{
"uniprot_canonical_ac": "P00915-1",
"uniprot_ac": "P00915",
"uniprot_id": "CAH1_HUMAN",
"mass": {
"chemical_mass": 28870.0,
"monoisotopic_mass": 28870.0
},
"refseq": {
"ac": "NP_001122301",
"name": "carbonic anhydrase 1 isoform a",
"summary": "Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
},
"gene_names": [
{
"name": "CA1",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P00915",
"id": "P00915"
},
{
"name": "CA-I; CAB; Car1; HEL-S-11",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301",
"id": "NP_001122301"
},
{
"name": "CA1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301",
"id": "NP_001122301"
}
],
"protein_names": [
{
"name": "Carbonic anhydrase 1",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P00915"
},
{
"name": "4.2.1.1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "4.2.1.69",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "CA-I",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "CAB",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "Carbonate dehydratase I",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "Carbonic anhydrase B",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "Carbonic anhydrase I",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "Cyanamide hydratase CA1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P00915"
},
{
"name": "carbonic anhydrase 1 isoform a",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301",
"id": "NP_001122301"
},
{
"name": "carbonic anhydrase B; carbonic anhydrase I; carbonate dehydratase I; epididymis secretory protein Li 11; epididymis secretory sperm binding protein; cyanamide hydratase CA1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301",
"id": "NP_001122301"
}
],
"function": [
{
"annotation": "Carbonic anhydrase 1 (CA1) and CA4 were identified as potential biomarkers of Colon adenocarcinoma due to their predictive roles in diagnosis and prognosis, and the results were further confirmed by a series of analyses.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
},
{
"database": "PubMed",
"id": "32031891",
"url": "https://glygen.org/publication/PubMed/32031891"
}
]
},
{
"annotation": "Carbonic anhydrase activity in the frontal lobe of human brain.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
},
{
"database": "PubMed",
"id": "33682938",
"url": "https://glygen.org/publication/PubMed/33682938"
}
]
},
{
"annotation": "Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
}
]
},
{
"annotation": "Catalyzes the reversible hydration of carbon dioxide (PubMed:10550681, PubMed:18618712, PubMed:16807956, PubMed:16686544, PubMed:17127057, PubMed:19186056, PubMed:19206230, PubMed:16506782, PubMed:17314045, PubMed:17407288). Can hydrate cyanamide to urea (PubMed:10550681).",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915#function"
},
{
"database": "PubMed",
"id": "17407288",
"url": "https://glygen.org/publication/PubMed/17407288"
},
{
"database": "PubMed",
"id": "19186056",
"url": "https://glygen.org/publication/PubMed/19186056"
},
{
"database": "PubMed",
"id": "18618712",
"url": "https://glygen.org/publication/PubMed/18618712"
},
{
"database": "PubMed",
"id": "16807956",
"url": "https://glygen.org/publication/PubMed/16807956"
},
{
"database": "PubMed",
"id": "17314045",
"url": "https://glygen.org/publication/PubMed/17314045"
},
{
"database": "PubMed",
"id": "19206230",
"url": "https://glygen.org/publication/PubMed/19206230"
},
{
"database": "PubMed",
"id": "16506782",
"url": "https://glygen.org/publication/PubMed/16506782"
},
{
"database": "PubMed",
"id": "10550681",
"url": "https://glygen.org/publication/PubMed/10550681"
},
{
"database": "PubMed",
"id": "17127057",
"url": "https://glygen.org/publication/PubMed/17127057"
},
{
"database": "PubMed",
"id": "16686544",
"url": "https://glygen.org/publication/PubMed/16686544"
}
]
},
{
"annotation": "Overexpression of CA1 mRNA and the CA I Protein in Tumor Cells Does Not Change the Gene Expression of the ECM Proteins. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
},
{
"database": "PubMed",
"id": "31963697",
"url": "https://glygen.org/publication/PubMed/31963697"
}
]
},
{
"annotation": "Reversible hydration of carbon dioxide.",
"evidence": [
{
"database": "UniProtKB",
"id": "E5RG43",
"url": "https://www.uniprot.org/uniprot/E5RG43#function"
},
{
"database": "UniProtKB",
"id": "RU367011",
"url": "https://www.uniprot.org/uniprot/RU367011#function"
},
{
"database": "UniProtKB",
"id": "E5RH81",
"url": "https://www.uniprot.org/uniprot/E5RH81#function"
},
{
"database": "UniProtKB",
"id": "H0YBE2",
"url": "https://www.uniprot.org/uniprot/H0YBE2#function"
},
{
"database": "UniProtKB",
"id": "E5RHP7",
"url": "https://www.uniprot.org/uniprot/E5RHP7#function"
},
{
"database": "UniProtKB",
"id": "E5RIF9",
"url": "https://www.uniprot.org/uniprot/E5RIF9#function"
},
{
"database": "UniProtKB",
"id": "E5RFE7",
"url": "https://www.uniprot.org/uniprot/E5RFE7#function"
}
]
},
{
"annotation": "The Effect of Nanoparticles on the Structure and Enzymatic Activity of Human Carbonic Anhydrase I and II. Review article Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
},
{
"database": "PubMed",
"id": "32992797",
"url": "https://glygen.org/publication/PubMed/32992797"
}
]
}
],
"disease": [],
"snv": [
{
"evidence": [
{
"id": "rs750567276",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750567276"
},
{
"id": "rs750567276",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750567276"
},
{
"id": "rs750567276",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs750567276"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 218,
"end_pos": 218,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVS->NVS); o-glyco-site-loss (S->N).",
"chr_id": "8",
"chr_pos": "85329705",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S218",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P00915",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00915"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 14,
"end_pos": 14,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "P",
"sequence_mut": "T",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NGP->NGT).",
"chr_id": "8",
"chr_pos": "85338447",
"ref_nt": "G",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "P14",
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs149736810",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149736810"
},
{
"id": "rs149736810",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149736810"
},
{
"id": "rs149736810",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs149736810#frequency_tab"
},
{
"id": "rs149736810",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs149736810"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 207,
"end_pos": 207,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).",
"chr_id": "8",
"chr_pos": "85329738",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S207",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs990726529",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs990726529"
},
{
"id": "rs990726529",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs990726529#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 216,
"end_pos": 216,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).",
"chr_id": "8",
"chr_pos": "85329711",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S216",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs767885397",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767885397"
},
{
"id": "rs767885397",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767885397"
},
{
"id": "23856246",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23856246"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 247,
"end_pos": 247,
"sequence_org": "R",
"sequence_mut": "S",
"comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNR->NNS).",
"chr_id": "8",
"chr_pos": "85328607",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "R247",
"keywords": [
"ebi",
"somatic"
]
},
{
"evidence": [
{
"id": "rs1335537877",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1335537877"
},
{
"id": "rs1335537877",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1335537877"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 35,
"end_pos": 35,
"sequence_org": "K",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KTS->NTS).",
"chr_id": "8",
"chr_pos": "85338382",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "K35",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs527238405",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527238405"
},
{
"id": "rs527238405",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs527238405"
},
{
"id": "rs527238405",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527238405"
},
{
"id": "rs527238405",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs527238405"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 37,
"end_pos": 37,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SET->NET).",
"chr_id": "8",
"chr_pos": "85338377",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "0.0002",
"site_lbl": "S37",
"keywords": [
"ebi",
"germline"
]
}
],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "74.41",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "41.27",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "69.01",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "63.05",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "99.85",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "98",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "53.38",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "62.87",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "52.9",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "70.88",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "54.41",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "61.28",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P00915"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "CA1",
"url": "https://www.uniprot.org/uniprot/P00915",
"locus": {
"chromosome": "8",
"start_pos": 85327608,
"end_pos": 85379014,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000133742",
"url": "https://www.ensembl.org/id/ENSG00000133742"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000133742",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000133742",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P00915",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P00915",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "4.2.1.1",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.2.1.1&UniProtAcc=P00915",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "CHEMBL261",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL261",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "CA1",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CA1",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "759",
"url": "https://www.ncbi.nlm.nih.gov/gene/759",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "2846",
"url": "https://glyconnect.expasy.org/browser/proteins/2846",
"database": "GlyConnect",
"categories": [
"Glycoproteomics",
"Glycan"
]
},
{
"id": "1368",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1368",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P00915",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P00915*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR001148",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001148",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018338",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018338",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR023561",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR023561",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036398",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036398",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:759",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:759",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "114800",
"url": "http://www.omim.org/entry/114800",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P00915",
"url": "https://www.nextprot.org/entry/NX_P00915",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P00915",
"url": "https://oglcnac.org/atlas/detail/P00915",
"database": "O-GlcNAc Atlas",
"categories": [
"Glycoproteomics"
]
},
{
"id": "P00915",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "NGPEQWG",
"url": "https://omabrowser.org/oma/group/NGPEQWG/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "49814at2759",
"url": "http://www.orthodb.org/?query=49814at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR18952",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18952",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR18952:SF266",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18952:SF266",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1AZM",
"url": "https://www.rcsb.org/structure/1AZM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1BZM",
"url": "https://www.rcsb.org/structure/1BZM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CRM",
"url": "https://www.rcsb.org/structure/1CRM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CZM",
"url": "https://www.rcsb.org/structure/1CZM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1HCB",
"url": "https://www.rcsb.org/structure/1HCB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1HUG",
"url": "https://www.rcsb.org/structure/1HUG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1HUH",
"url": "https://www.rcsb.org/structure/1HUH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1J9W",
"url": "https://www.rcsb.org/structure/1J9W",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1JV0",
"url": "https://www.rcsb.org/structure/1JV0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2CAB",
"url": "https://www.rcsb.org/structure/2CAB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2FOY",
"url": "https://www.rcsb.org/structure/2FOY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2FW4",
"url": "https://www.rcsb.org/structure/2FW4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2IT4",
"url": "https://www.rcsb.org/structure/2IT4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2NMX",
"url": "https://www.rcsb.org/structure/2NMX",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2NN1",
"url": "https://www.rcsb.org/structure/2NN1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2NN7",
"url": "https://www.rcsb.org/structure/2NN7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3LXE",
"url": "https://www.rcsb.org/structure/3LXE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3W6H",
"url": "https://www.rcsb.org/structure/3W6H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3W6I",
"url": "https://www.rcsb.org/structure/3W6I",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4WR7",
"url": "https://www.rcsb.org/structure/4WR7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4WUP",
"url": "https://www.rcsb.org/structure/4WUP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4WUQ",
"url": "https://www.rcsb.org/structure/4WUQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5E2M",
"url": "https://www.rcsb.org/structure/5E2M",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5GMM",
"url": "https://www.rcsb.org/structure/5GMM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6EVR",
"url": "https://www.rcsb.org/structure/6EVR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6EX1",
"url": "https://www.rcsb.org/structure/6EX1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6F3B",
"url": "https://www.rcsb.org/structure/6F3B",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6FAF",
"url": "https://www.rcsb.org/structure/6FAF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6FAG",
"url": "https://www.rcsb.org/structure/6FAG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6G3V",
"url": "https://www.rcsb.org/structure/6G3V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6HWZ",
"url": "https://www.rcsb.org/structure/6HWZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6I0J",
"url": "https://www.rcsb.org/structure/6I0J",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6I0L",
"url": "https://www.rcsb.org/structure/6I0L",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6SWM",
"url": "https://www.rcsb.org/structure/6SWM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XZE",
"url": "https://www.rcsb.org/structure/6XZE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XZO",
"url": "https://www.rcsb.org/structure/6XZO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XZS",
"url": "https://www.rcsb.org/structure/6XZS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XZX",
"url": "https://www.rcsb.org/structure/6XZX",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6XZY",
"url": "https://www.rcsb.org/structure/6XZY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6Y00",
"url": "https://www.rcsb.org/structure/6Y00",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7PLF",
"url": "https://www.rcsb.org/structure/7PLF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7Q0D",
"url": "https://www.rcsb.org/structure/7Q0D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7QOB",
"url": "https://www.rcsb.org/structure/7QOB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7ZL5",
"url": "https://www.rcsb.org/structure/7ZL5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00194",
"url": "http://pfam.xfam.org/family/PF00194",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P00915",
"url": "https://pharos.nih.gov/targets/P00915",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P00915",
"url": "http://purl.obolibrary.org/obo/PR_P00915",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8950505",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "10748",
"url": "https://www.rhea-db.org/rhea/10748",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "23056",
"url": "https://www.rhea-db.org/rhea/23056",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "E5RFE7",
"url": "https://www.uniprot.org/uniprot/E5RFE7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RFE7-1",
"url": "https://www.uniprot.org/uniprot/E5RFE7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RFL2",
"url": "https://www.uniprot.org/uniprot/E5RFL2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RFL2-1",
"url": "https://www.uniprot.org/uniprot/E5RFL2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RG43",
"url": "https://www.uniprot.org/uniprot/E5RG43",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RG43-1",
"url": "https://www.uniprot.org/uniprot/E5RG43-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RG81",
"url": "https://www.uniprot.org/uniprot/E5RG81",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RG81-1",
"url": "https://www.uniprot.org/uniprot/E5RG81-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RGU8",
"url": "https://www.uniprot.org/uniprot/E5RGU8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RGU8-1",
"url": "https://www.uniprot.org/uniprot/E5RGU8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RH81",
"url": "https://www.uniprot.org/uniprot/E5RH81",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RH81-1",
"url": "https://www.uniprot.org/uniprot/E5RH81-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RHP7",
"url": "https://www.uniprot.org/uniprot/E5RHP7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RHP7-1",
"url": "https://www.uniprot.org/uniprot/E5RHP7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RHS7",
"url": "https://www.uniprot.org/uniprot/E5RHS7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RHS7-1",
"url": "https://www.uniprot.org/uniprot/E5RHS7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RIF9",
"url": "https://www.uniprot.org/uniprot/E5RIF9",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RIF9-1",
"url": "https://www.uniprot.org/uniprot/E5RIF9-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RII2",
"url": "https://www.uniprot.org/uniprot/E5RII2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RII2-1",
"url": "https://www.uniprot.org/uniprot/E5RII2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RJF6",
"url": "https://www.uniprot.org/uniprot/E5RJF6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RJF6-1",
"url": "https://www.uniprot.org/uniprot/E5RJF6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RJI8",
"url": "https://www.uniprot.org/uniprot/E5RJI8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E5RJI8-1",
"url": "https://www.uniprot.org/uniprot/E5RJI8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YBE2",
"url": "https://www.uniprot.org/uniprot/H0YBE2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YBE2-1",
"url": "https://www.uniprot.org/uniprot/H0YBE2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P00915-1",
"url": "https://www.uniprot.org/uniprot/P00915-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF",
"length": 261,
"header": "sp|P00915-1|CAH1_HUMAN Isoform 1 of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2 CANONICAL=P00915-1"
},
"isoforms": [
{
"isoform_ac": "E5RFE7-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRAS",
"length": 194,
"header": "tr|E5RFE7-1|E5RFE7_HUMAN Computationally mapped isoform of Carbonic anhydrase OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85328566,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000524324.5",
"url": "https://www.ensembl.org/id/ENST00000524324.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000428923.1",
"url": "https://www.ensembl.org/id/ENSP00000428923.1"
}
]
}
},
{
"isoform_ac": "E5RFL2-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAE",
"length": 118,
"header": "tr|E5RFL2-1|E5RFL2_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85336945,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000522662.5",
"url": "https://www.ensembl.org/id/ENST00000522662.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430372.1",
"url": "https://www.ensembl.org/id/ENSP00000430372.1"
}
]
}
},
{
"isoform_ac": "E5RG43-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLM",
"length": 149,
"header": "tr|E5RG43-1|CAH1_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85333528,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000521846.5",
"url": "https://www.ensembl.org/id/ENST00000521846.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430471.1",
"url": "https://www.ensembl.org/id/ENSP00000430471.1"
}
]
}
},
{
"isoform_ac": "E5RG81-1",
"url": "",
"sequence": {
"sequence": "MMTKMLHVAHWNSAKYSSLAEAASKADGLAVIGVLMKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF",
"length": 127,
"header": "tr|E5RG81-1|E5RG81_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341613,
"end_pos": 85328563,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000522389.5",
"url": "https://www.ensembl.org/id/ENST00000522389.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000427773.1",
"url": "https://www.ensembl.org/id/ENSP00000427773.1"
}
]
}
},
{
"isoform_ac": "E5RGU8-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWG",
"length": 99,
"header": "tr|E5RGU8-1|E5RGU8_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85337002,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000523858.5",
"url": "https://www.ensembl.org/id/ENST00000523858.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430975.1",
"url": "https://www.ensembl.org/id/ENSP00000430975.1"
}
]
}
},
{
"isoform_ac": "E5RH81-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRA",
"length": 175,
"header": "tr|E5RH81-1|CAH1_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=8 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85329833,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000517590.5",
"url": "https://www.ensembl.org/id/ENST00000517590.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000429843.1",
"url": "https://www.ensembl.org/id/ENSP00000429843.1"
}
]
}
},
{
"isoform_ac": "E5RHP7-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQP",
"length": 251,
"header": "tr|E5RHP7-1|E5RHP7_HUMAN Computationally mapped isoform of Carbonic anhydrase OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85328593,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000517618.5",
"url": "https://www.ensembl.org/id/ENST00000517618.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430861.1",
"url": "https://www.ensembl.org/id/ENSP00000430861.1"
}
]
}
},
{
"isoform_ac": "E5RHS7-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYP",
"length": 22,
"header": "tr|E5RHS7-1|CAH1_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85338421,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000519129.5",
"url": "https://www.ensembl.org/id/ENST00000519129.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000429688.1",
"url": "https://www.ensembl.org/id/ENSP00000429688.1"
}
]
}
},
{
"isoform_ac": "E5RIF9-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVL",
"length": 148,
"header": "tr|E5RIF9-1|E5RIF9_HUMAN Computationally mapped isoform of Carbonic anhydrase OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85333531,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000522814.5",
"url": "https://www.ensembl.org/id/ENST00000522814.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430737.1",
"url": "https://www.ensembl.org/id/ENSP00000430737.1"
}
]
}
},
{
"isoform_ac": "E5RII2-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSALL",
"length": 81,
"header": "tr|E5RII2-1|E5RII2_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85338132,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000517429.5",
"url": "https://www.ensembl.org/id/ENST00000517429.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430710.1",
"url": "https://www.ensembl.org/id/ENSP00000430710.1"
}
]
}
},
{
"isoform_ac": "E5RJF6-1",
"url": "",
"sequence": {
"sequence": "MMTKMLHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLT",
"length": 87,
"header": "tr|E5RJF6-1|CAH1_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341613,
"end_pos": 85329758,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000520663.5",
"url": "https://www.ensembl.org/id/ENST00000520663.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430571.1",
"url": "https://www.ensembl.org/id/ENSP00000430571.1"
}
]
}
},
{
"isoform_ac": "E5RJI8-1",
"url": "",
"sequence": {
"sequence": "MMTKMLHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQ",
"length": 137,
"header": "tr|E5RJI8-1|E5RJI8_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=8 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341613,
"end_pos": 85328596,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000519991.5",
"url": "https://www.ensembl.org/id/ENST00000519991.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000430543.1",
"url": "https://www.ensembl.org/id/ENSP00000430543.1"
}
]
}
},
{
"isoform_ac": "H0YBE2-1",
"url": "",
"sequence": {
"sequence": "XHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQHNNRPTQPLKGRTVRASF",
"length": 178,
"header": "tr|H0YBE2-1|CAH1_HUMAN Computationally mapped isoform of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=1 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85338295,
"end_pos": 85328561,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000521679.5",
"url": "https://www.ensembl.org/id/ENST00000521679.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000429300.1",
"url": "https://www.ensembl.org/id/ENSP00000429300.1"
}
]
}
},
{
"isoform_ac": "P00915-1",
"url": "",
"sequence": {
"sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF",
"length": 261,
"header": "sp|P00915-1|CAH1_HUMAN Isoform 1 of Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2 CANONICAL=P00915-1"
},
"locus": {
"chromosome": "8",
"start_pos": 85341635,
"end_pos": 85328563,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000523022.6",
"url": "https://www.ensembl.org/id/ENST00000523022.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000429798.1",
"url": "https://www.ensembl.org/id/ENSP00000429798.1"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 130,
"start_aa": "Ser",
"end_pos": 130,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser130",
"evidence": [
{
"id": "P00915",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915"
},
{
"id": "24126823",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/24126823"
},
{
"id": "18984734",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/18984734"
},
{
"id": "P00915",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P00915"
},
{
"id": "2846",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/2846"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 218,
"start_aa": "Ser",
"end_pos": 218,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser218",
"evidence": [
{
"id": "P00915",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915"
},
{
"id": "24126823",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/24126823"
},
{
"id": "18984734",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/18984734"
},
{
"id": "P00915",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P00915"
},
{
"id": "2846",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/2846"
}
]
}
],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Carbonic anhydrase IV activity is localized on the exterior surface of human erythrocytes.",
"journal": "Acta physiologica Scandinavica",
"date": "1999",
"authors": "Wistrand PJ, Carter ND, Conroy CW, Mahieu I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "10090333",
"url": "https://glygen.org/publication/PubMed/10090333"
}
]
},
{
"title": "Human mitochondrial carbonic anhydrase VB. cDNA cloning, mRNA expression, subcellular localization, and mapping to chromosome x.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Fujikawa-Adachi K, Nishimori I, Taguchi T, Onishi S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "10409679",
"url": "https://glygen.org/publication/PubMed/10409679"
}
]
},
{
"title": "Assessment of roles of surface histidyl residues in the molecular basis of the Bohr effect and of beta 143 histidine in the binding of 2,3-bisphosphoglycerate in human normal adult hemoglobin.",
"journal": "Biochemistry",
"date": "1999",
"authors": "Fang TY, Zou M, Simplaceanu V, Ho NT, Ho C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "10529219",
"url": "https://glygen.org/publication/PubMed/10529219"
}
]
},
{
"title": "Carbonic anhydrase catalyzes cyanamide hydration to urea: is it mimicking the physiological reaction?",
"journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry",
"date": "1999-10",
"authors": "Briganti F, Mangani S, Scozzafava A, Vernaglione G, Supuran C T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "10550681",
"url": "https://glygen.org/publication/PubMed/10550681"
}
]
},
{
"title": "Identification of a cytochrome b-type NAD(P)H oxidoreductase ubiquitously expressed in human cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Zhu H, Qiu H, Yoon HW, Huang S, Bunn HF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "10611283",
"url": "https://glygen.org/publication/PubMed/10611283"
}
]
},
{
"title": "Purification and kinetic analysis of recombinant CA XII, a membrane carbonic anhydrase overexpressed in certain cancers.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Ulmasov B, Waheed A, Shah GN, Grubb JH, Sly WS, Tu C, Silverman DN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "11121027",
"url": "https://glygen.org/publication/PubMed/11121027"
}
]
},
{
"title": "A transport metabolon. Functional interaction of carbonic anhydrase II and chloride/bicarbonate exchangers.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Sterling D, Reithmeier RA, Casey JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "11606574",
"url": "https://glygen.org/publication/PubMed/11606574"
}
]
},
{
"title": "The catalytic properties of human carbonic anhydrase IX.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Wingo T, Tu C, Laipis PJ, Silverman DN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "11676494",
"url": "https://glygen.org/publication/PubMed/11676494"
}
]
},
{
"title": "Crystal structure of a zinc-activated variant of human carbonic anhydrase I, CA I Michigan 1: evidence for a second zinc binding site involving arginine coordination.",
"journal": "Biochemistry",
"date": "2002",
"authors": "Ferraroni M, Tilli S, Briganti F, Chegwidden WR, Supuran CT, Wiebauer KE, Tashian RE, Scozzafava A",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "12009884",
"url": "https://glygen.org/publication/PubMed/12009884"
}
]
},
{
"title": "Characterization of human carbonic anhydrase III from skeletal muscle.",
"journal": "Biochemical genetics",
"date": "1979",
"authors": "Carter N, Jeffery S, Shiels A, Edwards Y, Tipler T, Hopkinson DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "120192",
"url": "https://glygen.org/publication/PubMed/120192"
}
]
},
{
"title": "Aquaporin-1 and HCO3(-)-Cl- transporter-mediated transport of CO2 across the human erythrocyte membrane.",
"journal": "The Journal of physiology",
"date": "2003",
"authors": "Blank ME, Ehmke H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "12754312",
"url": "https://glygen.org/publication/PubMed/12754312"
}
]
},
{
"title": "Deficient HCO3- transport in an AE1 mutant with normal Cl- transport can be rescued by carbonic anhydrase II presented on an adjacent AE1 protomer.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Dahl NK, Jiang L, Chernova MN, Stuart-Tilley AK, Shmukler BE, Alper SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "12933803",
"url": "https://glygen.org/publication/PubMed/12933803"
}
]
},
{
"title": "Human carbonic anhydrase IV: cDNA cloning, sequence comparison, and expression in COS cell membranes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1992",
"authors": "Okuyama T, Sato S, Zhu XL, Waheed A, Sly WS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "1311094",
"url": "https://glygen.org/publication/PubMed/1311094"
}
]
},
{
"title": "Carbon 13 resonances of 13CO2 carbamino adducts of alpha and beta chains in human adult hemoglobin.",
"journal": "The Journal of biological chemistry",
"date": "1976",
"authors": "Morrow JS, Matthew JB, Wittebort RJ, Gurd FR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "1395",
"url": "https://glygen.org/publication/PubMed/1395"
}
]
},
{
"title": "Carbonic anhydrase inhibitors: inhibition of human and murine mitochondrial isozymes V with anions.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2003",
"authors": "Franchi M, Vullo D, Gallori E, Antel J, Wurl M, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "14611844",
"url": "https://glygen.org/publication/PubMed/14611844"
}
]
},
{
"title": "Quantitative determination of carbamino adducts of alpha and beta chains in human adult hemoglobin in presence and absence of carbon monoxide and 2,3-diphosphoglycerate.",
"journal": "The Journal of biological chemistry",
"date": "1977",
"authors": "Matthew JB, Morrow JS, Wittebort RJ, Gurd FR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "14958",
"url": "https://glygen.org/publication/PubMed/14958"
}
]
},
{
"title": "NCB5OR is a novel soluble NAD(P)H reductase localized in the endoplasmic reticulum.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Zhu H, Larade K, Jackson TA, Xie J, Ladoux A, Acker H, Berchner-Pfannschmidt U, Fandrey J, Cross AR, Lukat-Rodgers GS, Rodgers KR, Bunn HF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "15131110",
"url": "https://glygen.org/publication/PubMed/15131110"
}
]
},
{
"title": "Differences in anionic inhibition of human carbonic anhydrase I revealed from the structures of iodide and gold cyanide inhibitor complexes.",
"journal": "Acta Crystallogr. D",
"date": "1994",
"authors": "Kumar V, Kannan KK, Sathyamurthi P",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "15299369",
"url": "https://glygen.org/publication/PubMed/15299369"
}
]
},
{
"title": "Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2004",
"authors": "Innocenti A, Firnges MA, Antel J, Wurl M, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "15501038",
"url": "https://glygen.org/publication/PubMed/15501038"
}
]
},
{
"title": "Buffer dependence of CO2 hydration catalyzed by human carbonic anhydrase I.",
"journal": "Biochimica et biophysica acta",
"date": "1992",
"authors": "Ren X, Lindskog S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "1554744",
"url": "https://glygen.org/publication/PubMed/1554744"
}
]
},
{
"title": "Identification of cytochrome-b5 reductase as the enzyme responsible for NADH-dependent lucigenin chemiluminescence in human spermatozoa.",
"journal": "Biology of reproduction",
"date": "2005",
"authors": "Baker MA, Krutskikh A, Curry BJ, Hetherington L, Aitken RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "15858218",
"url": "https://glygen.org/publication/PubMed/15858218"
}
]
},
{
"title": "Carbonic anhydrase inhibitors: inhibition of the human transmembrane isozyme XIV with a library of aromatic/heterocyclic sulfonamides.",
"journal": "Bioorganic & medicinal chemistry",
"date": "2005",
"authors": "Ozensoy O, Nishimori I, Vullo D, Puccetti L, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "16006130",
"url": "https://glygen.org/publication/PubMed/16006130"
}
]
},
{
"title": "Proteome profiling of interleukin-12 treated human T helper cells.",
"journal": "Proteomics",
"date": "2005",
"authors": "Rosengren AT, Nyman TA, Lahesmaa R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8950505",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505"
}
],
"reference": [
{
"type": "PubMed",
"id": "16038020",
"url": "https://glygen.org/publication/PubMed/16038020"
}
]
},
{
"title": "Carbonic anhydrase inhibitors. The mitochondrial isozyme VB as a new target for sulfonamide and sulfamate inhibitors.",
"journal": "Journal of medicinal chemistry",
"date": "2005",
"authors": "Nishimori I, Vullo D, Innocenti A, Scozzafava A, Mastrolorenzo A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "16302824",
"url": "https://glygen.org/publication/PubMed/16302824"
}
]
},
{
"title": "Ultrahigh resolution crystal structures of human carbonic anhydrases I and II complexed with `two-prong` inhibitors reveal the molecular basis of high affinity.",
"journal": "Journal of the American Chemical Society",
"date": "2006",
"authors": "Jude KM, Banerjee AL, Haldar MK, Manokaran S, Roy B, Mallik S, Srivastava DK, Christianson DW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "16506782",
"url": "https://glygen.org/publication/PubMed/16506782"
}
]
},
{
"title": "Red cell membrane CO2 permeability in normal human blood and in blood deficient in various blood groups, and effect of DIDS.",
"journal": "Transfusion clinique et biologique : journal de la Societe francaise de transfusion sanguine",
"date": "2006",
"authors": "Endeward V, Cartron JP, Ripoche P, Gros G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "16563834",
"url": "https://glygen.org/publication/PubMed/16563834"
}
]
},
{
"title": "Carbonic anhydrase activators. Activation of isoforms I, II, IV, VA, VII, and XIV with L- and D-phenylalanine and crystallographic analysis of their adducts with isozyme II: stereospecific recognition within the active site of an enzyme and its consequences for the drug design.",
"journal": "Journal of medicinal chemistry",
"date": "2006-05-18",
"authors": "Temperini Claudia, Scozzafava Andrea, Vullo Daniela, Supuran Claudiu T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "16686544",
"url": "https://glygen.org/publication/PubMed/16686544"
}
]
},
{
"title": "Carbonic anhydrase activators. Activation of isozymes I, II, IV, VA, VII, and XIV with l- and d-histidine and crystallographic analysis of their adducts with isoform II: engineering proton-transfer processes within the active site of an enzyme.",
"journal": "Chemistry (Weinheim an der Bergstrasse, Germany)",
"date": "2006-09-18",
"authors": "Temperini Claudia, Scozzafava Andrea, Vullo Daniela, Supuran Claudiu T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "16807956",
"url": "https://glygen.org/publication/PubMed/16807956"
}
]
},
{
"title": "Carbonic anhydrase activators: the first X-ray crystallographic study of an adduct of isoform I.",
"journal": "Bioorg. Med. Chem. Lett.",
"date": "2006",
"authors": "Temperini C, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "16870440",
"url": "https://glygen.org/publication/PubMed/16870440"
}
]
},
{
"title": "The specific influence of carbon dioxide and carbamate compounds on the buffer power and Bohr effects in human haemoglobin solutions.",
"journal": "The Journal of physiology",
"date": "1967",
"authors": "Rossi-Bernardi L, Roughton FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "16992238",
"url": "https://glygen.org/publication/PubMed/16992238"
}
]
},
{
"title": "The chemical relationships and physiological importance of carbamino compounds of CO(2) with haemoglobin.",
"journal": "The Journal of physiology",
"date": "1934",
"authors": "Ferguson JK, Roughton FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "16994616",
"url": "https://glygen.org/publication/PubMed/16994616"
}
]
},
{
"title": "Evidence that aquaporin 1 is a major pathway for CO2 transport across the human erythrocyte membrane.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2006",
"authors": "Endeward V, Musa-Aziz R, Cooper GJ, Chen LM, Pelletier MF, Virkki LV, Supuran CT, King LS, Boron WF, Gros G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "17012249",
"url": "https://glygen.org/publication/PubMed/17012249"
}
]
},
{
"title": "Carbonic anhydrase activators: L-Adrenaline plugs the active site entrance of isozyme II, activating better isoforms I, IV, VA, VII, and XIV.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2007-02-01",
"authors": "Temperini Claudia, Innocenti Alessio, Scozzafava Andrea, Mastrolorenzo Antonio, Supuran Claudiu T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "17127057",
"url": "https://glygen.org/publication/PubMed/17127057"
}
]
},
{
"title": "Carbonic anhydrase inhibitors. DNA cloning, characterization, and inhibition studies of the human secretory isoform VI, a new target for sulfonamide and sulfamate inhibitors.",
"journal": "Journal of medicinal chemistry",
"date": "2007",
"authors": "Nishimori I, Minakuchi T, Onishi S, Vullo D, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "17228881",
"url": "https://glygen.org/publication/PubMed/17228881"
}
]
},
{
"title": "Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2007",
"authors": "Temperini C, Innocenti A, Guerri A, Scozzafava A, Rusconi S, Supuran CT",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "17314045",
"url": "https://glygen.org/publication/PubMed/17314045"
}
]
},
{
"title": "Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.",
"journal": "Nature",
"date": "2007",
"authors": "Ono M, Yaguchi H, Ohkura N, Kitabayashi I, Nagamura Y, Nomura T, Miyachi Y, Tsukada T, Sakaguchi S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8950505",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505"
}
],
"reference": [
{
"type": "PubMed",
"id": "17377532",
"url": "https://glygen.org/publication/PubMed/17377532"
}
]
},
{
"title": "Structural analysis of charge discrimination in the binding of inhibitors to human carbonic anhydrases I and II.",
"journal": "Journal of the American Chemical Society",
"date": "2007",
"authors": "Srivastava DK, Jude KM, Banerjee AL, Haldar M, Manokaran S, Kooren J, Mallik S, Christianson DW",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "17407288",
"url": "https://glygen.org/publication/PubMed/17407288"
}
]
},
{
"title": "Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III.",
"journal": "Proteins",
"date": "2007",
"authors": "Elder I, Fisher Z, Laipis PJ, Tu C, McKenna R, Silverman DN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "17427958",
"url": "https://glygen.org/publication/PubMed/17427958"
}
]
},
{
"title": "Carbonic anhydrase activators: the first activation study of the human secretory isoform VI with amino acids and amines.",
"journal": "Bioorganic & medicinal chemistry",
"date": "2007",
"authors": "Nishimori I, Onishi S, Vullo D, Innocenti A, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "17499996",
"url": "https://glygen.org/publication/PubMed/17499996"
}
]
},
{
"title": "RhAG protein of the Rhesus complex is a CO2 channel in the human red cell membrane.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2008",
"authors": "Endeward V, Cartron JP, Ripoche P, Gros G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "17712059",
"url": "https://glygen.org/publication/PubMed/17712059"
}
]
},
{
"title": "Carbonic anhydrase inhibitors: the inhibition profiles of the human mitochondrial isoforms VA and VB with anions are very different.",
"journal": "Bioorganic & medicinal chemistry",
"date": "2007",
"authors": "Nishimori I, Innocenti A, Vullo D, Scozzafava A, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "17761422",
"url": "https://glygen.org/publication/PubMed/17761422"
}
]
},
{
"title": "Protonation states of buried histidine residues in human deoxyhemoglobin revealed by neutron crystallography.",
"journal": "Journal of the American Chemical Society",
"date": "2007",
"authors": "Chatake T, Shibayama N, Park SY, Kurihara K, Tamada T, Tanaka I, Niimura N, Kuroki R, Morimoto Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "17990881",
"url": "https://glygen.org/publication/PubMed/17990881"
}
]
},
{
"title": "Carbonic anhydrase inhibitors. Interaction of 2-N,N-dimethylamino-1,3,4-thiadiazole-5-methanesulfonamide with 12 mammalian isoforms: kinetic and X-ray crystallographic studies.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2008",
"authors": "Temperini C, Cecchi A, Boyle NA, Scozzafava A, Cabeza JE, Wentworth P Jr, Blackburn GM, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "18162396",
"url": "https://glygen.org/publication/PubMed/18162396"
}
]
},
{
"title": "Carbonic anhydrase activators: activation of the human tumor-associated isozymes IX and XII with amino acids and amines.",
"journal": "Bioorganic & medicinal chemistry",
"date": "2008",
"authors": "Pastorekova S, Vullo D, Nishimori I, Scozzafava A, Pastorek J, Supuran CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "18294854",
"url": "https://glygen.org/publication/PubMed/18294854"
}
]
},
{
"title": "Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.",
"journal": "Proteins",
"date": "2009",
"authors": "Di Fiore A, Monti SM, Hilvo M, Parkkila S, Romano V, Scaloni A, Pedone C, Scozzafava A, Supuran CT, De Simone G",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "18618712",
"url": "https://glygen.org/publication/PubMed/18618712"
}
]
},
{
"title": "Biochemical characterization of CA IX, one of the most active carbonic anhydrase isozymes.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Hilvo M, Baranauskiene L, Salzano AM, Scaloni A, Matulis D, Innocenti A, Scozzafava A, Monti SM, Di Fiore A, De Simone G, Lindfors M, Janis J, Valjakka J, Pastorekova S, Pastorek J, Kulomaa MS, Nordlund HR, Supuran CT, Parkkila S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "18703501",
"url": "https://glygen.org/publication/PubMed/18703501"
}
]
},
{
"title": "Site-specific GlcNAcylation of human erythrocyte proteins: potential biomarker(s) for diabetes.",
"journal": "Diabetes",
"date": "2009",
"authors": "Wang Z, Park K, Comer F, Hsieh-Wilson LC, Saudek CD, Hart GW",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P00915",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915"
},
{
"database": "O-GlcNAc Atlas",
"id": "P00915",
"url": "https://oglcnac.org/atlas/detail/P00915"
},
{
"database": "GlyConnect",
"id": "2846",
"url": "https://glyconnect.expasy.org/browser/proteins/2846"
}
],
"reference": [
{
"type": "PubMed",
"id": "18984734",
"url": "https://glygen.org/publication/PubMed/18984734"
}
]
},
{
"title": "A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2009-03-01",
"authors": "Crocetti Letizia, Maresca Alfonso, Temperini Claudia, Hall Rebecca A, Scozzafava Andrea, M\u00fchlschlegel Fritz A, Supuran Claudiu T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "19186056",
"url": "https://glygen.org/publication/PubMed/19186056"
}
]
},
{
"title": "Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.",
"journal": "Journal of the American Chemical Society",
"date": "2009-03-04",
"authors": "Maresca Alfonso, Temperini Claudia, Vu Hoan, Pham Ngoc B, Poulsen Sally-Ann, Scozzafava Andrea, Quinn Ronald J, Supuran Claudiu T",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "19206230",
"url": "https://glygen.org/publication/PubMed/19206230"
}
]
},
{
"title": "Relative CO2/NH3 selectivities of AQP1, AQP4, AQP5, AmtB, and RhAG.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2009",
"authors": "Musa-Aziz R, Chen LM, Pelletier MF, Boron WF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "19273840",
"url": "https://glygen.org/publication/PubMed/19273840"
}
]
},
{
"title": "Brinzolamide ophthalmic suspension: a review of its pharmacology and use in the treatment of open angle glaucoma and ocular hypertension.",
"journal": "Clinical ophthalmology (Auckland, N.Z.)",
"date": "2008",
"authors": "Iester M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "19668749",
"url": "https://glygen.org/publication/PubMed/19668749"
}
]
},
{
"title": "Erratum to: Blood HbO2 and HbCO2 dissociation curves at varied O2, CO2, pH, 2,3-DPG and temperature levels.",
"journal": "Annals of biomedical engineering",
"date": "2010",
"authors": "Dash RK, Bassingthwaighte JB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "20162361",
"url": "https://glygen.org/publication/PubMed/20162361"
}
]
},
{
"title": "Direct determination of protonation states of histidine residues in a 2 A neutron structure of deoxy-human normal adult hemoglobin and implications for the Bohr effect.",
"journal": "Journal of molecular biology",
"date": "2010",
"authors": "Kovalevsky AY, Chatake T, Shibayama N, Park SY, Ishikawa T, Mustyakimov M, Fisher Z, Langan P, Morimoto Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "20230836",
"url": "https://glygen.org/publication/PubMed/20230836"
}
]
},
{
"title": "Identification of potent and selective human carbonic anhydrase VII (hCA VII) inhibitors.",
"journal": "ChemMedChem",
"date": "2010",
"authors": "Gitto R, Agnello S, Ferro S, Vullo D, Supuran CT, Chimirri A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "20349499",
"url": "https://glygen.org/publication/PubMed/20349499"
}
]
},
{
"title": "Analysis of a shortened form of human carbonic anhydrase VII expressed in vitro compared to the full-length enzyme.",
"journal": "Biochimie",
"date": "2010",
"authors": "Bootorabi F, Janis J, Smith E, Waheed A, Kukkurainen S, Hytonen V, Valjakka J, Supuran CT, Vullo D, Sly WS, Parkkila S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "20493921",
"url": "https://glygen.org/publication/PubMed/20493921"
}
]
},
{
"title": "Structural and kinetic study of the extended active site for proton transfer in human carbonic anhydrase II.",
"journal": "Biochemistry",
"date": "2010",
"authors": "Domsic JF, Williams W, Fisher SZ, Tu C, Agbandje-McKenna M, Silverman DN, McKenna R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "20578724",
"url": "https://glygen.org/publication/PubMed/20578724"
}
]
},
{
"title": "Protonation states of histidine and other key residues in deoxy normal human adult hemoglobin by neutron protein crystallography.",
"journal": "Acta crystallographica. Section D, Biological crystallography",
"date": "2010",
"authors": "Kovalevsky A, Chatake T, Shibayama N, Park SY, Ishikawa T, Mustyakimov M, Fisher SZ, Langan P, Morimoto Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "21041929",
"url": "https://glygen.org/publication/PubMed/21041929"
}
]
},
{
"title": "Carbonic anhydrase IV from human lung. Purification, characterization, and comparison with membrane carbonic anhydrase from human kidney.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Zhu XL, Sly WS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "2111324",
"url": "https://glygen.org/publication/PubMed/2111324"
}
]
},
{
"title": "Structure and methylation patterns of the gene encoding human carbonic anhydrase I.",
"journal": "Gene",
"date": "1990",
"authors": "Lowe N, Brady H J, Barlow J H, Sowden J C, Edwards M, Butterworth P H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "2121614",
"url": "https://glygen.org/publication/PubMed/2121614"
}
]
},
{
"title": "Intramolecular proton shuttle supports not only catalytic but also noncatalytic function of carbonic anhydrase II.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2011",
"authors": "Becker HM, Klier M, Schuler C, McKenna R, Deitmer JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "21282642",
"url": "https://glygen.org/publication/PubMed/21282642"
}
]
},
{
"title": "Buffer enhancement of proton transfer in catalysis by human carbonic anhydrase III.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Tu CK, Paranawithana SR, Jewell DA, Tanhauser SM, LoGrasso PV, Wynns GC, Laipis PJ, Silverman DN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "2169869",
"url": "https://glygen.org/publication/PubMed/2169869"
}
]
},
{
"title": "Structure and catalysis by carbonic anhydrase II: role of active-site tryptophan 5.",
"journal": "Archives of biochemistry and biophysics",
"date": "2011",
"authors": "Mikulski R, Domsic JF, Ling G, Tu C, Robbins AH, Silverman DN, McKenna R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "22001224",
"url": "https://glygen.org/publication/PubMed/22001224"
}
]
},
{
"title": "Proton magnetic resonance studies of carbonic anhydrase. II. Group controlling catalytic activity.",
"journal": "Biochemistry",
"date": "1975",
"authors": "Pesando JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "234739",
"url": "https://glygen.org/publication/PubMed/234739"
}
]
},
{
"title": "The exomes of the NCI-60 panel: a genomic resource for cancer biology and systems pharmacology.",
"journal": "Cancer research",
"date": "2013",
"authors": "Abaan OD, Polley EC, Davis SR, Zhu YJ, Bilke S, Walker RL, Pineda M, Gindin Y, Jiang Y, Reinhold WC, Holbeck SL, Simon RM, Doroshow JH, Pommier Y, Meltzer PS",
"evidence": [
{
"database": "dbSNP",
"id": "rs767885397",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767885397"
}
],
"reference": [
{
"type": "PubMed",
"id": "23856246",
"url": "https://glygen.org/publication/PubMed/23856246"
}
]
},
{
"title": "Aberrant O-GlcNAc-modified proteins expressed in primary colorectal cancer.",
"journal": "Oncology reports",
"date": "2013",
"authors": "Phueaouan T, Chaiyawat P, Netsirisawan P, Chokchaichamnankit D, Punyarit P, Srisomsap C, Svasti J, Champattanachai V",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P00915",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "24126823",
"url": "https://glygen.org/publication/PubMed/24126823"
}
]
},
{
"title": "Hyperoxic intubation apnoea: an in vivo model for the proof of the Christiansen-Douglas-Haldane effect.",
"journal": "Advances in experimental medicine and biology",
"date": "1989",
"authors": "Mertzlufft F, Brandt L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673"
}
],
"reference": [
{
"type": "PubMed",
"id": "2506737",
"url": "https://glygen.org/publication/PubMed/2506737"
}
]
},
{
"title": "Carbonic anhydrase inhibition by acetazolamide reduces in vitro epileptiform synchronization.",
"journal": "Neuropharmacology",
"date": "2015",
"authors": "Hamidi S, Avoli M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "25937211",
"url": "https://glygen.org/publication/PubMed/25937211"
}
]
},
{
"title": "Activation parameters for the carbonic anhydrase II-catalyzed hydration of CO2.",
"journal": "The Journal of biological chemistry",
"date": "1986",
"authors": "Ghannam AF, Tsen W, Rowlett RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "3080418",
"url": "https://glygen.org/publication/PubMed/3080418"
}
]
},
{
"title": "Human carbonic anhydrase I cDNA.",
"journal": "Nucleic Acids Res.",
"date": "1987",
"authors": "Barlow J H, Lowe N, Edwards Y H, Butterworth P H",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "3104879",
"url": "https://glygen.org/publication/PubMed/3104879"
}
]
},
{
"title": "Carbon dioxide and oxygen linkage in human hemoglobin tetramers.",
"journal": "Journal of molecular biology",
"date": "1987",
"authors": "Doyle ML, Di Cera E, Robert CH, Gill SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673"
}
],
"reference": [
{
"type": "PubMed",
"id": "3119859",
"url": "https://glygen.org/publication/PubMed/3119859"
}
]
},
{
"title": "Human whole-blood O2 affinity: effect of CO2.",
"journal": "Journal of applied physiology (Bethesda, Md. : 1985)",
"date": "1988",
"authors": "Kwant G, Oeseburg B, Zwart A, Zijlstra WG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "3136125",
"url": "https://glygen.org/publication/PubMed/3136125"
}
]
},
{
"title": "Overexpression of CA1 mRNA and the CA I Protein in Tumor Cells Does Not Change the Gene Expression of the ECM Proteins.",
"journal": "International journal of molecular sciences",
"date": "2020",
"authors": "Lakota J, Dubrovcakova M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
}
],
"reference": [
{
"type": "PubMed",
"id": "31963697",
"url": "https://glygen.org/publication/PubMed/31963697"
}
]
},
{
"title": "Comprehensive Analysis for Identifying Diagnostic and Prognostic Biomarkers in Colon Adenocarcinoma.",
"journal": "DNA and cell biology",
"date": "2020",
"authors": "Liu Z, Bai Y, Xie F, Miao F, Du F",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
}
],
"reference": [
{
"type": "PubMed",
"id": "32031891",
"url": "https://glygen.org/publication/PubMed/32031891"
}
]
},
{
"title": "The Effect of Nanoparticles on the Structure and Enzymatic Activity of Human Carbonic Anhydrase I and II.",
"journal": "Molecules (Basel, Switzerland)",
"date": "2020",
"authors": "Cabaleiro-Lago C, Lundqvist M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
}
],
"reference": [
{
"type": "PubMed",
"id": "32992797",
"url": "https://glygen.org/publication/PubMed/32992797"
}
]
},
{
"title": "Carbonic anhydrase activity in the frontal lobe of human brain.",
"journal": "NMR in biomedicine",
"date": "2021",
"authors": "Li S, An L, Ferraris Araneta M, Victorino M, Johnson CS, Shen J",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001122301",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122301"
}
],
"reference": [
{
"type": "PubMed",
"id": "33682938",
"url": "https://glygen.org/publication/PubMed/33682938"
}
]
},
{
"title": "Contribution of the Haldane effect to the increase in arterial carbon dioxide tension in hypoxaemic subjects treated with oxygen.",
"journal": "Advances in experimental medicine and biology",
"date": "1985",
"authors": "Kraan J, Rispens P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673"
}
],
"reference": [
{
"type": "PubMed",
"id": "3938604",
"url": "https://glygen.org/publication/PubMed/3938604"
}
]
},
{
"title": "Mechanism and kinetics of the Haldane effect in human erythrocytes.",
"journal": "Journal of applied physiology",
"date": "1973",
"authors": "Klocke RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673"
}
],
"reference": [
{
"type": "PubMed",
"id": "4203704",
"url": "https://glygen.org/publication/PubMed/4203704"
}
]
},
{
"title": "Human carbonic anhydrases. XII. The complete primary structure of the C isozyme.",
"journal": "The Journal of biological chemistry",
"date": "1974",
"authors": "Lin KT, Deutsch HF",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "4207120",
"url": "https://glygen.org/publication/PubMed/4207120"
}
]
},
{
"title": "[Primary structure of human B erythrocyte carbonic anhydrase. 3. Sequence of CNBr fragment I and III (residues 149-260)].",
"journal": "Biochimie",
"date": "1974",
"authors": "Giraud N, Marriq C, Laurent-Tabusse G",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "4217196",
"url": "https://glygen.org/publication/PubMed/4217196"
}
]
},
{
"title": "Interaction of 13 CO 2 and bicarbonate with human hemoglobin preparations.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1973",
"authors": "Morrow JS, Keim P, Visscher RB, Marshall RC, Gurd FR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "4514311",
"url": "https://glygen.org/publication/PubMed/4514311"
}
]
},
{
"title": "Structure of human carbonic anhydrase B. I. Crystallization and heavy atom modifications.",
"journal": "J. Mol. Biol.",
"date": "1972",
"authors": "Kannan K K, Fridborg K, Bergst\u00e9n P C, Liljas A, L\u00f6vgren S, Petef M, Strandberg B, Waara I, Adler L, Falkbring S O, G\u00f6the P O, Nyman P O",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "4622589",
"url": "https://glygen.org/publication/PubMed/4622589"
}
]
},
{
"title": "Amino acid sequence of human erythrocyte carbonic anhydrase B.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "1972",
"authors": "Andersson B, Nyman P O, Strid L",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "4625868",
"url": "https://glygen.org/publication/PubMed/4625868"
}
]
},
{
"title": "Human carbonic anhydrases. XI. The complete primary structure of carbonic anhydrase B.",
"journal": "J. Biol. Chem.",
"date": "1973",
"authors": "Lin K T, Deutsch H F",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "4632246",
"url": "https://glygen.org/publication/PubMed/4632246"
}
]
},
{
"title": "Carbamino compounds of haemoglobin in human adult and foetal blood.",
"journal": "The Journal of physiology",
"date": "1972",
"authors": "Bauer C, Schroder E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "4647257",
"url": "https://glygen.org/publication/PubMed/4647257"
}
]
},
{
"title": "Thermal studies of the rates of the reactions of carbon dioxide in concentrated haemoglobin solutions and in red blood cells. A. The reactions catalysed by carbonic anhydrase. B. The carbamino reactions of oxygenated and deoxygenated haemoglobin.",
"journal": "The Journal of physiology",
"date": "1968",
"authors": "Kernohan JC, Roughton FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "4975618",
"url": "https://glygen.org/publication/PubMed/4975618"
}
]
},
{
"title": "The carbon dioxide hydration activity of carbonic anhydrase. I. Stop-flow kinetic studies on the native human isoenzymes B and C.",
"journal": "The Journal of biological chemistry",
"date": "1971",
"authors": "Khalifah RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "4994926",
"url": "https://glygen.org/publication/PubMed/4994926"
}
]
},
{
"title": "Reaction of CO2 with human hemoglobin solution.",
"journal": "The Journal of biological chemistry",
"date": "1968",
"authors": "Forster RE, Constantine HP, Craw MR, Rotman HH, Klocke RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "5656372",
"url": "https://glygen.org/publication/PubMed/5656372"
}
]
},
{
"title": "A chemical and enzymological comparison of the common major human erythrocyte carbonic anhydrase II, its minor component, and a new genetic variant, CA II Melbourne (237 Pro leads to His).",
"journal": "Human genetics",
"date": "1983",
"authors": "Jones GL, Shaw DC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "6407977",
"url": "https://glygen.org/publication/PubMed/6407977"
}
]
},
{
"title": "Quantitative analyses of the CO2 dissociation curve of oxygenated blood and the Haldane effect in human blood.",
"journal": "The Japanese journal of physiology",
"date": "1983",
"authors": "Tazawa H, Mochizuki M, Tamura M, Kagawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673"
}
],
"reference": [
{
"type": "PubMed",
"id": "6417382",
"url": "https://glygen.org/publication/PubMed/6417382"
}
]
},
{
"title": "Structure, refinement, and function of carbonic anhydrase isozymes: refinement of human carbonic anhydrase I.",
"journal": "Ann. N. Y. Acad. Sci.",
"date": "1984",
"authors": "Kannan KK, Ramanadham M, Jones TA",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "6430186",
"url": "https://glygen.org/publication/PubMed/6430186"
}
]
},
{
"title": "Anion inhibition of CO2 hydration catalyzed by human carbonic anhydrase II. Mechanistic implications.",
"journal": "Biochimica et biophysica acta",
"date": "1984",
"authors": "Tibell L, Forsman C, Simonsson I, Lindskog S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "6433979",
"url": "https://glygen.org/publication/PubMed/6433979"
}
]
},
{
"title": "Population genetic studies of the Philippine Negritos. III. Identification of the carbonic anhydrase-1 variant with CA1 Guam.",
"journal": "American journal of human genetics",
"date": "1981",
"authors": "Omoto K, Ueda S, Goriki K, Takahashi N, Misawa S, Pagaran IG",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "6781336",
"url": "https://glygen.org/publication/PubMed/6781336"
}
]
},
{
"title": "A 13C nuclear magnetic resonance study of CO2/HCO-3 exchange catalyzed by human carbonic anhydrase I.",
"journal": "European journal of biochemistry",
"date": "1982",
"authors": "Simonsson I, Jonsson BH, Lindskog S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "6819139",
"url": "https://glygen.org/publication/PubMed/6819139"
}
]
},
{
"title": "The Haldane effect under different acid-base conditions in premature and adult humans.",
"journal": "Advances in experimental medicine and biology",
"date": "1994",
"authors": "Kalhoff H, Werkmeister F, Kiwull-Schone H, Diekmann L, Manz F, Kiwull P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1247673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673"
}
],
"reference": [
{
"type": "PubMed",
"id": "7541176",
"url": "https://glygen.org/publication/PubMed/7541176"
}
]
},
{
"title": "Carbonic anhydrase IV: role of removal of C-terminal domain in glycosylphosphatidylinositol anchoring and realization of enzyme activity.",
"journal": "Archives of biochemistry and biophysics",
"date": "1995",
"authors": "Okuyama T, Waheed A, Kusumoto W, Zhu XL, Sly WS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "7625839",
"url": "https://glygen.org/publication/PubMed/7625839"
}
]
},
{
"title": "Marked zinc activation of ester hydrolysis by a mutation, 67-His (CAT) to Arg (CGT), in the active site of human carbonic anhydrase I.",
"journal": "Human mutation",
"date": "1994",
"authors": "Chegwidden WR, Wagner LE, Venta PJ, Bergenhem NC, Yu YS, Tashian RE",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "7866410",
"url": "https://glygen.org/publication/PubMed/7866410"
}
]
},
{
"title": "Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.",
"journal": "J. Mol. Biol.",
"date": "1994",
"authors": "Chakravarty S, Kannan KK",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "7932756",
"url": "https://glygen.org/publication/PubMed/7932756"
}
]
},
{
"title": "Crystal structure of human erythrocyte carbonic anhydrase B. Three-dimensional structure at a nominal 2.2-A resolution.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1975",
"authors": "Kannan KK, Notstrand B, Fridborg K, Lovgren S, Ohlsson A, Petef M",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "804171",
"url": "https://glygen.org/publication/PubMed/804171"
}
]
},
{
"title": "Enzyme-substrate interactions. Structure of human carbonic anhydrase I complexed with bicarbonate.",
"journal": "J. Mol. Biol.",
"date": "1994",
"authors": "Kumar V, Kannan KK",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"reference": [
{
"type": "PubMed",
"id": "8057362",
"url": "https://glygen.org/publication/PubMed/8057362"
}
]
},
{
"title": "Binding of dorzolamide and its metabolite, N-deethylated dorzolamide, to human erythrocytes in vitro.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "1994",
"authors": "Hasegawa T, Hara K, Hata S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "8070313",
"url": "https://glygen.org/publication/PubMed/8070313"
}
]
},
{
"title": "Interactions of active-site residues and catalytic activity of human carbonic anhydrase III.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Tu C, Chen X, Ren X, LoGrasso PV, Jewell DA, Laipis PJ, Silverman DN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "8083199",
"url": "https://glygen.org/publication/PubMed/8083199"
}
]
},
{
"title": "Electrostatic modification at the amino termini of hemoglobin A.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Acharya AS, Bobelis DJ, White SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "8300612",
"url": "https://glygen.org/publication/PubMed/8300612"
}
]
},
{
"title": "Human mitochondrial carbonic anhydrase: cDNA cloning, expression, subcellular localization, and mapping to chromosome 16.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1993",
"authors": "Nagao Y, Platero JS, Waheed A, Sly WS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "8356065",
"url": "https://glygen.org/publication/PubMed/8356065"
}
]
},
{
"title": "Rate-equilibria relationships in intramolecular proton transfer in human carbonic anhydrase III.",
"journal": "Biochemistry",
"date": "1993",
"authors": "Silverman DN, Tu C, Chen X, Tanhauser SM, Kresge AJ, Laipis PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "8399223",
"url": "https://glygen.org/publication/PubMed/8399223"
}
]
},
{
"title": "The preclinical pharmacology of dorzolamide hydrochloride, a topical carbonic anhydrase inhibitor.",
"journal": "Journal of ocular pharmacology and therapeutics : the official journal of the Association for Ocular Pharmacology and Therapeutics",
"date": "1996",
"authors": "Sugrue MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "8875343",
"url": "https://glygen.org/publication/PubMed/8875343"
}
]
},
{
"title": "The asymmetry of chloride transport at 38 degrees C in human red blood cell membranes.",
"journal": "The Journal of general physiology",
"date": "1996",
"authors": "Knauf PA, Gasbjerg PK, Brahm J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "8972395",
"url": "https://glygen.org/publication/PubMed/8972395"
}
]
},
{
"title": "Catalysis and inhibition of human carbonic anhydrase IV.",
"journal": "Biochemistry",
"date": "1997",
"authors": "Baird TT Jr, Waheed A, Okuyama T, Sly WS, Fierke CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "9054574",
"url": "https://glygen.org/publication/PubMed/9054574"
}
]
},
{
"title": "Dorzolamide. A review of its pharmacology and therapeutic potential in the management of glaucoma and ocular hypertension.",
"journal": "Drugs & aging",
"date": "1997",
"authors": "Balfour JA, Wilde MI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "9143858",
"url": "https://glygen.org/publication/PubMed/9143858"
}
]
},
{
"title": "Structure and mechanism of carbonic anhydrase.",
"journal": "Pharmacology & therapeutics",
"date": "1997",
"authors": "Lindskog S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "9336012",
"url": "https://glygen.org/publication/PubMed/9336012"
}
]
},
{
"title": "Effect of expressing the water channel aquaporin-1 on the CO2 permeability of Xenopus oocytes.",
"journal": "The American journal of physiology",
"date": "1998",
"authors": "Nakhoul NL, Davis BA, Romero MF, Boron WF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1237044",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044"
}
],
"reference": [
{
"type": "PubMed",
"id": "9486145",
"url": "https://glygen.org/publication/PubMed/9486145"
}
]
},
{
"title": "Properties of intramolecular proton transfer in carbonic anhydrase III.",
"journal": "Biophysical journal",
"date": "1998",
"authors": "Tu C, Qian M, Earnhardt JN, Laipis PJ, Silverman DN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "9635771",
"url": "https://glygen.org/publication/PubMed/9635771"
}
]
},
{
"title": "Gustin from human parotid saliva is carbonic anhydrase VI.",
"journal": "Biochemical and biophysical research communications",
"date": "1998",
"authors": "Thatcher BJ, Doherty AE, Orvisky E, Martin BM, Henkin RI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1475029",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029"
}
],
"reference": [
{
"type": "PubMed",
"id": "9784398",
"url": "https://glygen.org/publication/PubMed/9784398"
}
]
}
],
"pathway": [
{
"id": "hsa:759",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:759",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-1237044",
"name": "Erythrocytes take up carbon dioxide and release oxygen",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1237044",
"resource": "Reactome",
"description": "Erythrocytes take up carbon dioxide and release oxygen"
},
{
"id": "R-HSA-1247673",
"name": "Erythrocytes take up oxygen and release carbon dioxide",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1247673",
"resource": "Reactome",
"description": "Erythrocytes take up oxygen and release carbon dioxide"
},
{
"id": "R-HSA-1475029",
"name": "Reversible hydration of carbon dioxide",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475029",
"resource": "Reactome",
"description": "Reversible hydration of carbon dioxide"
},
{
"id": "R-HSA-8950505",
"name": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505",
"resource": "Reactome",
"description": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "B0BNN3-1",
"protein_name": "Carbonic anhydrase 1",
"gene_name": "Ca1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF",
"length": 261
},
"evidence": [
{
"id": "45922311",
"url": "http://www.informatics.jax.org/homology/45922311",
"database": "MGI"
},
{
"id": "P00915",
"url": "https://omabrowser.org/oma/group/P00915/",
"database": "OMA"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P13634-1",
"protein_name": "Carbonic anhydrase 1",
"gene_name": "Ca1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLKPLSISYNPATAKEIVNVGHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSLQKVLDALNSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF",
"length": 261
},
"evidence": [
{
"id": "45922311",
"url": "http://www.informatics.jax.org/homology/45922311",
"database": "MGI"
},
{
"id": "P00915",
"url": "https://omabrowser.org/oma/group/P00915/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 5,
"go_terms": [
{
"name": "zinc ion binding",
"id": "GO:0008270",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
},
{
"name": "carbonate dehydratase activity",
"id": "GO:0004089",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004089",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
},
{
"name": "arylesterase activity",
"id": "GO:0004064",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004064",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
},
{
"name": "hydro-lyase activity",
"id": "GO:0016836",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016836",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
},
{
"name": "cyanamide hydratase activity",
"id": "GO:0018820",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018820",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 2,
"go_terms": [
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
},
{
"name": "extracellular exosome",
"id": "GO:0070062",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 1,
"go_terms": [
{
"name": "one-carbon metabolic process",
"id": "GO:0006730",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006730",
"evidence": [
{
"database": "UniProtKB",
"id": "P00915",
"url": "https://www.uniprot.org/uniprot/P00915"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 28,
"end_pos": 30,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 76,
"end_pos": 78,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "10748",
"name": "",
"equation": "H(+) + hydrogencarbonate = CO2 + H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"B0BNN3-1",
"Q66HG6-1",
"P43165-1",
"P14141-1",
"P27139-1",
"P48284-1",
"F1LQ08-1",
"B5DFG6-1",
"F7FL00-1",
"F7FAJ9-1",
"A0A8I6AP85-1",
"A6JXV1-1",
"P43166-1",
"Q9ULX7-1",
"P23280-1",
"Q9Y2D0-1",
"Q8N1Q1-1",
"P00918-1",
"P07451-1",
"P35218-1",
"O43570-1",
"Q16790-1",
"P22748-1",
"P00915-1",
"Q64444-1",
"Q9QZA0-1",
"P18761-1",
"Q99N23-1",
"Q9ERQ8-1",
"Q8VHB5-1",
"P23589-1",
"Q8CI85-1",
"Q9WVT6-1",
"P13634-1",
"P00920-1",
"P16015-1",
"Q9D6N1-1",
"P53615-1",
"Q555A3-1",
"Q55BU2-1",
"Q9V9Y6-1",
"Q9VHJ5-1",
"Q9V9Y8-1",
"A0A0B4LHX0-1",
"Q9VH26-1",
"Q8IMV4-1",
"Q9VB76-1",
"Q4V4S9-1",
"Q9V396-1"
],
"evidence": [
{
"id": "10748",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/10748"
}
]
},
{
"id": "23056",
"name": "",
"equation": "urea = cyanamide + H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"B0BNN3-1",
"P27139-1",
"P00918-1",
"P00915-1",
"P00920-1",
"P13634-1",
"P0CH63-1",
"P0CH64-1"
],
"evidence": [
{
"id": "23056",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/23056"
}
]
},
{
"id": "R-HSA-1475022",
"name": "Carbonic anhydrase dehydrates bicarbonate (cytosol)",
"equation": "",
"summary": "Carbonic anhydrase I (CA1, Khalifah 1971, Simonsson et al. 1982, Ren and Lindskog 1992), carbonic anyhydrase II (CA2, Tibell et al. 1984, Jones and Shaw 1983, Pesando 1975, Ghannam et al. 1986), carbonic anhydrase III (CA3, Carter et al. 1979, Tu et al. 1990, Tu et al. 1994, Tu et al. 1998, Silverman et al. 1993), carbonic anhydrase VII (CA7, Bootorabi et al. 2010, Gitto et al. 2010) dehydrate cytosolic bicarbonate to yield water and carbon dioxide (reviewed in Lindskog 1997). Depending on the concentrations of reactants the reaction is reversible.
CA2 and CA7 have high catalytic activity, CA1 has low activity (10% of the activity of CA2), and CA3 has very low activity (1% of the activity of CA2). CA1 and CA2 are found in erythrocytes. CA2 is also found in kidney, lung, and white muscle where it facilitates diffusion of carbon dioxide. CA3 is found in red muscle where it participates in resistance against oxidative stress.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00915-1",
"P07451-1",
"P43166-1",
"Q8N1Q1-1",
"P00918-1"
],
"evidence": [
{
"id": "R-HSA-1475022",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475022"
}
]
},
{
"id": "R-HSA-1475026",
"name": "Carbonic anhydrase hydrates carbon dioxide (cytosol)",
"equation": "",
"summary": "Carbonic anhydrase I (CA1, Khalifah 1971, Simonsson et al. 1982, Ren and Lindskog 1992), carbonic anyhydrase II (CA2, Tibell et al. 1984, Jones and Shaw 1983, Pesando 1975, Ghannam et al. 1986), carbonic anhydrase III (CA3, Carter et al. 1979, Tu et al. 1990, Tu et al. 1994, Tu et al. 1998, Silverman et al. 1993), carbonic anhydrase VII (CA7, Bootorabi et al. 2010, Gitto et al. 2010) hydrate carbon dioxide to yield bicarbonate and a proton. Carbonic anhydrase deprotonates water to yield a zinc-hydroxyl group and a proton which is transferred to external buffer molecules via histidine or glutamate residues in carbonic anhydrase. The hydroxyl group reacts with carbon dioxide in the active site to yield bicarbonate. A water molecule displaces the bicarbonate and the reaction cycle begins again (reviewed in Lindskog 1997). Depending on the concentrations of reactants the reaction is reversible.
CA2 and CA7 have high catalytic activity, CA1 has low activity (10% of the activity of CA2), and CA3 has very low activity (1% of the activity of CA2). CA1 and CA2 are found in erythrocytes. CA2 is also found in kidney, lung, and white muscle where it facilitates diffusion of carbon dioxide. CA3 is found in red muscle where it participates in resistance against oxidative stress.",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-113528"
],
"output_participant_list": [],
"enzyme_list": [
"P00915-1",
"P07451-1",
"P43166-1",
"Q8N1Q1-1",
"P00918-1"
],
"evidence": [
{
"id": "R-HSA-1475026",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475026"
}
]
},
{
"id": "R-HSA-1475435",
"name": "CA1:Zn2+,CA2:Zn2+ hydrate CO2 to HCO3-",
"equation": "",
"summary": "Carbonic anhydrase I (CA1, Khalifah 1971, Pesando 1975, Simonsson et al. 1982, Ren & Lindskog 1992) and carbonic anhydrase II (CA2, Tibell et al. 1984, Jones & Shaw 1983, Ghannam et al. 1986) hydrate carbon dioxide (CO2) to yield bicarbonate (HCO3-) and a proton (H+). During the reaction a hydroxyl group bound by the zinc ion (Zn2+) attacks the CO2 molecule in the active site to directly form HCO3- (reviewed in Lindskog 1997). The HCO3- is displaced by water, which is then deprotonated by a histidine residue to recreate the Zn2+:hydroxyl group. Depending on the concentrations of reactants the reaction is reversible.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00915-1",
"P00918-1"
],
"evidence": [
{
"id": "R-HSA-1475435",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475435"
}
]
},
{
"id": "R-HSA-1475436",
"name": "CA1:Zn2+,CA2:Zn2+ dehydrate HCO3- to CO2",
"equation": "",
"summary": "Carbonic anhydrase I (CA1, Khalifah 1971, Pesando 1975, Simonsson et al. 1982, Ren & Lindskog 1992) and carbonic anhydrase II (CA2, Tibell et al. 1984, Jones & Shaw 1983, Ghannam et al. 1986) hydrate carbon dioxide (CO2) to yield bicarbonate (HCO3-) and a proton (H+). During the reaction a hydroxyl group bound by the zinc ion (Zn2+) attacks the CO2 molecule in the active site to directly form HCO3- (reviewed in Lindskog 1997). The HCO3- is displaced by water, which is then deprotonated by a histidine residue to recreate the Zn2+:hydroxyl group. Depending on the concentrations of reactants the reaction is reversible.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00915-1",
"P00918-1"
],
"evidence": [
{
"id": "R-HSA-1475436",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1475436"
}
]
},
{
"id": "R-HSA-8950623",
"name": "Expression of Carbonic anhydrase 1",
"equation": "",
"summary": "Experiments using human cord blood CD4(+) T cells show 22 protein spots and 20 protein spots, upregulated and downregulated proteins respectively, following Interleukin-12 stimulation (Rosengren et.al, 2005). Among the up-regulated proteins is Carbonic anhydrase 1 (CA1).",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-8950385"
],
"output_participant_list": [
"R-HSA-1237027"
],
"enzyme_list": [
"P00915-1"
],
"evidence": [
{
"id": "R-HSA-8950623",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950623"
}
]
},
{
"id": "R-HSA-9707419",
"name": "CA1:Zn2+,CA2:Zn2+ bind CA inhibitors",
"equation": "",
"summary": "Erythrocytes take up oxygen and release carbon dioxide in the capillaries of the lung. In other tissues of the body the reverse reaction occurs; erythrocytes take up carbon dioxide from and deliver oxygen to cells. Carbonic anhydrases (CAs) are metalloenzymes that catalyze the interconversion between carbon dioxide (CO2) and water (H2O) and the dissociated ions of carbonic acid, i.e. bicarbonate (HCO3-) and protons (H+). The active site of most CAs contains a zinc ion. CAs maintain acid-base balance and help transport carbon dioxide. Depending on the concentrations of reactants, the reaction is reversible.
Carbonic anhydrase inhibitors have been developed to treat glaucoma via their effect on reducing intraocular pressure and decreasing aqueous humor and in managing seizures in various epileptic conditions (Supuran et al. 2003). In the ocular ciliary processes, the local production of bicarbonate by CAs promotes sodium and fluid transport. CA2 is a key isoenzyme found primarily in red blood cells (RBCs) that regulates aqueous humour production (Balfour et al. 1997, Hasegawa et al. 1994). The inhibition of CA2 in the ciliary process disrupts the formation of bicarbonate ions and reduces sodium and fluid transport, which leads to decreased aqueous humour secretion and reduced intraocular pressure (Sugrue 1996, Sugrue 2000, Iester 2008). Brinzolamide, dorzolamide, diclofenamide, ethoxzolamide and methazolamide are topical carbonic anhydrase (CA) inhibitors that treats elevated intraocular pressure (IOP) associated with open-angle glaucoma and ocular hypertension (Mincione et al. 2008).
Acetazolamide, toprimate, sultiame and zonisamide are effective in the treatment of most types of seizures, including generalized tonic-clonic and focal seizures and absence seizures (Hamidi & Avoli 2015, Aggarwal et al. 2013). They are thought to reduce seizures through the inhibition of CA, thereby increasing CO2 levels in the brain.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00915-1",
"P00918-1"
],
"evidence": [
{
"id": "R-HSA-9707419",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707419"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-113528",
"participant_name": "CO2 [cytosol]",
"crossref": [
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00011",
"database": "COMPOUND",
"url": ""
},
{
"id": "16526",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001967",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "11533283",
"database": "PubChem Substance",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1237027",
"participant_name": "CA1 [cytosol]",
"crossref": [
{
"id": "6I0J",
"database": "PDB",
"url": ""
},
{
"id": "2FOY",
"database": "PDB",
"url": ""
},
{
"id": "2597",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "6XZX",
"database": "PDB",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "6EVR",
"database": "PDB",
"url": ""
},
{
"id": "3LXE",
"database": "PDB",
"url": ""
},
{
"id": "7Q0D",
"database": "PDB",
"url": ""
},
{
"id": "6Y00",
"database": "PDB",
"url": ""
},
{
"id": "NP_001729.1",
"database": "RefSeq",
"url": ""
},
{
"id": "6XZO",
"database": "PDB",
"url": ""
},
{
"id": "1CRM",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000431316",
"database": "Ensembl",
"url": ""
},
{
"id": "1J9W",
"database": "PDB",
"url": ""
},
{
"id": "4.2.1.69",
"database": "IntEnz",
"url": ""
},
{
"id": "4WR7",
"database": "PDB",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "2NN1",
"database": "PDB",
"url": ""
},
{
"id": "2NMX",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000133742",
"database": "OpenTargets",
"url": ""
},
{
"id": "6HWZ",
"database": "PDB",
"url": ""
},
{
"id": "P00915",
"database": "GeneCards",
"url": ""
},
{
"id": "6XZS",
"database": "PDB",
"url": ""
},
{
"id": "NP_001158302.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2NN7",
"database": "PDB",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "ENSP00000430656",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001122302.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1CZM",
"database": "PDB",
"url": ""
},
{
"id": "NP_001122303.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000133742-CA1",
"database": "HPA",
"url": ""
},
{
"id": "6XZE",
"database": "PDB",
"url": ""
},
{
"id": "1JV0",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000542576",
"database": "Ensembl",
"url": ""
},
{
"id": "2CAB",
"database": "PDB",
"url": ""
},
{
"id": "6EX1",
"database": "PDB",
"url": ""
},
{
"id": "NP_001122301.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P00915",
"database": "UniProt",
"url": ""
},
{
"id": "P00915",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000429798",
"database": "Ensembl",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "6SWM",
"database": "PDB",
"url": ""
},
{
"id": "4WUQ",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000392338",
"database": "Ensembl",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENST00000523022",
"database": "Ensembl",
"url": ""
},
{
"id": "7PLF",
"database": "PDB",
"url": ""
},
{
"id": "P00915",
"database": "ZINC target",
"url": ""
},
{
"id": "3W6I",
"database": "PDB",
"url": ""
},
{
"id": "6F3B",
"database": "PDB",
"url": ""
},
{
"id": "2IT4",
"database": "PDB",
"url": ""
},
{
"id": "6FAG",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000443517",
"database": "Ensembl",
"url": ""
},
{
"id": "4WUP",
"database": "PDB",
"url": ""
},
{
"id": "7ZL5",
"database": "PDB",
"url": ""
},
{
"id": "P00915",
"database": "PRO",
"url": ""
},
{
"id": "5GMM",
"database": "PDB",
"url": ""
},
{
"id": "3W6H",
"database": "PDB",
"url": ""
},
{
"id": "1HUH",
"database": "PDB",
"url": ""
},
{
"id": "2FW4",
"database": "PDB",
"url": ""
},
{
"id": "6G3V",
"database": "PDB",
"url": ""
},
{
"id": "6I0L",
"database": "PDB",
"url": ""
},
{
"id": "1HCB",
"database": "PDB",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "7QOB",
"database": "PDB",
"url": ""
},
{
"id": "1AZM",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000523953",
"database": "Ensembl",
"url": ""
},
{
"id": "1BZM",
"database": "PDB",
"url": ""
},
{
"id": "6FAF",
"database": "PDB",
"url": ""
},
{
"id": "CAH1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "5E2M",
"database": "PDB",
"url": ""
},
{
"id": "6XZY",
"database": "PDB",
"url": ""
},
{
"id": "1HUG",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000133742",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP02057",
"database": "HMDB Protein",
"url": ""
}
]
},
{
"participant_id": "R-HSA-8950385",
"participant_name": "CA1 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000133742",
"database": "ENSEMBL",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A0B4LHX0",
"gene_name": "CAH16",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "A0A0B4LHX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0B4LHX0"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "A0A0B4LHX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0B4LHX0"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6AP85",
"gene_name": "AABR07063126.1",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "A0A8I6AP85",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AP85"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "A0A8I6AP85",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AP85"
}
]
}
]
},
{
"uniprot_ac": "A6JXV1",
"gene_name": "Car7",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "A6JXV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A6JXV1"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "A6JXV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A6JXV1"
}
]
}
]
},
{
"uniprot_ac": "B0BNN3",
"gene_name": "Ca1",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "B0BNN3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B0BNN3"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "B0BNN3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B0BNN3"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "B0BNN3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B0BNN3"
}
]
}
]
},
{
"uniprot_ac": "B5DFG6",
"gene_name": "Car13",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "B5DFG6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B5DFG6"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "B5DFG6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B5DFG6"
}
]
}
]
},
{
"uniprot_ac": "F1LQ08",
"gene_name": "Car6",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "F1LQ08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LQ08"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "F1LQ08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LQ08"
}
]
}
]
},
{
"uniprot_ac": "F7FAJ9",
"gene_name": "Car12",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "F7FAJ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F7FAJ9"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "F7FAJ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F7FAJ9"
}
]
}
]
},
{
"uniprot_ac": "F7FL00",
"gene_name": "Car9",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "F7FL00",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F7FL00"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "F7FL00",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F7FL00"
}
]
}
]
},
{
"uniprot_ac": "O43570",
"gene_name": "CA12",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "O43570",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43570"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "O43570",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43570"
}
]
}
]
},
{
"uniprot_ac": "P00915",
"gene_name": "CA1",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P00915",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00915"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P00915",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00915"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P00915",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00915"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "",
"evidence": [
{
"id": "P00915",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00915"
}
]
}
]
},
{
"uniprot_ac": "P00918",
"gene_name": "CA2",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P00918",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00918"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P00918",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00918"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P00918",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00918"
}
]
}
]
},
{
"uniprot_ac": "P00920",
"gene_name": "Ca2",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P00920",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00920"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P00920",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00920"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P00920",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00920"
}
]
}
]
},
{
"uniprot_ac": "P07451",
"gene_name": "CA3",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P07451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07451"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P07451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07451"
}
]
}
]
},
{
"uniprot_ac": "P0CH63",
"gene_name": "DDI2",
"activity": [
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P0CH63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CH63"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "",
"evidence": [
{
"id": "P0CH63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CH63"
}
]
}
]
},
{
"uniprot_ac": "P0CH64",
"gene_name": "DDI3",
"activity": [
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P0CH64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CH64"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "",
"evidence": [
{
"id": "P0CH64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CH64"
}
]
}
]
},
{
"uniprot_ac": "P13634",
"gene_name": "Ca1",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P13634",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13634"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P13634",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13634"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P13634",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13634"
}
]
}
]
},
{
"uniprot_ac": "P14141",
"gene_name": "Ca3",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P14141",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14141"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P14141",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14141"
}
]
}
]
},
{
"uniprot_ac": "P16015",
"gene_name": "Ca3",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P16015",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16015"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P16015",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16015"
}
]
}
]
},
{
"uniprot_ac": "P18761",
"gene_name": "Ca6",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P18761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18761"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P18761",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18761"
}
]
}
]
},
{
"uniprot_ac": "P22748",
"gene_name": "CA4",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P22748",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22748"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P22748",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22748"
}
]
}
]
},
{
"uniprot_ac": "P23280",
"gene_name": "CA6",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P23280",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23280"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P23280",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23280"
}
]
}
]
},
{
"uniprot_ac": "P23589",
"gene_name": "Ca5a",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P23589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23589"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P23589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23589"
}
]
}
]
},
{
"uniprot_ac": "P27139",
"gene_name": "Ca2",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P27139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P27139"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P27139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P27139"
}
]
},
{
"ec_number": "4.2.1.69",
"activity": "urea = cyanamide + H2O.",
"evidence": [
{
"id": "P27139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P27139"
}
]
}
]
},
{
"uniprot_ac": "P35218",
"gene_name": "CA5A",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P35218",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35218"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P35218",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P35218"
}
]
}
]
},
{
"uniprot_ac": "P43165",
"gene_name": "Ca5a",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P43165",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43165"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P43165",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43165"
}
]
}
]
},
{
"uniprot_ac": "P43166",
"gene_name": "CA7",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P43166",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43166"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P43166",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P43166"
}
]
}
]
},
{
"uniprot_ac": "P48284",
"gene_name": "Ca4",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P48284",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48284"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P48284",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48284"
}
]
}
]
},
{
"uniprot_ac": "P53615",
"gene_name": "NCE103",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "P53615",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53615"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "P53615",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53615"
}
]
}
]
},
{
"uniprot_ac": "Q16790",
"gene_name": "CA9",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q16790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16790"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q16790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16790"
}
]
}
]
},
{
"uniprot_ac": "Q4V4S9",
"gene_name": "CAH8",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q4V4S9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V4S9"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q4V4S9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V4S9"
}
]
}
]
},
{
"uniprot_ac": "Q555A3",
"gene_name": "",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q555A3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q555A3"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q555A3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q555A3"
}
]
}
]
},
{
"uniprot_ac": "Q55BU2",
"gene_name": "cahA",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q55BU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55BU2"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q55BU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55BU2"
}
]
}
]
},
{
"uniprot_ac": "Q64444",
"gene_name": "Ca4",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q64444",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64444"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q64444",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64444"
}
]
}
]
},
{
"uniprot_ac": "Q66HG6",
"gene_name": "Ca5b",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q66HG6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q66HG6"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q66HG6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q66HG6"
}
]
}
]
},
{
"uniprot_ac": "Q8CI85",
"gene_name": "Ca12",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q8CI85",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CI85"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q8CI85",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CI85"
}
]
}
]
},
{
"uniprot_ac": "Q8IMV4",
"gene_name": "CAH4",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q8IMV4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IMV4"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q8IMV4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IMV4"
}
]
}
]
},
{
"uniprot_ac": "Q8N1Q1",
"gene_name": "CA13",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q8N1Q1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N1Q1"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q8N1Q1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N1Q1"
}
]
}
]
},
{
"uniprot_ac": "Q8VHB5",
"gene_name": "Ca9",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q8VHB5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VHB5"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q8VHB5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VHB5"
}
]
}
]
},
{
"uniprot_ac": "Q99N23",
"gene_name": "Ca15",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q99N23",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99N23"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q99N23",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99N23"
}
]
}
]
},
{
"uniprot_ac": "Q9D6N1",
"gene_name": "Ca13",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9D6N1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D6N1"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9D6N1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D6N1"
}
]
}
]
},
{
"uniprot_ac": "Q9ERQ8",
"gene_name": "Ca7",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9ERQ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ERQ8"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9ERQ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ERQ8"
}
]
}
]
},
{
"uniprot_ac": "Q9QZA0",
"gene_name": "Ca5b",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9QZA0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QZA0"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9QZA0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QZA0"
}
]
}
]
},
{
"uniprot_ac": "Q9ULX7",
"gene_name": "CA14",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9ULX7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULX7"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9ULX7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULX7"
}
]
}
]
},
{
"uniprot_ac": "Q9V396",
"gene_name": "CAH1",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9V396",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V396"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9V396",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V396"
}
]
}
]
},
{
"uniprot_ac": "Q9V9Y6",
"gene_name": "CAH5",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9V9Y6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V9Y6"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9V9Y6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V9Y6"
}
]
}
]
},
{
"uniprot_ac": "Q9V9Y8",
"gene_name": "CAH6",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9V9Y8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V9Y8"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9V9Y8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9V9Y8"
}
]
}
]
},
{
"uniprot_ac": "Q9VB76",
"gene_name": "CAH9",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9VB76",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VB76"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9VB76",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VB76"
}
]
}
]
},
{
"uniprot_ac": "Q9VH26",
"gene_name": "CAH7",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9VH26",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VH26"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9VH26",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VH26"
}
]
}
]
},
{
"uniprot_ac": "Q9VHJ5",
"gene_name": "CAHbeta",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9VHJ5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHJ5"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9VHJ5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHJ5"
}
]
}
]
},
{
"uniprot_ac": "Q9WVT6",
"gene_name": "Ca14",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9WVT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVT6"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9WVT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVT6"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2D0",
"gene_name": "CA5B",
"activity": [
{
"ec_number": "4.2.1.1",
"activity": "H(+) + hydrogencarbonate = CO2 + H2O.",
"evidence": [
{
"id": "Q9Y2D0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2D0"
}
]
},
{
"ec_number": "4.2.1.1",
"activity": "",
"evidence": [
{
"id": "Q9Y2D0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2D0"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [
130,
218
],
"snv_sites": [
14,
35,
37,
207,
216,
218,
247
],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": [
{
"start_pos": 28,
"end_pos": 30
},
{
"start_pos": 76,
"end_pos": 78
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 2
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 2
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 7
},
{
"field": "total_sites",
"count": 7
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 6
},
{
"field": "total_sites",
"count": 6
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 112
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}