{ "uniprot_canonical_ac": "P01861-2", "uniprot_ac": "P01861", "uniprot_id": "IGHG4_HUMAN", "mass": { "chemical_mass": 43832.0, "monoisotopic_mass": 43832.0 }, "refseq": {}, "gene_names": [ { "name": "IGHG4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01861", "id": "P01861" } ], "protein_names": [ { "name": "Immunoglobulin heavy constant gamma 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01861" }, { "name": "Ig gamma-4 chain C region", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01861" } ], "function": [ { "annotation": "Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268).", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861#function" }, { "database": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" }, { "database": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" }, { "database": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs587753186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587753186" }, { "id": "rs587753186", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs587753186" }, { "id": "rs587753186", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587753186" }, { "id": "rs587753186", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs587753186" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 90, "end_pos": 90, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNT->NNT); o-glyco-site-loss (S->N).", "chr_id": "14", "chr_pos": "105625798", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S90", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767000787", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767000787" }, { "id": "rs767000787", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767000787" }, { "id": "rs767000787", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767000787#frequency_tab" }, { "id": "rs767000787", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767000787" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 100, "end_pos": 100, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "14", "chr_pos": "105625376", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S100", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767000787", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767000787" }, { "id": "rs767000787", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767000787" }, { "id": "rs767000787", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767000787#frequency_tab" }, { "id": "rs767000787", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767000787" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 100, "end_pos": 100, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "14", "chr_pos": "105625376", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S100", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs139754373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139754373" }, { "id": "rs139754373", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs139754373" }, { "id": "rs139754373", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139754373" }, { "id": "rs139754373", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139754373#frequency_tab" }, { "id": "rs139754373", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139754373" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 100, "end_pos": 100, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "14", "chr_pos": "105625377", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.009185", "site_lbl": "S100", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774995496", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774995496" }, { "id": "rs774995496", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774995496" }, { "id": "rs774995496", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774995496#frequency_tab" }, { "id": "rs774995496", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774995496" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 145, "end_pos": 145, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVS->NVS).", "chr_id": "14", "chr_pos": "105625124", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201037000", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201037000" }, { "id": "rs201037000", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201037000" }, { "id": "rs201037000", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201037000#frequency_tab" }, { "id": "rs201037000", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201037000" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 179, "end_pos": 179, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSM).", "chr_id": "14", "chr_pos": "105625021", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T179", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201037000", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201037000" }, { "id": "rs201037000", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201037000#frequency_tab" }, { "id": "rs201037000", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201037000" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 179, "end_pos": 179, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSR).", "chr_id": "14", "chr_pos": "105625021", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T179", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs587621643", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587621643" }, { "id": "rs587621643", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs587621643" }, { "id": "rs587621643", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587621643" }, { "id": "rs587621643", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs587621643" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 215, "end_pos": 215, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TIS->NIS).", "chr_id": "14", "chr_pos": "105624913", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "T215", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs375640130", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375640130" }, { "id": "rs375640130", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375640130" }, { "id": "rs375640130", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375640130#frequency_tab" }, { "id": "rs375640130", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375640130" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 272, "end_pos": 272, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KTT->NTT).", "chr_id": "14", "chr_pos": "105624644", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K272", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781648835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781648835" }, { "id": "rs781648835", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781648835" }, { "id": "rs781648835", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781648835#frequency_tab" }, { "id": "rs781648835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781648835" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 281, "end_pos": 281, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGS->NGS).", "chr_id": "14", "chr_pos": "105624619", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D281", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1187954921", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1187954921" }, { "id": "rs1187954921", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1187954921#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 293, "end_pos": 293, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DKS->NKS).", "chr_id": "14", "chr_pos": "105624583", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs587702784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587702784" }, { "id": "rs587702784", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs587702784" }, { "id": "rs587702784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587702784" }, { "id": "rs587702784", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs587702784#frequency_tab" }, { "id": "rs587702784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs587702784" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 320, "end_pos": 320, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLS->NLS).", "chr_id": "14", "chr_pos": "105624501", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "S320", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1219519694", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1219519694" }, { "id": "rs1219519694", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1219519694#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 362, "end_pos": 362, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAT->NAT).", "chr_id": "14", "chr_pos": "105623090", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S362", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201574915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201574915" }, { "id": "rs201574915", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201574915" }, { "id": "rs201574915", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201574915" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 74, "end_pos": 74, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "14", "chr_pos": "105625846", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S74", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201574915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201574915" }, { "id": "rs201574915", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201574915" }, { "id": "rs201574915", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201574915" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 74, "end_pos": 74, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "14", "chr_pos": "105625846", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S74", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1298545590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1298545590" }, { "id": "rs1298545590", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1298545590" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 74, "end_pos": 74, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "14", "chr_pos": "105625845", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S74", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754423745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754423745" }, { "id": "rs754423745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754423745" }, { "id": "rs754423745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754423745#frequency_tab" }, { "id": "rs754423745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754423745" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 75, "end_pos": 75, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "14", "chr_pos": "105625844", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S75", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1358492082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358492082" }, { "id": "rs1358492082", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358492082" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 75, "end_pos": 75, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "14", "chr_pos": "105625843", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S75", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1358492082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358492082" }, { "id": "rs1358492082", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358492082" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 75, "end_pos": 75, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "14", "chr_pos": "105625843", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S75", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1480402082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1480402082" }, { "id": "rs1480402082", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1480402082" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 75, "end_pos": 75, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "14", "chr_pos": "105625842", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S75", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780047408", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780047408" }, { "id": "rs780047408", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780047408" }, { "id": "rs780047408", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780047408" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 90, "end_pos": 90, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "14", "chr_pos": "105625799", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S90", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "82.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "90.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "72.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "66.04", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "80.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "82.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "65.32", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "67.56", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01861", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01861" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "common_name": "Human" } ], "gene": [ { "name": "IGHG4", "url": "https://www.uniprot.org/uniprot/P01861", "locus": { "chromosome": "14", "start_pos": 105620506, "end_pos": 105626066, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000211892", "url": "https://www.ensembl.org/id/ENSG00000211892" } ] } } ], "crossref": [ { "id": "ENSG00000211892", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211892", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05768", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05768", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21817", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21817", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IGHG4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHG4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "5528", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5528", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01861", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01861*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003597", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003597", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "147130", "url": "http://www.omim.org/entry/147130", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01861", "url": "https://www.nextprot.org/entry/NX_P01861", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01861", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CIVIHEA", "url": "https://omabrowser.org/oma/group/CIVIHEA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23411", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23411", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23411:SF39", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23411:SF39", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1ADQ", "url": "https://www.rcsb.org/structure/1ADQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BBJ", "url": "https://www.rcsb.org/structure/1BBJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FL5", "url": "https://www.rcsb.org/structure/2FL5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EO1", "url": "https://www.rcsb.org/structure/3EO1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4B53", "url": "https://www.rcsb.org/structure/4B53", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4C54", "url": "https://www.rcsb.org/structure/4C54", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4C55", "url": "https://www.rcsb.org/structure/4C55", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4D2N", "url": "https://www.rcsb.org/structure/4D2N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HVW", "url": "https://www.rcsb.org/structure/5HVW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LG1", "url": "https://www.rcsb.org/structure/5LG1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W5M", "url": "https://www.rcsb.org/structure/5W5M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W5N", "url": "https://www.rcsb.org/structure/5W5N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WIB", "url": "https://www.rcsb.org/structure/6WIB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WMH", "url": "https://www.rcsb.org/structure/6WMH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WNA", "url": "https://www.rcsb.org/structure/6WNA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WOL", "url": "https://www.rcsb.org/structure/6WOL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07654", "url": "http://pfam.xfam.org/family/PF07654", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01861", "url": "https://pharos.nih.gov/targets/P01861", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052161", "url": "https://proconsortium.org/app/entry/PR:000052161", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052162", "url": "https://proconsortium.org/app/entry/PR:000052162", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052163", "url": "https://proconsortium.org/app/entry/PR:000052163", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052164", "url": "https://proconsortium.org/app/entry/PR:000052164", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052165", "url": "https://proconsortium.org/app/entry/PR:000052165", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052166", "url": "https://proconsortium.org/app/entry/PR:000052166", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052167", "url": "https://proconsortium.org/app/entry/PR:000052167", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052168", "url": "https://proconsortium.org/app/entry/PR:000052168", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052169", "url": "https://proconsortium.org/app/entry/PR:000052169", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052170", "url": "https://proconsortium.org/app/entry/PR:000052170", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052171", "url": "https://proconsortium.org/app/entry/PR:000052171", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052172", "url": "https://proconsortium.org/app/entry/PR:000052172", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052173", "url": "https://proconsortium.org/app/entry/PR:000052173", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052174", "url": "https://proconsortium.org/app/entry/PR:000052174", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052175", "url": "https://proconsortium.org/app/entry/PR:000052175", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052176", "url": "https://proconsortium.org/app/entry/PR:000052176", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052177", "url": "https://proconsortium.org/app/entry/PR:000052177", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052178", "url": "https://proconsortium.org/app/entry/PR:000052178", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052179", "url": "https://proconsortium.org/app/entry/PR:000052179", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052180", "url": "https://proconsortium.org/app/entry/PR:000052180", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052181", "url": "https://proconsortium.org/app/entry/PR:000052181", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052182", "url": "https://proconsortium.org/app/entry/PR:000052182", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052183", "url": "https://proconsortium.org/app/entry/PR:000052183", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052184", "url": "https://proconsortium.org/app/entry/PR:000052184", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052185", "url": "https://proconsortium.org/app/entry/PR:000052185", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052186", "url": "https://proconsortium.org/app/entry/PR:000052186", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052187", "url": "https://proconsortium.org/app/entry/PR:000052187", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052188", "url": "https://proconsortium.org/app/entry/PR:000052188", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052189", "url": "https://proconsortium.org/app/entry/PR:000052189", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052190", "url": "https://proconsortium.org/app/entry/PR:000052190", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052191", "url": "https://proconsortium.org/app/entry/PR:000052191", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052192", "url": "https://proconsortium.org/app/entry/PR:000052192", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052193", "url": "https://proconsortium.org/app/entry/PR:000052193", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052194", "url": "https://proconsortium.org/app/entry/PR:000052194", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052195", "url": "https://proconsortium.org/app/entry/PR:000052195", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052196", "url": "https://proconsortium.org/app/entry/PR:000052196", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01861", "url": "http://purl.obolibrary.org/obo/PR_P01861", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9664422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "P01861", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01861-1", "url": "https://www.uniprot.org/uniprot/P01861-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01861-2", "url": "https://www.uniprot.org/uniprot/P01861-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIVPDYRNMIRQGA", "length": 396, "header": "sp|P01861-2|IGHG4_HUMAN Isoform 2 of Immunoglobulin heavy constant gamma 4 OS=Homo sapiens OX=9606 GN=IGHG4 PE=1 SV=2 CANONICAL=P01861-2" }, "isoforms": [ { "isoform_ac": "P01861-1", "url": "", "sequence": { "sequence": "ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK", "length": 327, "header": "sp|P01861-1|IGHG4_HUMAN Isoform 1 of Immunoglobulin heavy constant gamma 4 OS=Homo sapiens OX=9606 GN=IGHG4 PE=1 SV=2 CANONICAL=P01861-2" }, "locus": { "chromosome": "14", "start_pos": 105626066, "end_pos": 105624479, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000390543.3", "url": "https://www.ensembl.org/id/ENST00000390543.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000374985.2", "url": "https://www.ensembl.org/id/ENSP00000374985.2" } ] } }, { "isoform_ac": "P01861-2", "url": "", "sequence": { "sequence": "ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIVPDYRNMIRQGA", "length": 396, "header": "sp|P01861-2|IGHG4_HUMAN Isoform 2 of Immunoglobulin heavy constant gamma 4 OS=Homo sapiens OX=9606 GN=IGHG4 PE=1 SV=2 CANONICAL=P01861-2" }, "locus": { "chromosome": "14", "start_pos": 105626066, "end_pos": 105621915, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000641978.1", "url": "https://www.ensembl.org/id/ENST00000641978.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000493388.1", "url": "https://www.ensembl.org/id/ENSP00000493388.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 100, "start_aa": "Ser", "end_pos": 100, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser100", "evidence": [ { "id": "P01861", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 15, "start_aa": "Ser", "end_pos": 15, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser15", "evidence": [ { "id": "P01861", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10339FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G16175ZV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G27919IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "glytoucan_ac": "G30159WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G40792UP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G47748JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G49284IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29992770" } ] }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G51287LK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G58667NI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G61855PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G71013KY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "glytoucan_ac": "G82053YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G85767HW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G86500WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ] }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01861#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "11406581", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11406581" }, { "id": "20357243", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20357243" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 74, "start_aa": "Ser", "end_pos": 74, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser74", "evidence": [ { "id": "P01861", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 75, "start_aa": "Ser", "end_pos": 75, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser75", "evidence": [ { "id": "P01861", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 90, "start_aa": "Ser", "end_pos": 90, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser90", "evidence": [ { "id": "P01861", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G03127AL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G05642HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G05850WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G07483YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G11535IB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G12708JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G27919IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G30159WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G33780DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G34730YF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" } ] }, { "glytoucan_ac": "G36836GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G39943KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G43157UW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G50636SI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" } ] }, { "glytoucan_ac": "G52934AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G56903ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G58667NI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G59471TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G61627IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G62831KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G65219TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G66937TJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G71013KY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G72718TT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" } ] }, { "glytoucan_ac": "G72956NR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G81282CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "glytoucan_ac": "G81413UE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G83355KE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "1639758", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1639758" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "10574203", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10574203" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G85767HW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G89319AW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" } ] }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7540366" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2138613", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2138613" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12652077" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "glytoucan_ac": "G92129PT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2363690" }, { "id": "23382691", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25685702" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "The interaction between N-WASP and the Arp2/3 complex links Cdc42-dependent signals to actin assembly.", "journal": "Cell", "date": "1999", "authors": "Rohatgi R, Ma L, Miki H, Lopez M, Kirchhausen T, Takenawa T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10219243", "url": "https://glygen.org/publication/PubMed/10219243" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Phospholipases and phagocytosis: the role of phospholipid-derived second messengers in phagocytosis.", "journal": "The international journal of biochemistry & cell biology", "date": "1999", "authors": "Lennartz MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "10224668", "url": "https://glygen.org/publication/PubMed/10224668" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Localization of p21-activated kinase 1 (PAK1) to pseudopodia, membrane ruffles, and phagocytic cups in activated human neutrophils.", "journal": "Journal of leukocyte biology", "date": "1999", "authors": "Dharmawardhane S, Brownson D, Lennartz M, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10496324", "url": "https://glygen.org/publication/PubMed/10496324" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "10531307", "url": "https://glygen.org/publication/PubMed/10531307" } ] }, { "title": "Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.", "journal": "Nature cell biology", "date": "1999", "authors": "Edwards DC, Sanders LC, Bokoch GM, Gill GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10559936", "url": "https://glygen.org/publication/PubMed/10559936" } ] }, { "title": "Carbohydrate release from picomole quantities of glycoprotein and characterisation of glycans by high-performance liquid chromatography and mass spectrometry.", "journal": "Journal of chromatography. B, Biomedical sciences and applications", "date": "1999", "authors": "Charlwood J, Birrell H, Camilleri P", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "10574203", "url": "https://glygen.org/publication/PubMed/10574203" } ] }, { "title": "Phospholipase C-gamma as a signal-transducing element.", "journal": "Experimental cell research", "date": "1999", "authors": "Carpenter G, Ji Qs", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "10579907", "url": "https://glygen.org/publication/PubMed/10579907" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1067618", "url": "https://glygen.org/publication/PubMed/1067618" } ] }, { "title": "Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.", "journal": "Nature", "date": "2000", "authors": "Kim AS, Kakalis LT, Abdul-Manan N, Liu GA, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10724160", "url": "https://glygen.org/publication/PubMed/10724160" } ] }, { "title": "GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Carlier MF, Nioche P, Broutin-L'Hermite I, Boujemaa R, Le Clainche C, Egile C, Garbay C, Ducruix A, Sansonetti P, Pantaloni D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10781580", "url": "https://glygen.org/publication/PubMed/10781580" } ] }, { "title": "Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Suzuki T, Kono H, Hirose N, Okada M, Yamamoto T, Yamamoto K, Honda Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "10861086", "url": "https://glygen.org/publication/PubMed/10861086" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "A complex of N-WASP and WIP integrates signalling cascades that lead to actin polymerization.", "journal": "Nature cell biology", "date": "2000", "authors": "Moreau V, Frischknecht F, Reckmann I, Vincentelli R, Rabut G, Stewart D, Way M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10878810", "url": "https://glygen.org/publication/PubMed/10878810" } ] }, { "title": "Distinct pathways of mannan-binding lectin (MBL)- and C1-complex autoactivation revealed by reconstitution of MBL with recombinant MBL-associated serine protease-2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Vorup-Jensen T, Petersen SV, Hansen AG, Poulsen K, Schwaeble W, Sim RB, Reid KB, Davis SJ, Thiel S, Jensenius JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "10925294", "url": "https://glygen.org/publication/PubMed/10925294" } ] }, { "title": "Activation by Cdc42 and PIP(2) of Wiskott-Aldrich syndrome protein (WASp) stimulates actin nucleation by Arp2/3 complex.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10995437", "url": "https://glygen.org/publication/PubMed/10995437" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Fukuoka M, Suetsugu S, Miki H, Fukami K, Endo T, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11157975", "url": "https://glygen.org/publication/PubMed/11157975" } ] }, { "title": "The Arp2/3 complex nucleates actin filament branches from the sides of pre-existing filaments.", "journal": "Nature cell biology", "date": "2001", "authors": "Amann KJ, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11231582", "url": "https://glygen.org/publication/PubMed/11231582" } ] }, { "title": "Phosphorylation of cofilin by LIM-kinase is necessary for semaphorin 3A-induced growth cone collapse.", "journal": "Nature neuroscience", "date": "2001", "authors": "Aizawa H, Wakatsuki S, Ishii A, Moriyama K, Sasaki Y, Ohashi K, Sekine-Aizawa Y, Sehara-Fujisawa A, Mizuno K, Goshima Y, Yahara I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11276226", "url": "https://glygen.org/publication/PubMed/11276226" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "WASP and WAVE family proteins: key molecules for rapid rearrangement of cortical actin filaments and cell movement.", "journal": "Journal of cell science", "date": "2001", "authors": "Takenawa T, Miki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11329366", "url": "https://glygen.org/publication/PubMed/11329366" } ] }, { "title": "Nck and phosphatidylinositol 4,5-bisphosphate synergistically activate actin polymerization through the N-WASP-Arp2/3 pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rohatgi R, Nollau P, Ho HY, Kirschner MW, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11340081", "url": "https://glygen.org/publication/PubMed/11340081" } ] }, { "title": "Nomenclature of the human immunoglobulin heavy (IGH) genes.", "journal": "Exp. Clin. Immunogenet.", "date": "2001", "authors": "Lefranc M P", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "11340299", "url": "https://glygen.org/publication/PubMed/11340299" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "EndoS, a novel secreted protein from Streptococcus pyogenes with endoglycosidase activity on human IgG.", "journal": "The EMBO journal", "date": "2001", "authors": "Collin M, Olsen A", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861#ptm_processing" }, { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "11406581", "url": "https://glygen.org/publication/PubMed/11406581" } ] }, { "title": "Restricted accumulation of phosphatidylinositol 3-kinase products in a plasmalemmal subdomain during Fc gamma receptor-mediated phagocytosis.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Marshall JG, Booth JW, Stambolic V, Mak T, Balla T, Schreiber AD, Meyer T, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "11425868", "url": "https://glygen.org/publication/PubMed/11425868" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "CR16 forms a complex with N-WASP in brain and is a novel member of a conserved proline-rich actin-binding protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Ho HY, Rohatgi R, Ma L, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11553796", "url": "https://glygen.org/publication/PubMed/11553796" } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11694537", "url": "https://glygen.org/publication/PubMed/11694537" } ] }, { "title": "Different WASP family proteins stimulate different Arp2/3 complex-dependent actin-nucleating activities.", "journal": "Current biology : CB", "date": "2001", "authors": "Zalevsky J, Lempert L, Kranitz H, Mullins RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11747816", "url": "https://glygen.org/publication/PubMed/11747816" } ] }, { "title": "Protein kinase C: structural and spatial regulation by phosphorylation, cofactors, and macromolecular interactions.", "journal": "Chemical reviews", "date": "2001", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "11749377", "url": "https://glygen.org/publication/PubMed/11749377" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "WICH, a novel verprolin homology domain-containing protein that functions cooperatively with N-WASP in actin-microspike formation.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Kato M, Miki H, Kurita S, Endo T, Nakagawa H, Miyamoto S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11829459", "url": "https://glygen.org/publication/PubMed/11829459" } ] }, { "title": "Dynamics of cytoskeletal proteins during Fcgamma receptor-mediated phagocytosis in macrophages.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Diakonova M, Bokoch G, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11854399", "url": "https://glygen.org/publication/PubMed/11854399" } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11939578", "url": "https://glygen.org/publication/PubMed/11939578" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "12055245", "url": "https://glygen.org/publication/PubMed/12055245" } ] }, { "title": "Myosin X is a downstream effector of PI(3)K during phagocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Cox D, Berg JS, Cammer M, Chinegwundoh JO, Dale BM, Cheney RE, Greenberg S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12055636", "url": "https://glygen.org/publication/PubMed/12055636" } ] }, { "title": "May the force be with you: Myosin-X in phagocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12105426", "url": "https://glygen.org/publication/PubMed/12105426" } ] }, { "title": "Opsonization modulates Rac-1 activation during cell entry by Leishmania amazonensis.", "journal": "Infection and immunity", "date": "2002", "authors": "Morehead J, Coppens I, Andrews NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12117970", "url": "https://glygen.org/publication/PubMed/12117970" } ] }, { "title": "Rapid association of cytoskeletal remodeling proteins with the developing phagosomes of human neutrophils.", "journal": "Histochemistry and cell biology", "date": "2002", "authors": "Robinson JM, Badwey JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12189515", "url": "https://glygen.org/publication/PubMed/12189515" } ] }, { "title": "The WASP-binding protein WIRE has a role in the regulation of the actin filament system downstream of the platelet-derived growth factor receptor.", "journal": "Experimental cell research", "date": "2002", "authors": "Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12213210", "url": "https://glygen.org/publication/PubMed/12213210" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Phosphorylation of tyrosine 291 enhances the ability of WASp to stimulate actin polymerization and filopodium formation. Wiskott-Aldrich Syndrome protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cory GO, Garg R, Cramer R, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12235133", "url": "https://glygen.org/publication/PubMed/12235133" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "The biological functions of MBL-associated serine proteases (MASPs).", "journal": "Immunobiology", "date": "2002", "authors": "Hajela K, Kojima M, Ambrus G, Wong KH, Moffatt BE, Ferluga J, Hajela S, Gal P, Sim RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "12396008", "url": "https://glygen.org/publication/PubMed/12396008" } ] }, { "title": "Phosphorylation of Tyr342 in the linker region of Syk is critical for Fc epsilon RI signaling in mast cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Zhang J, Berenstein E, Siraganian RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12417718", "url": "https://glygen.org/publication/PubMed/12417718" } ] }, { "title": "Activation of C1r by proteolytic cleavage.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Ziccardi RJ, Cooper NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623" } ], "reference": [ { "type": "PubMed", "id": "1249422", "url": "https://glygen.org/publication/PubMed/1249422" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome.", "journal": "Glycoconjugate journal", "date": "2002", "authors": "Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "12652077", "url": "https://glygen.org/publication/PubMed/12652077" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "ATP hydrolysis on actin-related protein 2/3 complex causes debranching of dendritic actin arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Le Clainche C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12743368", "url": "https://glygen.org/publication/PubMed/12743368" } ] }, { "title": "Interleukin-10 therapy--review of a new approach.", "journal": "Pharmacological reviews", "date": "2003", "authors": "Asadullah K, Sterry W, Volk HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12773629", "url": "https://glygen.org/publication/PubMed/12773629" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Class I phosphoinositide 3-kinase p110beta is required for apoptotic cell and Fcgamma receptor-mediated phagocytosis by macrophages.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Leverrier Y, Okkenhaug K, Sawyer C, Bilancio A, Vanhaesebroeck B, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "12869549", "url": "https://glygen.org/publication/PubMed/12869549" } ] }, { "title": "Signal transduction by Fc gamma RIII (CD16) is mediated through the gamma chain.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Wirthmueller U, Kurosaki T, Murakami MS, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "1314888", "url": "https://glygen.org/publication/PubMed/1314888" } ] }, { "title": "Activation of Fc gamma RII induces tyrosine phosphorylation of multiple proteins including Fc gamma RII.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Huang MM, Indik Z, Brass LF, Hoxie JA, Schreiber AD, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "1372004", "url": "https://glygen.org/publication/PubMed/1372004" } ] }, { "title": "Factor I-dependent inactivation of human complement C4b of the classical pathway by C3b/C4b receptor (CR1, CD35) and membrane cofactor protein (MCP, CD46).", "journal": "Journal of biochemistry", "date": "1992", "authors": "Masaki T, Matsumoto M, Nakanishi I, Yasuda R, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1386357", "url": "https://glygen.org/publication/PubMed/1386357" } ] }, { "title": "C'1 ESTERASE EFFECT ON ACTIVITY AND PHYSICOCHEMICAL PROPERTIES OF THE FOURTH COMPONENT OF COMPLEMENT.", "journal": "The Journal of experimental medicine", "date": "1965", "authors": "MUELLER-EBERHARD HJ, LEPOW IH", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "14280442", "url": "https://glygen.org/publication/PubMed/14280442" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Focal adhesion kinase regulation of N-WASP subcellular localization and function.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wu X, Suetsugu S, Cooper LA, Takenawa T, Guan JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "14676198", "url": "https://glygen.org/publication/PubMed/14676198" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Fcgamma RI-triggered generation of arachidonic acid and eicosanoids requires iPLA2 but not cPLA2 in human monocytic cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tay HK, Melendez AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15007079", "url": "https://glygen.org/publication/PubMed/15007079" } ] }, { "title": "Signalling to actin assembly via the WASP (Wiskott-Aldrich syndrome protein)-family proteins and the Arp2/3 complex.", "journal": "The Biochemical journal", "date": "2004", "authors": "Millard TH, Sharp SJ, Machesky LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15040784", "url": "https://glygen.org/publication/PubMed/15040784" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "Mechanism of tyrosine phosphorylation and activation of phospholipase C-gamma 1. Tyrosine 783 phosphorylation is not sufficient for lipase activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sekiya F, Poulin B, Kim YJ, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15161916", "url": "https://glygen.org/publication/PubMed/15161916" } ] }, { "title": "The lectin-complement pathway--its role in innate immunity and evolution.", "journal": "Immunological reviews", "date": "2004", "authors": "Fujita T, Matsushita M, Endo Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "15199963", "url": "https://glygen.org/publication/PubMed/15199963" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Phospholipases D1 and D2 coordinately regulate macrophage phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Iyer SS, Barton JA, Bourgoin S, Kusner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15294978", "url": "https://glygen.org/publication/PubMed/15294978" } ] }, { "title": "Regulation of WASP/WAVE proteins: making a long story short.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bompard G, Caron E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15452139", "url": "https://glygen.org/publication/PubMed/15452139" } ] }, { "title": "Molecular basis for a direct interaction between the Syk protein-tyrosine kinase and phosphoinositide 3-kinase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Moon KD, Post CB, Durden DL, Zhou Q, De P, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15536084", "url": "https://glygen.org/publication/PubMed/15536084" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Abelson-interactor-1 promotes WAVE2 membrane translocation and Abelson-mediated tyrosine phosphorylation required for WAVE2 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Leng Y, Zhang J, Badour K, Arpaia E, Freeman S, Cheung P, Siu M, Siminovitch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15657136", "url": "https://glygen.org/publication/PubMed/15657136" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Phosphatidylinositol-4,5-bisphosphate hydrolysis directs actin remodeling during phagocytosis.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Scott CC, Dobson W, Botelho RJ, Coady-Osberg N, Chavrier P, Knecht DA, Heath C, Stahl P, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15809313", "url": "https://glygen.org/publication/PubMed/15809313" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Control of infection with Leishmania major in susceptible BALB/c mice lacking the common gamma-chain for FcR is associated with reduced production of IL-10 and TGF-beta by parasitized cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Padigel UM, Farrell JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "15879134", "url": "https://glygen.org/publication/PubMed/15879134" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Insights into the human CD59 complement binding interface toward engineering new therapeutics.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Huang Y, Smith CA, Song H, Morgan BP, Abagyan R, Tomlinson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16079145", "url": "https://glygen.org/publication/PubMed/16079145" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Binding of complement factor H to endothelial cells is mediated by the carboxy-terminal glycosaminoglycan binding site.", "journal": "The American journal of pathology", "date": "2005", "authors": "Jokiranta TS, Cheng ZZ, Seeberger H, Jozsi M, Heinen S, Noris M, Remuzzi G, Ormsby R, Gordon DL, Meri S, Hellwage J, Zipfel PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16192651", "url": "https://glygen.org/publication/PubMed/16192651" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Mechanism of filament nucleation and branch stability revealed by the structure of the Arp2/3 complex at actin branch junctions.", "journal": "PLoS biology", "date": "2005", "authors": "Egile C, Rouiller I, Xu XP, Volkmann N, Li R, Hanein D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16262445", "url": "https://glygen.org/publication/PubMed/16262445" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis.", "journal": "Journal of biochemistry", "date": "1992", "authors": "Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "1639758", "url": "https://glygen.org/publication/PubMed/1639758" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Dynamics and function of phospholipase D and phosphatidic acid during phagocytosis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Corrotte M, Chasserot-Golaz S, Huang P, Du G, Ktistakis NT, Frohman MA, Vitale N, Bader MF, Grant NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "16497229", "url": "https://glygen.org/publication/PubMed/16497229" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Requirements for Vav guanine nucleotide exchange factors and Rho GTPases in FcgammaR- and complement-mediated phagocytosis.", "journal": "Immunity", "date": "2006", "authors": "Hall AB, Gakidis MA, Glogauer M, Wilsbacher JL, Gao S, Swat W, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16546099", "url": "https://glygen.org/publication/PubMed/16546099" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Hsp90 increases LIM kinase activity by promoting its homo-dimerization.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Li R, Soosairajah J, Harari D, Citri A, Price J, Ng HL, Morton CJ, Parker MW, Yarden Y, Bernard O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16641196", "url": "https://glygen.org/publication/PubMed/16641196" } ] }, { "title": "PKD at the crossroads of DAG and PKC signaling.", "journal": "Trends in pharmacological sciences", "date": "2006", "authors": "Wang QJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "16678913", "url": "https://glygen.org/publication/PubMed/16678913" } ] }, { "title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16702231", "url": "https://glygen.org/publication/PubMed/16702231" } ] }, { "title": "Arp2/3 ATP hydrolysis: to branch or to debranch?", "journal": "Nature cell biology", "date": "2006", "authors": "Kovar DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16880808", "url": "https://glygen.org/publication/PubMed/16880808" } ] }, { "title": "Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Huang ZY, Barreda DR, Worth RG, Indik ZK, Kim MK, Chien P, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "16921024", "url": "https://glygen.org/publication/PubMed/16921024" } ] }, { "title": "Levels of expression of complement regulatory proteins CD46, CD55 and CD59 on resting and activated human peripheral blood leucocytes.", "journal": "Immunology", "date": "2006", "authors": "Christmas SE, de la Mata Espinosa CT, Halliday D, Buxton CA, Cummerson JA, Johnson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16999828", "url": "https://glygen.org/publication/PubMed/16999828" } ] }, { "title": "Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Harris CL, Pettigrew DM, Lea SM, Morgan BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17182573", "url": "https://glygen.org/publication/PubMed/17182573" } ] }, { "title": "Lim kinases, regulators of actin dynamics.", "journal": "The international journal of biochemistry & cell biology", "date": "2007", "authors": "Bernard O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17188549", "url": "https://glygen.org/publication/PubMed/17188549" } ] }, { "title": "Effect of WAVE2 phosphorylation on activation of the Arp2/3 complex.", "journal": "Journal of biochemistry", "date": "2007", "authors": "Nakanishi O, Suetsugu S, Yamazaki D, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17202194", "url": "https://glygen.org/publication/PubMed/17202194" } ] }, { "title": "Role of CrkII in Fcgamma receptor-mediated phagocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee WL, Cosio G, Ireton K, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17308335", "url": "https://glygen.org/publication/PubMed/17308335" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2007", "authors": "Huang Y, Fedarovich A, Tomlinson S, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17505110", "url": "https://glygen.org/publication/PubMed/17505110" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Immunoglobulin somatic hypermutation.", "journal": "Annual review of genetics", "date": "2007", "authors": "Teng Grace, Papavasiliou F Nina", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" } ] }, { "title": "Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase.", "journal": "Gene", "date": "2007", "authors": "Takeuchi M, Harigai M, Momohara S, Ball E, Abe J, Furuichi K, Kamatani N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "17590538", "url": "https://glygen.org/publication/PubMed/17590538" } ] }, { "title": "FcgammaRIII mediates immunoglobulin G-induced interleukin-10 and is required for chronic Leishmania mexicana lesions.", "journal": "Infection and immunity", "date": "2008", "authors": "Thomas BN, Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "18070890", "url": "https://glygen.org/publication/PubMed/18070890" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Regulation of actin assembly associated with protrusion and adhesion in cell migration.", "journal": "Physiological reviews", "date": "2008", "authors": "Le Clainche C, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "18391171", "url": "https://glygen.org/publication/PubMed/18391171" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry.", "journal": "Journal of chromatography. B, Analytical technologies in the biomedical and life sciences", "date": "2008", "authors": "Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T", "evidence": [ { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Molecular mechanism of the Syk activation switch.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tsang E, Giannetti AM, Shaw D, Dinh M, Tse JK, Gandhi S, Ho H, Wang S, Papp E, Bradshaw JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "18818202", "url": "https://glygen.org/publication/PubMed/18818202" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861#ptm_processing" }, { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861#ptm_processing" }, { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "Cdc42 regulates Fc gamma receptor-mediated phagocytosis through the activation and phosphorylation of Wiskott-Aldrich syndrome protein (WASP) and neural-WASP.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Park H, Cox D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "19741094", "url": "https://glygen.org/publication/PubMed/19741094" } ] }, { "title": "A Cdc42 activation cycle coordinated by PI 3-kinase during Fc receptor-mediated phagocytosis.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Beemiller P, Zhang Y, Mohan S, Levinsohn E, Gaeta I, Hoppe AD, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "19955216", "url": "https://glygen.org/publication/PubMed/19955216" } ] }, { "title": "Structure and function of immunoglobulins.", "journal": "The Journal of allergy and clinical immunology", "date": "2010-02", "authors": "Schroeder Harry W, Cavacini Lisa", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" } ] }, { "title": "The IgG-specific endoglycosidase EndoS inhibits both cellular and complement-mediated autoimmune hemolysis.", "journal": "Blood", "date": "2010", "authors": "Allhorn M, Briceno JG, Baudino L, Lood C, Olsson ML, Izui S, Collin M", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861#ptm_processing" }, { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "20357243", "url": "https://glygen.org/publication/PubMed/20357243" } ] }, { "title": "Calcium-activated pathways and oxidative burst mediate zymosan-induced signaling and IL-10 production in human macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Kelly EK, Wang L, Ivashkiv LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "20400701", "url": "https://glygen.org/publication/PubMed/20400701" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "IgG1 is pathogenic in Leishmania mexicana infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Chu N, Thomas BN, Patel SR, Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "21037092", "url": "https://glygen.org/publication/PubMed/21037092" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "2138613", "url": "https://glygen.org/publication/PubMed/2138613" } ] }, { "title": "ERK-MAPK drives lamellipodia protrusion by activating the WAVE2 regulatory complex.", "journal": "Molecular cell", "date": "2011", "authors": "Mendoza MC, Er EE, Zhang W, Ballif BA, Elliott HL, Danuser G, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "21419341", "url": "https://glygen.org/publication/PubMed/21419341" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Unique structure of iC3b resolved at a resolution of 24 A by 3D-electron microscopy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Alcorlo M, Martinez-Barricarte R, Fernandez FJ, Rodriguez-Gallego C, Round A, Vega MC, Harris CL, de Cordoba SR, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "21788512", "url": "https://glygen.org/publication/PubMed/21788512" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Molecular programming of B cell memory.", "journal": "Nature reviews. Immunology", "date": "2011-12-09", "authors": "McHeyzer-Williams Michael, Okitsu Shinji, Wang Nathaniel, McHeyzer-Williams Louise", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Thrombin generates previously unidentified C5 products that support the terminal complement activation pathway.", "journal": "Blood", "date": "2012", "authors": "Krisinger MJ, Goebeler V, Lu Z, Meixner SC, Myles T, Pryzdial EL, Conway EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "22802338", "url": "https://glygen.org/publication/PubMed/22802338" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.", "journal": "PLoS genetics", "date": "2013", "authors": "Lauc G, Huffman JE, Pucic M, Zgaga L, Adamczyk B, Muzinic A, Novokmet M, Polasek O, Gornik O, Kristic J, Keser T, Vitart V, Scheijen B, Uh HW, Molokhia M, Patrick AL, McKeigue P, Kolcic I, Lukic IK, Swann O, van Leeuwen FN, Ruhaak LR, Houwing-Duistermaat JJ, Slagboom PE, Beekman M, de Craen AJ, Deelder AM, Zeng Q, Wang W, Hastie ND, Gyllensten U, Wilson JF, Wuhrer M, Wright AF, Rudd PM, Hayward C, Aulchenko Y, Campbell H, Rudan I", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "23382691", "url": "https://glygen.org/publication/PubMed/23382691" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Dimerization of complement factor H-related proteins modulates complement activation in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Goicoechea de Jorge E, Caesar JJ, Malik TH, Patel M, Colledge M, Johnson S, Hakobyan S, Morgan BP, Harris CL, Pickering MC, Lea SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "23487775", "url": "https://glygen.org/publication/PubMed/23487775" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins.", "journal": "The Biochemical journal", "date": "1990", "authors": "Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "2363690", "url": "https://glygen.org/publication/PubMed/2363690" } ] }, { "title": "Leishmania mexicana infection induces IgG to parasite surface glycoinositol phospholipids that can induce IL-10 in mice and humans.", "journal": "PLoS neglected tropical diseases", "date": "2013", "authors": "Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "23675550", "url": "https://glygen.org/publication/PubMed/23675550" } ] }, { "title": "EndoS2 is a unique and conserved enzyme of serotype M49 group A Streptococcus that hydrolyses N-linked glycans on IgG and alpha1-acid glycoprotein.", "journal": "The Biochemical journal", "date": "2013", "authors": "Sjogren J, Struwe WB, Cosgrave EF, Rudd PM, Stervander M, Allhorn M, Hollands A, Nizet V, Collin M", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "23865566", "url": "https://glygen.org/publication/PubMed/23865566" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Endogenous association of decay-accelerating factor (DAF) with C4b and C3b on cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Kinoshita T, Medof ME, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2420889", "url": "https://glygen.org/publication/PubMed/2420889" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "SC5b-7, SC5b-8 and SC5b-9 complexes of complement: ultrastructure and localization of the S-protein (vitronectin) within the macromolecules.", "journal": "European journal of immunology", "date": "1989", "authors": "Preissner KP, Podack ER, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2465906", "url": "https://glygen.org/publication/PubMed/2465906" } ] }, { "title": "Complement S-protein (vitronectin) is associated with cytolytic membrane-bound C5b-9 complexes.", "journal": "Clinical and experimental immunology", "date": "1988", "authors": "Bhakdi S, Kaflein R, Halstensen TS, Hugo F, Preissner KT, Mollnes TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2466593", "url": "https://glygen.org/publication/PubMed/2466593" } ] }, { "title": "Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species.", "journal": "Carbohydrate research", "date": "2014", "authors": "Adamczyk B, Tharmalingam-Jaikaran T, Schomberg M, Szekrenyes A, Kelly RM, Karlsson NG, Guttman A, Rudd PM", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "24680513", "url": "https://glygen.org/publication/PubMed/24680513" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Human Fc gamma RIII (CD16). Isoforms with distinct allelic expression, extracellular domains, and membrane linkages on polymorphonuclear and natural killer cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1989", "authors": "Edberg JC, Redecha PB, Salmon JE, Kimberly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "2474607", "url": "https://glygen.org/publication/PubMed/2474607" } ] }, { "title": "Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis.", "journal": "Journal of proteome research", "date": "2014", "authors": "Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P", "evidence": [ { "database": "UniCarbKB", "id": "P01861", "url": "" }, { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "title": "Functional properties of membrane cofactor protein of complement.", "journal": "The Biochemical journal", "date": "1989", "authors": "Seya T, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2481448", "url": "https://glygen.org/publication/PubMed/2481448" } ] }, { "title": "Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls.", "journal": "Proteomics", "date": "2014", "authors": "Kontro H, Joenvaara S, Haglund C, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P01861", "url": "" }, { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "title": "Immunoglobulin G (IgG) Fab glycosylation analysis using a new mass spectrometric high-throughput profiling method reveals pregnancy-associated changes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Bondt A, Rombouts Y, Selman MH, Hensbergen PJ, Reiding KR, Hazes JM, Dolhain RJ, Wuhrer M", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "25004930", "url": "https://glygen.org/publication/PubMed/25004930" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Structure and expression of human IgG FcRII(CD32). Functional heterogeneity is encoded by the alternatively spliced products of multiple genes.", "journal": "The Journal of experimental medicine", "date": "1989", "authors": "Brooks DG, Qiu WQ, Luster AD, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "2529342", "url": "https://glygen.org/publication/PubMed/2529342" } ] }, { "title": "The Serum Immunoglobulin G Glycosylation Signature of Gastric Cancer.", "journal": "EuPA open proteomics", "date": "2015", "authors": "Ruhaak LR, Barkauskas DA, Torres J, Cooke CL, Wu LD, Stroble C, Ozcan S, Williams CC, Camorlinga M, Rocke DM, Lebrilla CB, Solnick JV", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "25685702", "url": "https://glygen.org/publication/PubMed/25685702" } ] }, { "title": "IL-10 Production in Macrophages Is Regulated by a TLR-Driven CREB-Mediated Mechanism That Is Linked to Genes Involved in Cell Metabolism.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Sanin DE, Prendergast CT, Mountford AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "26116503", "url": "https://glygen.org/publication/PubMed/26116503" } ] }, { "title": "Regulation of the amplification C3 convertase of human complement by an inhibitory protein isolated from human erythrocyte membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293688", "url": "https://glygen.org/publication/PubMed/293688" } ] }, { "title": "Modulation of the classical pathway C3 convertase by plasma proteins C4 binding protein and C3b inactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Gigli I, Fujita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293746", "url": "https://glygen.org/publication/PubMed/293746" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Human complement factor I: analysis of cDNA-derived primary structure and assignment of its gene to chromosome 4.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Goldberger G, Bruns GA, Rits M, Edge MD, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2956252", "url": "https://glygen.org/publication/PubMed/2956252" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01861", "url": "" }, { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Identification of the C3b receptor-binding domain in third component of complement.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Becherer JD, Lambris JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2971659", "url": "https://glygen.org/publication/PubMed/2971659" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum.", "journal": "Proteomics. Clinical applications", "date": "2018", "authors": "Saraswat M, Makitie A, Tohmola T, Dickinson A, Saraswat S, Joenvaara S, Renkonen S", "evidence": [ { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "29992770", "url": "https://glygen.org/publication/PubMed/29992770" } ] }, { "title": "Human complement C3b inactivator: isolation, characterization, and demonstration of an absolute requirement for the serum protein beta1H for cleavage of C3b and C4b in solution.", "journal": "The Journal of experimental medicine", "date": "1977", "authors": "Pangburn MK, Schreiber RD, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "301546", "url": "https://glygen.org/publication/PubMed/301546" } ] }, { "title": "Multi-isotype Glycoproteomic Characterization of Serum Antibody Heavy Chains Reveals Isotype- and Subclass-Specific N-Glycosylation Profiles.", "journal": "Molecular & cellular proteomics : MCP", "date": "2019", "authors": "Chandler KB, Mehta N, Leon DR, Suscovich TJ, Alter G, Costello CE", "evidence": [ { "database": "UniCarbKB", "id": "P01861", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30659065", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "770", "url": "https://glyconnect.expasy.org/browser/proteins/770" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G.", "journal": "Biochemistry", "date": "1987", "authors": "Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "3567160", "url": "https://glygen.org/publication/PubMed/3567160" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01861", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01861", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01861" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "C3 nephritic factor protects bound C3bBb from cleavage by factor I and human erythrocytes.", "journal": "Molecular immunology", "date": "1985", "authors": "Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "3848661", "url": "https://glygen.org/publication/PubMed/3848661" } ] }, { "title": "Anaphylatoxin inactivator of human plasma: its isolation and characterization as a carboxypeptidase.", "journal": "The Journal of clinical investigation", "date": "1970", "authors": "Bokisch VA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "4098172", "url": "https://glygen.org/publication/PubMed/4098172" } ] }, { "title": "Human immunoglobulin subclasses. Partial amino acid sequence of the constant region of a gamma 4 chain.", "journal": "Biochem. J.", "date": "1970", "authors": "Pink J R, Buttery S H, De Vries G M, Milstein C", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "4192699", "url": "https://glygen.org/publication/PubMed/4192699" } ] }, { "title": "Formation and functional significance of a molecular complex derived from the second and the fourth component of human complement.", "journal": "The Journal of experimental medicine", "date": "1967", "authors": "Muller-Eberhard HJ, Polley MJ, Calcott MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "6019133", "url": "https://glygen.org/publication/PubMed/6019133" } ] }, { "title": "Generation of three different fragments of bound C3 with purified factor I or serum. I. Requirements for factor H vs CR1 cofactor activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1982", "authors": "Ross GD, Lambris JD, Cain JA, Newman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6214588", "url": "https://glygen.org/publication/PubMed/6214588" } ] }, { "title": "Kinetic and thermodynamic analysis of the control of C3b by the complement regulatory proteins factors H and I.", "journal": "Biochemistry", "date": "1983", "authors": "Pangburn MK, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6219696", "url": "https://glygen.org/publication/PubMed/6219696" } ] }, { "title": "Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Dahlback B, Smith CA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6222381", "url": "https://glygen.org/publication/PubMed/6222381" } ] }, { "title": "Identification of a 145,000 Mr membrane protein as the C3d receptor (CR2) of human B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Weis JJ, Tedder TF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6230668", "url": "https://glygen.org/publication/PubMed/6230668" } ] }, { "title": "Inhibition of complement activation on the surface of cells after incorporation of decay-accelerating factor (DAF) into their membranes.", "journal": "The Journal of experimental medicine", "date": "1984", "authors": "Medof ME, Kinoshita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6238120", "url": "https://glygen.org/publication/PubMed/6238120" } ] }, { "title": "Nucleotide sequence of a human immunoglobulin C gamma 4 gene.", "journal": "DNA", "date": "1981", "authors": "Ellison J, Buxbaum J, Hood L", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "reference": [ { "type": "PubMed", "id": "6299662", "url": "https://glygen.org/publication/PubMed/6299662" } ] }, { "title": "Characterization of the interaction of human C4b-binding protein with physiological ligands.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Ziccardi RJ, Dahlback B, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6334079", "url": "https://glygen.org/publication/PubMed/6334079" } ] }, { "title": "High molecular weight complex in human plasma between vitamin K-dependent protein S and complement component C4b-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Dahlback B, Stenflo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6454142", "url": "https://glygen.org/publication/PubMed/6454142" } ] }, { "title": "Physiologic inactivation of fluid phase C3b: isolation and structural analysis of C3c, C3d,g (alpha 2D), and C3g.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1984", "authors": "Davis AE 3rd, Harrison RA, Lachmann PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6607952", "url": "https://glygen.org/publication/PubMed/6607952" } ] }, { "title": "Human C4-binding protein. I. Isolation and characterization.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Scharfstein J, Ferreira A, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "670886", "url": "https://glygen.org/publication/PubMed/670886" } ] }, { "title": "The human complement system: assembly of the classical pathway C3 convertase.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kerr MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6906228", "url": "https://glygen.org/publication/PubMed/6906228" } ] }, { "title": "Human C4-binding protein. II. Role in proteolysis of C4b by C3b-inactivator.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Fujita T, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "702059", "url": "https://glygen.org/publication/PubMed/702059" } ] }, { "title": "Cleavage of C2 by C1s into the antigenically distinct fragments C2a and C2b: demonstration of binding of C2b to C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1977", "authors": "Nagasawa S, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "70787", "url": "https://glygen.org/publication/PubMed/70787" } ] }, { "title": "Cleavage of C4b by C3b inactivator: production of a nicked form of C4b, C4b', as an intermediate cleavage product of C4b by C3b inactivator.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Nagasawa S, Ichihara C, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7391570", "url": "https://glygen.org/publication/PubMed/7391570" } ] }, { "title": "Interaction between the labile binding sites of the fourth (C4) and fifth (C5) human complement proteins and erythrocyte cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Law SK, Lichtenberg NA, Holcombe FH, Levine RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "7391573", "url": "https://glygen.org/publication/PubMed/7391573" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "Clustering of the high affinity Fc receptor for immunoglobulin G (Fc gamma RI) results in phosphorylation of its associated gamma-chain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Duchemin AM, Ernst LK, Anderson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7512959", "url": "https://glygen.org/publication/PubMed/7512959" } ] }, { "title": "The high affinity Fc gamma receptor (CD64) induces phagocytosis in the absence of its cytoplasmic domain: the gamma subunit of Fc gamma RIIIA imparts phagocytic function to Fc gamma RI.", "journal": "Experimental hematology", "date": "1994", "authors": "Indik ZK, Hunter S, Huang MM, Pan XQ, Chien P, Kelly C, Levinson AI, Kimberly RP, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7516890", "url": "https://glygen.org/publication/PubMed/7516890" } ] }, { "title": "Tyrosine phosphorylation of phospholipase C-gamma 2 is involved in the activation of phosphoinositide hydrolysis by Fc receptors in human neutrophils.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Dusi S, Donini M, Della Bianca V, Rossi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "7517665", "url": "https://glygen.org/publication/PubMed/7517665" } ] }, { "title": "Substitutions and deletions in the cytoplasmic domain of the phagocytic receptor Fc gamma RIIA: effect on receptor tyrosine phosphorylation and phagocytosis.", "journal": "Blood", "date": "1994", "authors": "Mitchell MA, Huang MM, Chien P, Indik ZK, Pan XQ, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7521687", "url": "https://glygen.org/publication/PubMed/7521687" } ] }, { "title": "Protein-tyrosine kinase p72syk in Fc gamma RI receptor signaling.", "journal": "Blood", "date": "1994", "authors": "Durden DL, Liu YB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7522622", "url": "https://glygen.org/publication/PubMed/7522622" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Tyrosine phosphorylation and association of Syk with Fc gamma RII in monocytic THP-1 cells.", "journal": "The Biochemical journal", "date": "1995", "authors": "Ghazizadeh S, Bolen JB, Fleit HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7530449", "url": "https://glygen.org/publication/PubMed/7530449" } ] }, { "title": "Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides.", "journal": "Analytical biochemistry", "date": "1995", "authors": "Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "7540366", "url": "https://glygen.org/publication/PubMed/7540366" } ] }, { "title": "Complement inhibition by human vitronectin involves non-heparin binding domains.", "journal": "Clinical and experimental immunology", "date": "1995", "authors": "Sheehan M, Morris CA, Pussell BA, Charlesworth JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7542572", "url": "https://glygen.org/publication/PubMed/7542572" } ] }, { "title": "Up-regulation of monocytic IL-10 by tumor necrosis factor-alpha and cAMP elevating drugs.", "journal": "International immunology", "date": "1995", "authors": "Platzer C, Meisel C, Vogt K, Platzer M, Volk HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "7547677", "url": "https://glygen.org/publication/PubMed/7547677" } ] }, { "title": "Interaction of C1-inhibitor with the C1r and C1s subcomponents in human C1.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Arlaud GJ, Reboul A, Sim RB, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "760802", "url": "https://glygen.org/publication/PubMed/760802" } ] }, { "title": "Interaction of 125I-labelled complement subcomponents C-1r and C-1s with protease inhibitors in plasma.", "journal": "FEBS letters", "date": "1979", "authors": "Sim RB, Reboul A, Arlaud GJ, Villiers CL, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "761607", "url": "https://glygen.org/publication/PubMed/761607" } ] }, { "title": "Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Matsumoto AK, Martin DR, Carter RH, Klickstein LB, Ahearn JM, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7690834", "url": "https://glygen.org/publication/PubMed/7690834" } ] }, { "title": "Interactions of soluble CD59 with the terminal complement complexes. CD59 and C9 compete for a nascent epitope on C8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Lehto T, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7691959", "url": "https://glygen.org/publication/PubMed/7691959" } ] }, { "title": "Identification of signaling motifs within human Fc gamma RIIa and Fc gamma RIIb isoforms.", "journal": "Blood", "date": "1995", "authors": "Van den Herik-Oudijk IE, Capel PJ, van der Bruggen T, Van de Winkel JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7718892", "url": "https://glygen.org/publication/PubMed/7718892" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Kiz-1, a protein with LIM zinc finger and kinase domains, is expressed mainly in neurons.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "1994", "authors": "Bernard O, Ganiatsas S, Kannourakis G, Dringen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "7848918", "url": "https://glygen.org/publication/PubMed/7848918" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Physicochemical and functional characterization of the C1r subunit of the first complement component.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Ziccardi RJ, Cooper NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623" } ], "reference": [ { "type": "PubMed", "id": "814163", "url": "https://glygen.org/publication/PubMed/814163" } ] }, { "title": "Cross-linking of Fc gamma receptor I (Fc gamma RI) and receptor II (Fc gamma RII) on monocytic cells activates a signal transduction pathway common to both Fc receptors that involves the stimulation of p72 Syk protein tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Kiener PA, Rankin BM, Burkhardt AL, Schieven GL, Gilliland LK, Rowley RB, Bolen JB, Ledbetter JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8226994", "url": "https://glygen.org/publication/PubMed/8226994" } ] }, { "title": "Immunoglobulin G-mediated phagocytosis activates a calcium-independent, phosphatidylethanolamine-specific phospholipase.", "journal": "Journal of leukocyte biology", "date": "1993", "authors": "Lennartz MR, Lefkowith JB, Bromley FA, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "8228618", "url": "https://glygen.org/publication/PubMed/8228618" } ] }, { "title": "Association of the high-affinity receptor for IgG (Fc gamma RI) with the gamma subunit of the IgE receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Ernst LK, Duchemin AM, Anderson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8327478", "url": "https://glygen.org/publication/PubMed/8327478" } ] }, { "title": "Involvement of p72syk, a protein-tyrosine kinase, in Fc gamma receptor signaling.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Agarwal A, Salem P, Robbins KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8340414", "url": "https://glygen.org/publication/PubMed/8340414" } ] }, { "title": "Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Tschopp J, Chonn A, Hertig S, French LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8345200", "url": "https://glygen.org/publication/PubMed/8345200" } ] }, { "title": "Covalent binding properties of the human complement protein C4 and hydrolysis rate of the internal thioester upon activation.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Sepp A, Dodds AW, Anderson MJ, Campbell RD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8495193", "url": "https://glygen.org/publication/PubMed/8495193" } ] }, { "title": "The reaction mechanism of the internal thioester in the human complement component C4.", "journal": "Nature", "date": "1996", "authors": "Dodds AW, Ren XD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "8538770", "url": "https://glygen.org/publication/PubMed/8538770" } ] }, { "title": "The molecular dissection of Fc gamma receptor mediated phagocytosis.", "journal": "Blood", "date": "1995", "authors": "Indik ZK, Park JG, Hunter S, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8541526", "url": "https://glygen.org/publication/PubMed/8541526" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "FcR gamma-chain is essential for both surface expression and function of human Fc gamma RI (CD64) in vivo.", "journal": "Blood", "date": "1996", "authors": "van Vugt MJ, Heijnen IA, Capel PJ, Park SY, Ra C, Saito T, Verbeek JS, van de Winkel JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8611682", "url": "https://glygen.org/publication/PubMed/8611682" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Law CL, Chandran KA, Sidorenko SP, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "8657103", "url": "https://glygen.org/publication/PubMed/8657103" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Localization of classical and alternative pathway regulatory activity within the decay-accelerating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Brodbeck WG, Liu D, Sperry J, Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8786315", "url": "https://glygen.org/publication/PubMed/8786315" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Vav in natural killer cells is tyrosine phosphorylated upon cross-linking of Fc gamma RIIIA and is constitutively associated with a serine/threonine kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Xu X, Chong AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "8809042", "url": "https://glygen.org/publication/PubMed/8809042" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Abrogation of the Fc gamma receptor IIA-mediated phagocytic signal by stem-loop Syk antisense oligonucleotides.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Matsuda M, Park JG, Wang DC, Hunter S, Chien P, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8862523", "url": "https://glygen.org/publication/PubMed/8862523" } ] }, { "title": "The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography.", "journal": "Carbohydrate research", "date": "1996", "authors": "McGuire JM, Douglas M, Smith KD", "evidence": [ { "database": "GlyConnect", "id": "233", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "reference": [ { "type": "PubMed", "id": "8870235", "url": "https://glygen.org/publication/PubMed/8870235" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "Tyrosine phosphorylation and Fcgamma receptor-mediated phagocytosis.", "journal": "FEBS letters", "date": "1997", "authors": "Strzelecka A, Kwiatkowska K, Sobota A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "9000504", "url": "https://glygen.org/publication/PubMed/9000504" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Binding of human and rat CD59 to the terminal complement complexes.", "journal": "Immunology", "date": "1997", "authors": "Lehto T, Morgan BP, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "9038722", "url": "https://glygen.org/publication/PubMed/9038722" } ] }, { "title": "Identification of the major sites of autophosphorylation of the murine protein-tyrosine kinase Syk.", "journal": "Biochimica et biophysica acta", "date": "1997", "authors": "Furlong MT, Mahrenholz AM, Kim KH, Ashendel CL, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9042338", "url": "https://glygen.org/publication/PubMed/9042338" } ] }, { "title": "syk kinase activation by a src kinase-initiated activation loop phosphorylation chain reaction.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "El-Hillal O, Kurosaki T, Yamamura H, Kinet JP, Scharenberg AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9050880", "url": "https://glygen.org/publication/PubMed/9050880" } ] }, { "title": "Mapping of the human IL10 gene and further characterization of the 5' flanking sequence.", "journal": "Immunogenetics", "date": "1997", "authors": "Eskdale J, Kube D, Tesch H, Gallagher G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9162098", "url": "https://glygen.org/publication/PubMed/9162098" } ] }, { "title": "A critical role for Syk in signal transduction and phagocytosis mediated by Fcgamma receptors on macrophages.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Crowley MT, Costello PS, Fitzer-Attas CJ, Turner M, Meng F, Lowell C, Tybulewicz VL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "9314552", "url": "https://glygen.org/publication/PubMed/9314552" } ] }, { "title": "The interaction of Arp2/3 complex with actin: nucleation, high affinity pointed end capping, and formation of branching networks of filaments.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Mullins RD, Heuser JA, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9600938", "url": "https://glygen.org/publication/PubMed/9600938" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "Structural requirements for PAK activation by Rac GTPases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9705280", "url": "https://glygen.org/publication/PubMed/9705280" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Alternative pathway of complement: recruitment of precursor properdin by the labile C3/C5 convertase and the potentiation of the pathway.", "journal": "The Journal of experimental medicine", "date": "1976", "authors": "Medicus RG, Gotze O, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "978134", "url": "https://glygen.org/publication/PubMed/978134" } ] }, { "title": "Fc receptor-mediated phagocytosis requires CDC42 and Rac1.", "journal": "The EMBO journal", "date": "1998", "authors": "Massol P, Montcourrier P, Guillemot JC, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9799231", "url": "https://glygen.org/publication/PubMed/9799231" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.", "journal": "The EMBO journal", "date": "1998", "authors": "Miki H, Suetsugu S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9843499", "url": "https://glygen.org/publication/PubMed/9843499" } ] }, { "title": "Cbl-mediated negative regulation of the Syk tyrosine kinase. A critical role for Cbl phosphotyrosine-binding domain binding to Syk phosphotyrosine 323.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lupher ML Jr, Rao N, Lill NL, Andoniou CE, Miyake S, Clark EA, Druker B, Band H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9857068", "url": "https://glygen.org/publication/PubMed/9857068" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "EVH1/WH1 domains of VASP and WASP proteins belong to a large family including Ran-binding domains of the RanBP1 family.", "journal": "FEBS letters", "date": "1998", "authors": "Callebaut I, Cossart P, Dehoux P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9883880", "url": "https://glygen.org/publication/PubMed/9883880" } ] }, { "title": "A contractile activity that closes phagosomes in macrophages.", "journal": "Journal of cell science", "date": "1999", "authors": "Swanson JA, Johnson MT, Beningo K, Post P, Mooseker M, Araki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9885284", "url": "https://glygen.org/publication/PubMed/9885284" } ] }, { "title": "Fc gamma receptor-mediated activation of phospholipase D regulates macrophage phagocytosis of IgG-opsonized particles.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kusner DJ, Hall CF, Jackson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "9973503", "url": "https://glygen.org/publication/PubMed/9973503" } ] } ], "pathway": [ { "id": "R-HSA-166663", "name": "Initial triggering of complement", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663", "resource": "Reactome", "description": "Initial triggering of complement" }, { "id": "R-HSA-173623", "name": "Classical antibody-mediated complement activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623", "resource": "Reactome", "description": "Classical antibody-mediated complement activation" }, { "id": "R-HSA-2029481", "name": "FCGR activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481", "resource": "Reactome", "description": "FCGR activation" }, { "id": "R-HSA-2029482", "name": "Regulation of actin dynamics for phagocytic cup formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482", "resource": "Reactome", "description": "Regulation of actin dynamics for phagocytic cup formation" }, { "id": "R-HSA-2029485", "name": "Role of phospholipids in phagocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485", "resource": "Reactome", "description": "Role of phospholipids in phagocytosis" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-9664323", "name": "FCGR3A-mediated IL10 synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323", "resource": "Reactome", "description": "FCGR3A-mediated IL10 synthesis" }, { "id": "R-HSA-9664422", "name": "FCGR3A-mediated phagocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422", "resource": "Reactome", "description": "FCGR3A-mediated phagocytosis" }, { "id": "R-HSA-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "F6TQW2-1", "protein_name": "Immunoglobulin heavy constant gamma 2C", "gene_name": "Ighg2c", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "XKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTISRSLGLDLDDVCTEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVELKQKISPDYRNMIGQGA", "length": 404 }, "evidence": [ { "id": "P01861", "url": "https://omabrowser.org/oma/group/P01861/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "immunoglobulin receptor binding", "id": "GO:0034987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034987", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "antigen binding", "id": "GO:0003823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "immunoglobulin complex, circulating", "id": "GO:0042571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042571", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "IgG immunoglobulin complex", "id": "GO:0071735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071735", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "B cell receptor signaling pathway", "id": "GO:0050853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" }, { "name": "complement activation, classical pathway", "id": "GO:0006958", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 1 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G02815KT. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G02815KT. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052161", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052161" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 2 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G02886BB. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G02886BB. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052162", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052162" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 3 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052163", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052163" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 4 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G10339FR. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G10339FR. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052164", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052164" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 5 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052165", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052165" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 6 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G15038BD. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G15038BD. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052166", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052166" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 7 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G16175ZV. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G16175ZV. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052167", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052167" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 8 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G19379ID. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G19379ID. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052168", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052168" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 9 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G22018FP. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G22018FP. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052169", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052169" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 10 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G23505EP. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G23505EP. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052170", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052170" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 11 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G25987BV. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G25987BV. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052171", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052171" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 12 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G27126ED. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G27126ED. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052172", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052172" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 13 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G35029YA. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G35029YA. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052173", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052173" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 14 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G40792UP. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G40792UP. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052174", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052174" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 15 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G40834TG. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G40834TG. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052175", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052175" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 16 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052176", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052176" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 17 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G49284IH. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G49284IH. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052177", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052177" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 18 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G49955PK. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G49955PK. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052178", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052178" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 19 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G50073PQ. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G50073PQ. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052179", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052179" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 20 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G54600FO. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G54600FO. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052180", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052180" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 21 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G55070DG. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G55070DG. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052181", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052181" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 22 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052182", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052182" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 23 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G59937CP. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G59937CP. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052183", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052183" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 24 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G60033FS. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G60033FS. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052184", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052184" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 25 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G61855PQ. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G61855PQ. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052185", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052185" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 26 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G65184UU. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G65184UU. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052186", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052186" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 27 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G65681LR. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G65681LR. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052187", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052187" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 28 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G68318VE. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G68318VE. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052188", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052188" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 29 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G72787SB. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G72787SB. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052189", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052189" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 30 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G72790NZ. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G72790NZ. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052190", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052190" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 31 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G80475RE. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G80475RE. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052191", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052191" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 32 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052192", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052192" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 33 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G85740DB. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G85740DB. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052193", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052193" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 34 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052194", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052194" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 35 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G88725PI. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G88725PI. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052195", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052195" } ] }, { "name": "immunoglobulin heavy constant gamma 4 N-glycosylated 36 (human)", "definition": "An immunoglobulin heavy constant gamma 4 (human) that has been N-glycosylated at the residue equivalent to Asn-177 of the amino acid sequence represented by UniProtKB:P01861-1, in which the glycan composition is represented by GlyTouCan:G95865ZB. Example: UniProtKB:P01861-1, Asn-177, MOD:00160~GNO:G95865ZB. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052196", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052196" } ] } ], "site_annotation": [ { "start_pos": 177, "end_pos": 179, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "(Microbial infection) Deglycosylation on Asn-177 by S.pyogenes EndoS or Endos2 endoglucosidases prevents interaction between immunoglobulin-gamma (IgG) and Fc receptors, impairing ability to activate the complement pathway.", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" }, { "database": "PubMed", "id": "11406581", "url": "https://glygen.org/publication/PubMed/11406581" }, { "database": "PubMed", "id": "23865566", "url": "https://glygen.org/publication/PubMed/23865566" }, { "database": "PubMed", "id": "20357243", "url": "https://glygen.org/publication/PubMed/20357243" } ] }, { "annotation": "Glycosylation on Asn-177 is required for interaction with Fc receptors and ability to activate the complement pathway.", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprot/P01861" }, { "database": "PubMed", "id": "20357243", "url": "https://glygen.org/publication/PubMed/20357243" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 177 ], "o_linked_sites": [ 15, 74, 75, 90, 100 ], "snv_sites": [ 74, 75, 90, 100, 145, 179, 215, 272, 281, 293, 320, 362 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 177, "end_pos": 179 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 184 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 150 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 183 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 150 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 284 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }