.", "journal": "Vox sanguinis", "date": "2022-11", "authors": "Suwanwootichai Ploymanee, Lopez Genghis H, Emthip Morakot, Wilson Brett, Millard Glenda M, Onpuns Sunisa, Laemsri Kanchana, Bejrachandra Sasitorn, Liew Yew-Wah", "evidence": [ { "database": "RefSeq", "id": "NP_001295119", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001295119" } ], "reference": [ { "type": "PubMed", "id": "36102166", "url": "https://glygen.org/publication/PubMed/36102166" } ] }, { "title": "Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Fukuda M, Lauffenburger M, Sasaki H, Rogers ME, Dell A", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "GlyConnect", "id": "189", "url": "https://glyconnect.expasy.org/browser/proteins/189" } ], "reference": [ { "type": "PubMed", "id": "3624241", "url": "https://glygen.org/publication/PubMed/3624241" } ] }, { "title": "Molecular biological study of the structure and expression of human glycophorin A.", "journal": "Rev. Fr. Transfus. Immunohematol.", "date": "1986", "authors": "Siebert P D, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "3809885", "url": "https://glygen.org/publication/PubMed/3809885" } ] }, { "title": "Structure determination of oligosaccharides isolated from Cad erythrocyte membranes by permethylation analysis and 500-MHz 1H-NMR spectroscopy.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Herkt F, Parente JP, Leroy Y, Fournet B, Blanchard D, Cartron JP, van Halbeek H, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "3967649", "url": "https://glygen.org/publication/PubMed/3967649" } ] }, { "title": "Comparative study of glycophorin A derived O-glycans from human Cad, Sd(a+) and Sd(a-) erythrocytes.", "journal": "The Biochemical journal", "date": "1985", "authors": "Blanchard D, Capon C, Leroy Y, Cartron JP, Fournet B", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" }, { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "4091823", "url": "https://glygen.org/publication/PubMed/4091823" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides.", "journal": "The Journal of biological chemistry", "date": "1969", "authors": "Thomas DB, Winzler RJ", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "5350948", "url": "https://glygen.org/publication/PubMed/5350948" } ] }, { "title": "Mg and Mc: mutations within the amino-terminal region of glycophorin A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Furthmayr H, Metaxas MN, Metaxas-Buhler M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "6166001", "url": "https://glygen.org/publication/PubMed/6166001" } ] }, { "title": "Primary structure of the oligosaccharide determinant of blood group Cad specificity.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Blanchard D, Cartron JP, Fournet B, Montreuil J, van Halbeek H, Vliegenthart JF", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" }, { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "6190803", "url": "https://glygen.org/publication/PubMed/6190803" } ] }, { "title": "A carbohydrate structural variant of MM glycoprotein (glycophorin A).", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Adamany AM, Blumenfeld OO, Sabo B, McCreary J", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" }, { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "6619126", "url": "https://glygen.org/publication/PubMed/6619126" } ] }, { "title": "Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Blumenfeld OO, Adamany AM, Puglia KV", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "6940143", "url": "https://glygen.org/publication/PubMed/6940143" } ] }, { "title": "Erythrocytes deficiency in glycophorin resist invasion by the malarial parasite Plasmodium falciparum.", "journal": "Nature", "date": "1982", "authors": "Pasvol G, Wainscoat J S, Weatherall D J", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "7040988", "url": "https://glygen.org/publication/PubMed/7040988" } ] }, { "title": "Structures of the asparagine-linked sugar chains of glycophorin A.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Yoshima H, Furthmayr H, Kobata A", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" }, { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "7430095", "url": "https://glygen.org/publication/PubMed/7430095" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Characterization of glycophorin A transcripts: control by the common erythroid-specific promoter and alternative usage of different polyadenylation signals.", "journal": "J. Biochem.", "date": "1994", "authors": "Kudo S, Onda M, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "7798177", "url": "https://glygen.org/publication/PubMed/7798177" } ] }, { "title": "Receptor and ligand domains for invasion of erythrocytes by Plasmodium falciparum.", "journal": "Science (New York, N.Y.)", "date": "1994-06-24", "authors": "Sim B K, Chitnis C E, Wasniowska K, Hadley T J, Miller L H", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "8009226", "url": "https://glygen.org/publication/PubMed/8009226" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "Alteration of splice site selection by an exon mutation in the human glycophorin A gene.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Huang CH, Reid M, Daniels G, Blumenfeld OO", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "8245024", "url": "https://glygen.org/publication/PubMed/8245024" } ] }, { "title": "Glycosylation sites identified by solid-phase Edman degradation: O-linked glycosylation motifs on human glycophorin A.", "journal": "Glycobiology", "date": "1993", "authors": "Pisano A, Redmond JW, Williams KL, Gooley AA", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724#ptm_processing" }, { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "8286855", "url": "https://glygen.org/publication/PubMed/8286855" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A.", "journal": "Carbohydrate research", "date": "1993", "authors": "Krotkiewski H, Lisowska E, Nilsson G, Gronberg G, Nilsson B", "evidence": [ { "database": "UniCarbKB", "id": "P02724", "url": "" }, { "database": "GlyConnect", "id": "187", "url": "https://glyconnect.expasy.org/browser/proteins/187" } ], "reference": [ { "type": "PubMed", "id": "8384526", "url": "https://glygen.org/publication/PubMed/8384526" } ] }, { "title": "Improved prediction for the structure of the dimeric transmembrane domain of glycophorin A obtained through global searching.", "journal": "Proteins", "date": "1996", "authors": "Adams P D, Engelman D M, Br\u00fcnger A T", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "8953647", "url": "https://glygen.org/publication/PubMed/8953647" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "A transmembrane helix dimer: structure and implications.", "journal": "Science", "date": "1997", "authors": "MacKenzie K R, Prestegard J H, Engelman D M", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "reference": [ { "type": "PubMed", "id": "9082985", "url": "https://glygen.org/publication/PubMed/9082985" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] } ], "pathway": [ { "id": "hsa:2993", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2993", "resource": "KEGG Pathway" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" } ], "orthologs": [ { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA", "length": 91 }, "evidence": [ { "id": "45933965", "url": "http://www.informatics.jax.org/homology/45933965", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P14220-1", "protein_name": "Glycophorin-A", "gene_name": "Gypa", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALVMILIILGVMAGIIGTILLISYCISRMTKKSSVDIQSPEGGDNSVPLSSIEQTPNEESSNV", "length": 168 }, "evidence": [ { "id": "45933965", "url": "http://www.informatics.jax.org/homology/45933965", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P15421-1", "protein_name": "Glycophorin-E", "gene_name": "GYPE", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIFEVMLVVVGMIILISYCIR", "length": 78 }, "evidence": [ { "id": "45933965", "url": "http://www.informatics.jax.org/homology/45933965", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" }, { "name": "ankyrin-1 complex", "id": "GO:0170014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0170014", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "glycophorin-A O-glycosylated 1 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052547", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052547" } ] }, { "name": "glycophorin-A O-glycosylated 2 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052548", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052548" } ] }, { "name": "glycophorin-A O-glycosylated 3 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052549", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052549" } ] }, { "name": "glycophorin-A O-glycosylated 4 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052550", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052550" } ] }, { "name": "glycophorin-A O-glycosylated 5 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052551", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052551" } ] }, { "name": "glycophorin-A O-glycosylated 6 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052552", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052552" } ] }, { "name": "glycophorin-A O-glycosylated 7 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052553", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052553" } ] }, { "name": "glycophorin-A O-glycosylated 8 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052554", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052554" } ] }, { "name": "glycophorin-A O-glycosylated 9 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052555", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052555" } ] }, { "name": "glycophorin-A O-glycosylated 10 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052556", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052556" } ] }, { "name": "glycophorin-A O-glycosylated 11 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-21 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-21, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052557", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052557" } ] }, { "name": "glycophorin-A O-glycosylated 12 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052558", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052558" } ] }, { "name": "glycophorin-A O-glycosylated 13 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052559", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052559" } ] }, { "name": "glycophorin-A O-glycosylated 14 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052560", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052560" } ] }, { "name": "glycophorin-A O-glycosylated 15 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052561", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052561" } ] }, { "name": "glycophorin-A O-glycosylated 16 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052562", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052562" } ] }, { "name": "glycophorin-A O-glycosylated 17 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052563", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052563" } ] }, { "name": "glycophorin-A O-glycosylated 18 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052564", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052564" } ] }, { "name": "glycophorin-A O-glycosylated 19 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052565", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052565" } ] }, { "name": "glycophorin-A O-glycosylated 20 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052566", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052566" } ] }, { "name": "glycophorin-A O-glycosylated 21 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052567", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052567" } ] }, { "name": "glycophorin-A O-glycosylated 22 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-30, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052568", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052568" } ] }, { "name": "glycophorin-A O-glycosylated 23 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052569", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052569" } ] }, { "name": "glycophorin-A O-glycosylated 24 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052570", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052570" } ] }, { "name": "glycophorin-A O-glycosylated 25 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052571", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052571" } ] }, { "name": "glycophorin-A O-glycosylated 26 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052572", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052572" } ] }, { "name": "glycophorin-A O-glycosylated 27 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052573", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052573" } ] }, { "name": "glycophorin-A O-glycosylated 28 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052574", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052574" } ] }, { "name": "glycophorin-A O-glycosylated 29 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052575", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052575" } ] }, { "name": "glycophorin-A O-glycosylated 30 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052576", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052576" } ] }, { "name": "glycophorin-A O-glycosylated 31 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052577", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052577" } ] }, { "name": "glycophorin-A O-glycosylated 32 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052578", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052578" } ] }, { "name": "glycophorin-A O-glycosylated 33 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-32, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052579", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052579" } ] }, { "name": "glycophorin-A O-glycosylated 34 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052580", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052580" } ] }, { "name": "glycophorin-A O-glycosylated 35 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052581", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052581" } ] }, { "name": "glycophorin-A O-glycosylated 36 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052582", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052582" } ] }, { "name": "glycophorin-A O-glycosylated 37 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052583", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052583" } ] }, { "name": "glycophorin-A O-glycosylated 38 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052584", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052584" } ] }, { "name": "glycophorin-A O-glycosylated 39 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052585", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052585" } ] }, { "name": "glycophorin-A O-glycosylated 40 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052586", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052586" } ] }, { "name": "glycophorin-A O-glycosylated 41 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052587", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052587" } ] }, { "name": "glycophorin-A O-glycosylated 42 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052588", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052588" } ] }, { "name": "glycophorin-A O-glycosylated 43 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052589", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052589" } ] }, { "name": "glycophorin-A O-glycosylated 44 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-38 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-38, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052590", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052590" } ] }, { "name": "glycophorin-A O-glycosylated 45 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052591", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052591" } ] }, { "name": "glycophorin-A O-glycosylated 46 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052592", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052592" } ] }, { "name": "glycophorin-A O-glycosylated 47 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052593", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052593" } ] }, { "name": "glycophorin-A O-glycosylated 48 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052594", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052594" } ] }, { "name": "glycophorin-A O-glycosylated 49 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052595", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052595" } ] }, { "name": "glycophorin-A O-glycosylated 50 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052596", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052596" } ] }, { "name": "glycophorin-A O-glycosylated 51 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052597", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052597" } ] }, { "name": "glycophorin-A O-glycosylated 52 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052598", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052598" } ] }, { "name": "glycophorin-A O-glycosylated 53 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052599", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052599" } ] }, { "name": "glycophorin-A O-glycosylated 54 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052600", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052600" } ] }, { "name": "glycophorin-A O-glycosylated 55 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-41 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-41, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052601", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052601" } ] }, { "name": "glycophorin-A O-glycosylated 56 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052602", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052602" } ] }, { "name": "glycophorin-A O-glycosylated 57 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052603", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052603" } ] }, { "name": "glycophorin-A O-glycosylated 58 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052604", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052604" } ] }, { "name": "glycophorin-A O-glycosylated 59 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052605", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052605" } ] }, { "name": "glycophorin-A O-glycosylated 60 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052606", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052606" } ] }, { "name": "glycophorin-A O-glycosylated 61 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052607", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052607" } ] }, { "name": "glycophorin-A O-glycosylated 62 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052608", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052608" } ] }, { "name": "glycophorin-A O-glycosylated 63 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052609", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052609" } ] }, { "name": "glycophorin-A O-glycosylated 64 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052610", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052610" } ] }, { "name": "glycophorin-A O-glycosylated 65 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052611", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052611" } ] }, { "name": "glycophorin-A O-glycosylated 66 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-63 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-63, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052612", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052612" } ] }, { "name": "glycophorin-A O-glycosylated 67 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052613", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052613" } ] }, { "name": "glycophorin-A O-glycosylated 68 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052614", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052614" } ] }, { "name": "glycophorin-A O-glycosylated 69 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052615", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052615" } ] }, { "name": "glycophorin-A O-glycosylated 70 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052616", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052616" } ] }, { "name": "glycophorin-A O-glycosylated 71 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052617", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052617" } ] }, { "name": "glycophorin-A O-glycosylated 72 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052618", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052618" } ] }, { "name": "glycophorin-A O-glycosylated 73 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052619", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052619" } ] }, { "name": "glycophorin-A O-glycosylated 74 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052620", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052620" } ] }, { "name": "glycophorin-A O-glycosylated 75 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052621", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052621" } ] }, { "name": "glycophorin-A O-glycosylated 76 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052622", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052622" } ] }, { "name": "glycophorin-A O-glycosylated 77 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Ser-66 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Ser-66, MOD:00002~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052623", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052623" } ] }, { "name": "glycophorin-A O-glycosylated 78 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052624", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052624" } ] }, { "name": "glycophorin-A O-glycosylated 79 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052625", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052625" } ] }, { "name": "glycophorin-A O-glycosylated 80 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052626", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052626" } ] }, { "name": "glycophorin-A O-glycosylated 81 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052627", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052627" } ] }, { "name": "glycophorin-A O-glycosylated 82 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052628", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052628" } ] }, { "name": "glycophorin-A O-glycosylated 83 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052629", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052629" } ] }, { "name": "glycophorin-A O-glycosylated 84 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052630", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052630" } ] }, { "name": "glycophorin-A O-glycosylated 85 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052631", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052631" } ] }, { "name": "glycophorin-A O-glycosylated 86 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052632", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052632" } ] }, { "name": "glycophorin-A O-glycosylated 87 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052633", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052633" } ] }, { "name": "glycophorin-A O-glycosylated 88 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-22, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052634", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052634" } ] }, { "name": "glycophorin-A O-glycosylated 89 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052635", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052635" } ] }, { "name": "glycophorin-A O-glycosylated 90 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052636", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052636" } ] }, { "name": "glycophorin-A O-glycosylated 91 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052637", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052637" } ] }, { "name": "glycophorin-A O-glycosylated 92 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052638", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052638" } ] }, { "name": "glycophorin-A O-glycosylated 93 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052639", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052639" } ] }, { "name": "glycophorin-A O-glycosylated 94 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052640", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052640" } ] }, { "name": "glycophorin-A O-glycosylated 95 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052641", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052641" } ] }, { "name": "glycophorin-A O-glycosylated 96 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052642", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052642" } ] }, { "name": "glycophorin-A O-glycosylated 97 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052643", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052643" } ] }, { "name": "glycophorin-A O-glycosylated 98 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052644", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052644" } ] }, { "name": "glycophorin-A O-glycosylated 99 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-23, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052645", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052645" } ] }, { "name": "glycophorin-A O-glycosylated 100 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052646", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052646" } ] }, { "name": "glycophorin-A O-glycosylated 101 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052647", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052647" } ] }, { "name": "glycophorin-A O-glycosylated 102 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052648", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052648" } ] }, { "name": "glycophorin-A O-glycosylated 103 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052649", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052649" } ] }, { "name": "glycophorin-A O-glycosylated 104 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052650", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052650" } ] }, { "name": "glycophorin-A O-glycosylated 105 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052651", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052651" } ] }, { "name": "glycophorin-A O-glycosylated 106 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052652", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052652" } ] }, { "name": "glycophorin-A O-glycosylated 107 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052653", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052653" } ] }, { "name": "glycophorin-A O-glycosylated 108 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052654", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052654" } ] }, { "name": "glycophorin-A O-glycosylated 109 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052655", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052655" } ] }, { "name": "glycophorin-A O-glycosylated 110 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-29, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052656", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052656" } ] }, { "name": "glycophorin-A O-glycosylated 111 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052657", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052657" } ] }, { "name": "glycophorin-A O-glycosylated 112 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052658", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052658" } ] }, { "name": "glycophorin-A O-glycosylated 113 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052659", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052659" } ] }, { "name": "glycophorin-A O-glycosylated 114 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052660", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052660" } ] }, { "name": "glycophorin-A O-glycosylated 115 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052661", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052661" } ] }, { "name": "glycophorin-A O-glycosylated 116 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052662", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052662" } ] }, { "name": "glycophorin-A O-glycosylated 117 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052663", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052663" } ] }, { "name": "glycophorin-A O-glycosylated 118 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052664", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052664" } ] }, { "name": "glycophorin-A O-glycosylated 119 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052665", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052665" } ] }, { "name": "glycophorin-A O-glycosylated 120 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052666", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052666" } ] }, { "name": "glycophorin-A O-glycosylated 121 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-31 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-31, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052667", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052667" } ] }, { "name": "glycophorin-A O-glycosylated 122 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052668", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052668" } ] }, { "name": "glycophorin-A O-glycosylated 123 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052669", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052669" } ] }, { "name": "glycophorin-A O-glycosylated 124 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052670", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052670" } ] }, { "name": "glycophorin-A O-glycosylated 125 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052671", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052671" } ] }, { "name": "glycophorin-A O-glycosylated 126 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052672", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052672" } ] }, { "name": "glycophorin-A O-glycosylated 127 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052673", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052673" } ] }, { "name": "glycophorin-A O-glycosylated 128 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052674", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052674" } ] }, { "name": "glycophorin-A O-glycosylated 129 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052675", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052675" } ] }, { "name": "glycophorin-A O-glycosylated 130 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052676", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052676" } ] }, { "name": "glycophorin-A O-glycosylated 131 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052677", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052677" } ] }, { "name": "glycophorin-A O-glycosylated 132 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-36, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052678", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052678" } ] }, { "name": "glycophorin-A O-glycosylated 133 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052679", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052679" } ] }, { "name": "glycophorin-A O-glycosylated 134 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052680", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052680" } ] }, { "name": "glycophorin-A O-glycosylated 135 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052681", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052681" } ] }, { "name": "glycophorin-A O-glycosylated 136 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052682", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052682" } ] }, { "name": "glycophorin-A O-glycosylated 137 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052683", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052683" } ] }, { "name": "glycophorin-A O-glycosylated 138 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052684", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052684" } ] }, { "name": "glycophorin-A O-glycosylated 139 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052685", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052685" } ] }, { "name": "glycophorin-A O-glycosylated 140 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052686", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052686" } ] }, { "name": "glycophorin-A O-glycosylated 141 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052687", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052687" } ] }, { "name": "glycophorin-A O-glycosylated 142 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052688", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052688" } ] }, { "name": "glycophorin-A O-glycosylated 143 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-44 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-44, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052689", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052689" } ] }, { "name": "glycophorin-A O-glycosylated 144 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052690", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052690" } ] }, { "name": "glycophorin-A O-glycosylated 145 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052691", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052691" } ] }, { "name": "glycophorin-A O-glycosylated 146 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052692", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052692" } ] }, { "name": "glycophorin-A O-glycosylated 147 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052693", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052693" } ] }, { "name": "glycophorin-A O-glycosylated 148 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052694", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052694" } ] }, { "name": "glycophorin-A O-glycosylated 149 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052695", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052695" } ] }, { "name": "glycophorin-A O-glycosylated 150 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052696", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052696" } ] }, { "name": "glycophorin-A O-glycosylated 151 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052697", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052697" } ] }, { "name": "glycophorin-A O-glycosylated 152 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052698", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052698" } ] }, { "name": "glycophorin-A O-glycosylated 153 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052699", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052699" } ] }, { "name": "glycophorin-A O-glycosylated 154 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-52 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-52, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052700", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052700" } ] }, { "name": "glycophorin-A O-glycosylated 155 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052701", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052701" } ] }, { "name": "glycophorin-A O-glycosylated 156 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052702", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052702" } ] }, { "name": "glycophorin-A O-glycosylated 157 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052703", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052703" } ] }, { "name": "glycophorin-A O-glycosylated 158 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052704", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052704" } ] }, { "name": "glycophorin-A O-glycosylated 159 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052705", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052705" } ] }, { "name": "glycophorin-A O-glycosylated 160 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052706", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052706" } ] }, { "name": "glycophorin-A O-glycosylated 161 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052707", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052707" } ] }, { "name": "glycophorin-A O-glycosylated 162 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052708", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052708" } ] }, { "name": "glycophorin-A O-glycosylated 163 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052709", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052709" } ] }, { "name": "glycophorin-A O-glycosylated 164 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052710", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052710" } ] }, { "name": "glycophorin-A O-glycosylated 165 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-56 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-56, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052711", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052711" } ] }, { "name": "glycophorin-A O-glycosylated 166 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052712", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052712" } ] }, { "name": "glycophorin-A O-glycosylated 167 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052713", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052713" } ] }, { "name": "glycophorin-A O-glycosylated 168 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G16370GQ. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G16370GQ. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052714", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052714" } ] }, { "name": "glycophorin-A O-glycosylated 169 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052715", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052715" } ] }, { "name": "glycophorin-A O-glycosylated 170 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G33350UC. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G33350UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052716", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052716" } ] }, { "name": "glycophorin-A O-glycosylated 171 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G42797SX. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G42797SX. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052717", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052717" } ] }, { "name": "glycophorin-A O-glycosylated 172 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052718", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052718" } ] }, { "name": "glycophorin-A O-glycosylated 173 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G47180UC. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G47180UC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052719", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052719" } ] }, { "name": "glycophorin-A O-glycosylated 174 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56245IE. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G56245IE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052720", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052720" } ] }, { "name": "glycophorin-A O-glycosylated 175 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052721", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052721" } ] }, { "name": "glycophorin-A O-glycosylated 176 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052722", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052722" } ] }, { "name": "glycophorin-A O-glycosylated 177 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94217FB. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G94217FB. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052723", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052723" } ] }, { "name": "glycophorin-A O-glycosylated 178 (human)", "definition": "A glycophorin-A (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:P02724-1, in which the glycan structure is represented by GlyTouCan:G94435QH. Example: UniProtKB:P02724-1, Thr-69, MOD:00005~GNO:G94435QH. [PRO:DNx, PMID:3514617, PMID:4091823, PMID:6190803, PMID:6619126, PMID:7430095, PMID:8384526]", "evidence": [ { "id": "PR:000052724", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052724" } ] } ], "site_annotation": [ { "start_pos": 45, "end_pos": 47, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "The major O-linked glycan are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH (about 78 %) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH (17 %). Minor O-glycans (5 %) include NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH NeuAc-alpha-(2-8)-NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH. About 1% of all O-linked glycans carry blood group A, B and H determinants. They derive from a type-2 precursor core structure, Gal-beta-(1,3)-GlcNAc-beta-1-R, and the antigens are synthesized by addition of fucose (H antigen-specific) and then N-acetylgalactosamine (A antigen-specific) or galactose (B antigen-specific). Specifically O-linked-glycans are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta-(3-1)-GalNAc-alpha (about 1%, B antigen-specific) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta (1 %, O antigen-, A antigen- and B antigen-specific).", "evidence": [ { "database": "UniProtKB", "id": "P02724", "url": "https://www.uniprot.org/uniprot/P02724" }, { "database": "PubMed", "id": "10912628", "url": "https://glygen.org/publication/PubMed/10912628" }, { "database": "PubMed", "id": "15313217", "url": "https://glygen.org/publication/PubMed/15313217" }, { "database": "PubMed", "id": "8286855", "url": "https://glygen.org/publication/PubMed/8286855" }, { "database": "PubMed", "id": "3624241", "url": "https://glygen.org/publication/PubMed/3624241" }, { "database": "PubMed", "id": "5350948", "url": "https://glygen.org/publication/PubMed/5350948" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 45 ], "o_linked_sites": [ 21, 22, 23, 29, 30, 31, 32, 36, 38, 41, 42, 44, 52, 56, 59, 63, 66, 69 ], "snv_sites": [ 16, 21, 22, 23, 30, 32, 36, 42, 44, 47, 52, 66, 69, 119 ], "glycation_sites": [], "phosphorylation_sites": [ 133, 138, 148 ], "sequon_annotation_sites": [ { "start_pos": 45, "end_pos": 47 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 232 }, { "field": "total_sites", "count": 19 }, { "field": "n_linked_glycans", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 26 }, { "field": "o_linked_glycan_sites", "count": 34 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 16 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 215 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 26 }, { "field": "o_linked_glycan_sites", "count": 18 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 14 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 14 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 117 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }