{ "uniprot_canonical_ac": "O75593-1", "uniprot_ac": "O75593", "uniprot_id": "FOXH1_HUMAN", "mass": { "chemical_mass": 39257.0, "monoisotopic_mass": 39257.0 }, "refseq": { "ac": "NP_003914", "name": "forkhead box protein H1", "summary": "FOXH1 encodes a human homolog of Xenopus forkhead activin signal transducer-1. FOXH1 protein binds SMAD2 and activates an activin response element via binding the DNA motif TGT(G/T)(T/G)ATT. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" }, "gene_names": [ { "name": "FOXH1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75593", "id": "O75593" }, { "name": "FAST-1; FAST1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914", "id": "NP_003914" }, { "name": "FAST1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75593", "id": "O75593" }, { "name": "FAST2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75593", "id": "O75593" }, { "name": "FOXH1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914", "id": "NP_003914" } ], "protein_names": [ { "name": "Forkhead box protein H1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75593" }, { "name": "Fast-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75593" }, { "name": "Fast-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75593" }, { "name": "Forkhead activin signal transducer 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75593" }, { "name": "Forkhead activin signal transducer 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75593" }, { "name": "TGF-beta/activin signal transducer; forkhead activin signal transducer-1; fast-2; hFAST-1; forkhead activin signal transducer 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914", "id": "NP_003914" }, { "name": "forkhead box protein H1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914", "id": "NP_003914" }, { "name": "hFAST-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75593" } ], "function": [ { "annotation": "A comprehensive analysis of FOX family in HCC and experimental evidence to support the oncogenic role of FOXH1.", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" }, { "database": "PubMed", "id": "35255005", "url": "https://glygen.org/publication/PubMed/35255005" } ] }, { "annotation": "FOXH1 encodes a human homolog of Xenopus forkhead activin signal transducer-1. FOXH1 protein binds SMAD2 and activates an activin response element via binding the DNA motif TGT(G/T)(T/G)ATT. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" } ] }, { "annotation": "Identification of FOXH1 mutations in patients with sporadic conotruncal heart defect.", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" }, { "database": "PubMed", "id": "32003456", "url": "https://glygen.org/publication/PubMed/32003456" } ] }, { "annotation": "Large-scale whole-exome sequencing association study identifies FOXH1 gene and sphingolipid metabolism pathway influencing major depressive disorder.", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" }, { "database": "PubMed", "id": "34633764", "url": "https://glygen.org/publication/PubMed/34633764" } ] }, { "annotation": "Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" }, { "database": "PubMed", "id": "36435807", "url": "https://glygen.org/publication/PubMed/36435807" } ] }, { "annotation": "Transcriptional activator. Recognizes and binds to the DNA sequence 5'-TGT[GT][GT]ATT-3'. Required for induction of the goosecoid (GSC) promoter by TGF-beta or activin signaling. Forms a transcriptionally active complex containing FOXH1/SMAD2/SMAD4 on a site on the GSC promoter called TARE (TGF-beta/activin response element).", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593#function" }, { "database": "PubMed", "id": "9702198", "url": "https://glygen.org/publication/PubMed/9702198" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O75593", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75593" } ], "glycoeffect": [], "start_pos": 257, "end_pos": 257, "subjects_tested": "92", "subjects_positive": "1", "frequency": "1.1", "sequence_org": "G", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "chr_id": "8", "chr_pos": "144474566", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "G257", "keywords": [ "biomuta", "somatic", "cancer" ] } ], "mutagenesis": [ { "start_pos": 83, "end_pos": 83, "sequence_org": "H", "sequence_mut": "R", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" }, { "database": "PubMed", "id": "9702198", "url": "https://glygen.org/publication/PubMed/9702198" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "56.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "42.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "51.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "77.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "69.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "62.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "52.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "49.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "62.03", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "41.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "57.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "51.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75593" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "common_name": "Human" } ], "gene": [ { "name": "FOXH1", "url": "https://www.uniprot.org/uniprot/O75593", "locus": { "chromosome": "8", "start_pos": 144473412, "end_pos": 144475849, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000160973", "url": "https://www.ensembl.org/id/ENSG00000160973" } ] } } ], "crossref": [ { "id": "ENSG00000160973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160973", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75593", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75593", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd20022", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20022", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FOXH1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FOXH1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8928", "url": "https://www.ncbi.nlm.nih.gov/gene/8928", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3814", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3814", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75593", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75593*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030456", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030456", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047511", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047511", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8928", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8928", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603621", "url": "http://www.omim.org/entry/603621", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75593", "url": "https://www.nextprot.org/entry/NX_O75593", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75593", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75593", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "WGVASET", "url": "https://omabrowser.org/oma/group/WGVASET/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5385885at2759", "url": "http://www.orthodb.org/?query=5385885at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47316", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47316", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47316:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47316:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5XOC", "url": "https://www.rcsb.org/structure/5XOC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7YZB", "url": "https://www.rcsb.org/structure/7YZB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00250", "url": "http://pfam.xfam.org/family/PF00250", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75593", "url": "https://pharos.nih.gov/targets/O75593", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75593", "url": "http://purl.obolibrary.org/obo/PR_O75593", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9796292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9796292", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75593-1", "url": "https://www.uniprot.org/uniprot/O75593-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL", "length": 365, "header": "sp|O75593-1|FOXH1_HUMAN Isoform 1 of Forkhead box protein H1 OS=Homo sapiens OX=9606 GN=FOXH1 PE=1 SV=1 CANONICAL=O75593-1" }, "isoforms": [ { "isoform_ac": "O75593-1", "url": "", "sequence": { "sequence": "MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL", "length": 365, "header": "sp|O75593-1|FOXH1_HUMAN Isoform 1 of Forkhead box protein H1 OS=Homo sapiens OX=9606 GN=FOXH1 PE=1 SV=1 CANONICAL=O75593-1" }, "locus": { "chromosome": "8", "start_pos": 144475756, "end_pos": 144474241, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000377317.5", "url": "https://www.ensembl.org/id/ENST00000377317.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000366534.4", "url": "https://www.ensembl.org/id/ENSP00000366534.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O75593", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75593" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 265, "end_pos": 265, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75593", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75593" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser265" }, { "start_pos": 266, "end_pos": 266, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75593", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75593" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser266" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Expression of the Sonic hedgehog (SHH ) gene during early human development and phenotypic expression of new mutations causing holoprosencephaly.", "journal": "Human molecular genetics", "date": "1999", "authors": "Odent S, Atti-Bitach T, Blayau M, Mathieu M, Aug J, Delezo de AL, Gall JY, Le Marec B, Munnich A, David V, Vekemans M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9796292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9796292" } ], "reference": [ { "type": "PubMed", "id": "10441331", "url": "https://glygen.org/publication/PubMed/10441331" } ] }, { "title": "The role of FAST-1 and Smads in transcriptional regulation by activin during early Xenopus embryogenesis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yeo CY, Chen X, Whitman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "10473623", "url": "https://glygen.org/publication/PubMed/10473623" } ] }, { "title": "Heterogeneities in the biological and biochemical functions of Smad2 and Smad4 mutants naturally occurring in human lung cancers.", "journal": "Oncogene", "date": "2000", "authors": "Yanagisawa K, Uchida K, Nagatake M, Masuda A, Sugiyama M, Saito T, Yamaki K, Takahashi T, Osada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "10822381", "url": "https://glygen.org/publication/PubMed/10822381" } ] }, { "title": "The nuclear import function of Smad2 is masked by SARA and unmasked by TGFbeta-dependent phosphorylation.", "journal": "Nature cell biology", "date": "2000", "authors": "Xu L, Chen YG, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "10934479", "url": "https://glygen.org/publication/PubMed/10934479" } ] }, { "title": "Nodal signaling uses activin and transforming growth factor-beta receptor-regulated Smads.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kumar A, Novoselov V, Celeste AJ, Wolfman NM, ten Dijke P, Kuehn MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "11024047", "url": "https://glygen.org/publication/PubMed/11024047" } ] }, { "title": "Truncated activin type I receptor Alk4 isoforms are dominant negative receptors inhibiting activin signaling.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2000", "authors": "Zhou Y, Sun H, Danila DC, Johnson SR, Sigai DP, Zhang X, Klibanski A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "11117535", "url": "https://glygen.org/publication/PubMed/11117535" } ] }, { "title": "Transforming growth factor-beta induces nuclear import of Smad3 in an importin-beta1 and Ran-dependent manner.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Kurisaki A, Kose S, Yoneda Y, Heldin CH, Moustakas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "11294908", "url": "https://glygen.org/publication/PubMed/11294908" } ] }, { "title": "Nodal signals to Smads through Cripto-dependent and Cripto-independent mechanisms.", "journal": "Molecular cell", "date": "2001", "authors": "Yeo C, Whitman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "11389842", "url": "https://glygen.org/publication/PubMed/11389842" } ] }, { "title": "The orphan receptor ALK7 and the Activin receptor ALK4 mediate signaling by Nodal proteins during vertebrate development.", "journal": "Genes & development", "date": "2001", "authors": "Reissmann E, Jornvall H, Blokzijl A, Andersson O, Chang C, Minchiotti G, Persico MG, Ibanez CF, Brivanlou AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "11485994", "url": "https://glygen.org/publication/PubMed/11485994" } ] }, { "title": "Crystal structure of a phosphorylated Smad2. Recognition of phosphoserine by the MH2 domain and insights on Smad function in TGF-beta signaling.", "journal": "Molecular cell", "date": "2001", "authors": "Wu JW, Hu M, Chai J, Seoane J, Huse M, Li C, Rigotti DJ, Kyin S, Muir TW, Fairman R, Massague J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "11779503", "url": "https://glygen.org/publication/PubMed/11779503" } ] }, { "title": "Structural basis of Smad1 activation by receptor kinase phosphorylation.", "journal": "Molecular cell", "date": "2001", "authors": "Qin BY, Chacko BM, Lam SS, de Caestecker MP, Correia JJ, Lin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "11779505", "url": "https://glygen.org/publication/PubMed/11779505" } ] }, { "title": "cDNA cloning, expression studies and chromosome mapping of human type I serine/threonine kinase receptor ALK7 (ACVR1C).", "journal": "Cytogenetics and cell genetics", "date": "2001", "authors": "Bondestam J, Huotari MA, Moren A, Ustinov J, Kaivo-Oja N, Kallio J, Horelli-Kuitunen N, Aaltonen J, Fujii M, Moustakas A, Ten Dijke P, Otonkoski T, Ritvos O", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "12063393", "url": "https://glygen.org/publication/PubMed/12063393" } ] }, { "title": "An extended bipartite nuclear localization signal in Smad4 is required for its nuclear import and transcriptional activity.", "journal": "Oncogene", "date": "2003", "authors": "Xiao Z, Latek R, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "12592392", "url": "https://glygen.org/publication/PubMed/12592392" } ] }, { "title": "SB-505124 is a selective inhibitor of transforming growth factor-beta type I receptors ALK4, ALK5, and ALK7.", "journal": "Molecular pharmacology", "date": "2004", "authors": "DaCosta Byfield S, Major C, Laping NJ, Roberts AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "14978253", "url": "https://glygen.org/publication/PubMed/14978253" } ] }, { "title": "Receptor internalization-independent activation of Smad2 in activin signaling.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Zhou Y, Scolavino S, Funderburk SF, Ficociello LF, Zhang X, Klibanski A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "15087470", "url": "https://glygen.org/publication/PubMed/15087470" } ] }, { "title": "Differences between human and mouse embryonic stem cells.", "journal": "Developmental biology", "date": "2004", "authors": "Ginis I, Luo Y, Miura T, Thies S, Brandenberger R, Gerecht-Nir S, Amit M, Hoke A, Carpenter MK, Itskovitz-Eldor J, Rao MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "15110706", "url": "https://glygen.org/publication/PubMed/15110706" } ] }, { "title": "An activin mutant with disrupted ALK4 binding blocks signaling via type II receptors.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Harrison CA, Gray PC, Fischer WH, Donaldson C, Choe S, Vale W", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "15123686", "url": "https://glygen.org/publication/PubMed/15123686" } ] }, { "title": "Nodal and ALK7 inhibit proliferation and induce apoptosis in human trophoblast cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Munir S, Xu G, Wu Y, Yang B, Lala PK, Peng C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "15150278", "url": "https://glygen.org/publication/PubMed/15150278" } ] }, { "title": "Structural basis of heteromeric smad protein assembly in TGF-beta signaling.", "journal": "Molecular cell", "date": "2004", "authors": "Chacko BM, Qin BY, Tiwari A, Shi G, Lam S, Hayward LJ, De Caestecker M, Lin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "15350224", "url": "https://glygen.org/publication/PubMed/15350224" } ] }, { "title": "ALK7, a receptor for nodal, is dispensable for embryogenesis and left-right patterning in the mouse.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Jornvall H, Reissmann E, Andersson O, Mehrkash M, Ibanez CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "15485907", "url": "https://glygen.org/publication/PubMed/15485907" } ] }, { "title": "Nodal induces apoptosis and inhibits proliferation in human epithelial ovarian cancer cells via activin receptor-like kinase 7.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Xu G, Zhong Y, Munir S, Yang BB, Tsang BK, Peng C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "15531507", "url": "https://glygen.org/publication/PubMed/15531507" } ] }, { "title": "Activin A mediates growth inhibition and cell cycle arrest through Smads in human breast cancer cells.", "journal": "Cancer research", "date": "2005", "authors": "Burdette JE, Jeruss JS, Kurley SJ, Lee EJ, Woodruff TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "16140969", "url": "https://glygen.org/publication/PubMed/16140969" } ] }, { "title": "Kinetic analysis of Smad nucleocytoplasmic shuttling reveals a mechanism for transforming growth factor beta-dependent nuclear accumulation of Smads.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Schmierer B, Hill CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "16260601", "url": "https://glygen.org/publication/PubMed/16260601" } ] }, { "title": "Analysis of Oct4-dependent transcriptional networks regulating self-renewal and pluripotency in human embryonic stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2007", "authors": "Babaie Y, Herwig R, Greber B, Brink TC, Wruck W, Groth D, Lehrach H, Burdon T, Adjaye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "17068183", "url": "https://glygen.org/publication/PubMed/17068183" } ] }, { "title": "Endofin, a FYVE domain protein, interacts with Smad4 and facilitates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen YG, Wang Z, Ma J, Zhang L, Lu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "17272273", "url": "https://glygen.org/publication/PubMed/17272273" } ] }, { "title": "MicroRNA miR-24 inhibits erythropoiesis by targeting activin type I receptor ALK4.", "journal": "Blood", "date": "2008", "authors": "Wang Q, Huang Z, Xue H, Jin C, Ju XL, Han JD, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "17906079", "url": "https://glygen.org/publication/PubMed/17906079" } ] }, { "title": "Short-term BMP-4 treatment initiates mesoderm induction in human embryonic stem cells.", "journal": "Blood", "date": "2008", "authors": "Zhang P, Li J, Tan Z, Wang C, Liu T, Chen L, Yong J, Jiang W, Sun X, Du L, Ding M, Deng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "18042803", "url": "https://glygen.org/publication/PubMed/18042803" } ] }, { "title": "Activin signals via SMAD2/3 between germ and somatic cells in the human fetal ovary and regulates kit ligand expression.", "journal": "Developmental biology", "date": "2008", "authors": "Coutts SM, Childs AJ, Fulton N, Collins C, Bayne RA, McNeilly AS, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "18166170", "url": "https://glygen.org/publication/PubMed/18166170" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O75593", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75593" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Analysis of the temporal and concentration-dependent effects of BMP-4, VEGF, and TPO on development of embryonic stem cell-derived mesoderm and blood progenitors in a defined, serum-free media.", "journal": "Experimental hematology", "date": "2008", "authors": "Purpura KA, Morin J, Zandstra PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "18550259", "url": "https://glygen.org/publication/PubMed/18550259" } ] }, { "title": "Robust generation of hemangioblastic progenitors from human embryonic stem cells.", "journal": "Regenerative medicine", "date": "2008", "authors": "Lu SJ, Luo C, Holton K, Feng Q, Ivanova Y, Lanza R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "18729794", "url": "https://glygen.org/publication/PubMed/18729794" } ] }, { "title": "Insulin gene is a target in activin receptor-like kinase 7 signaling pathway in pancreatic beta-cells.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Watanabe R, Shen ZP, Tsuda K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "18951876", "url": "https://glygen.org/publication/PubMed/18951876" } ] }, { "title": "Nucleocytoplasmic shuttling of Smad proteins.", "journal": "Cell research", "date": "2009", "authors": "Hill CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "19114992", "url": "https://glygen.org/publication/PubMed/19114992" } ] }, { "title": "Coupling of dephosphorylation and nuclear export of Smads in TGF-beta signaling.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2010", "authors": "Dai F, Duan X, Liang YY, Lin X, Feng XH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "20694664", "url": "https://glygen.org/publication/PubMed/20694664" } ] }, { "title": "missing tag=TI", "journal": "missing tag=JT", "date": "missing", "authors": "author information missing", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "21229555", "url": "https://glygen.org/publication/PubMed/21229555" } ] }, { "title": "Pluripotency factors regulate definitive endoderm specification through eomesodermin.", "journal": "Genes & development", "date": "2011", "authors": "Teo AK, Arnold SJ, Trotter MW, Brown S, Ang LT, Chng Z, Robertson EJ, Dunn NR, Vallier L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "21245162", "url": "https://glygen.org/publication/PubMed/21245162" } ] }, { "title": "Nodal signals through activin receptor-like kinase 7 to inhibit trophoblast migration and invasion: implication in the pathogenesis of preeclampsia.", "journal": "The American journal of pathology", "date": "2011", "authors": "Nadeem L, Munir S, Fu G, Dunk C, Baczyk D, Caniggia I, Lye S, Peng C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "21356369", "url": "https://glygen.org/publication/PubMed/21356369" } ] }, { "title": "Nodal and activin receptor-like kinase 7 induce apoptosis in human breast cancer cell lines: Role of caspase 3.", "journal": "International journal of physiology, pathophysiology and pharmacology", "date": "2009", "authors": "Zhong Y, Xu G, Ye G, Lee D, Modica-Amore J, Peng C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "21383881", "url": "https://glygen.org/publication/PubMed/21383881" } ] }, { "title": "Nodal enhances the activity of FoxO3a and its synergistic interaction with Smads to regulate cyclin G2 transcription in ovarian cancer cells.", "journal": "Oncogene", "date": "2011", "authors": "Fu G, Peng C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "21532621", "url": "https://glygen.org/publication/PubMed/21532621" } ] }, { "title": "Chromatin and transcriptional signatures for Nodal signaling during endoderm formation in hESCs.", "journal": "Developmental biology", "date": "2011", "authors": "Kim SW, Yoon SJ, Chuong E, Oyolu C, Wills AE, Gupta R, Baker J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9796292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9796292" } ], "reference": [ { "type": "PubMed", "id": "21741376", "url": "https://glygen.org/publication/PubMed/21741376" } ] }, { "title": "Transcription factor binding dynamics during human ES cell differentiation.", "journal": "Nature", "date": "2015", "authors": "Tsankov AM, Gu H, Akopian V, Ziller MJ, Donaghey J, Amit I, Gnirke A, Meissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "25693565", "url": "https://glygen.org/publication/PubMed/25693565" } ] }, { "title": "beta-Catenin Regulates Primitive Streak Induction through Collaborative Interactions with SMAD2/SMAD3 and OCT4.", "journal": "Cell stem cell", "date": "2015", "authors": "Funa NS, Schachter KA, Lerdrup M, Ekberg J, Hess K, Dietrich N, Honore C, Hansen K, Semb H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "25921273", "url": "https://glygen.org/publication/PubMed/25921273" } ] }, { "title": "SMADs and YAP compete to control elongation of beta-catenin:LEF-1-recruited RNAPII during hESC differentiation.", "journal": "Molecular cell", "date": "2015", "authors": "Estaras C, Benner C, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "25936800", "url": "https://glygen.org/publication/PubMed/25936800" } ] }, { "title": "Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors.", "journal": "Nature communications", "date": "2017", "authors": "Martin-Malpartida P, Batet M, Kaczmarska Z, Freier R, Gomes T, Aragon E, Zou Y, Wang Q, Xi Q, Ruiz L, Vea A, Marquez JA, Massague J, Macias MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "29234012", "url": "https://glygen.org/publication/PubMed/29234012" } ] }, { "title": "Derivation of notochordal cells from human embryonic stem cells reveals unique regulatory networks by single cell-transcriptomics.", "journal": "Journal of cellular physiology", "date": "2020", "authors": "Diaz-Hernandez ME, Khan NM, Trochez CM, Yoon T, Maye P, Presciutti SM, Gibson G, Drissi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9796292", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9796292" } ], "reference": [ { "type": "PubMed", "id": "31840817", "url": "https://glygen.org/publication/PubMed/31840817" } ] }, { "title": "Identification of FOXH1 mutations in patients with sporadic conotruncal heart defect.", "journal": "Clinical genetics", "date": "2020", "authors": "Wei W, Li B, Li F, Sun K, Jiang X, Xu R", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" } ], "reference": [ { "type": "PubMed", "id": "32003456", "url": "https://glygen.org/publication/PubMed/32003456" } ] }, { "title": "TATA box-binding protein-related factor 3 drives the mesendoderm specification of human embryonic stem cells by globally interacting with the TATA box of key mesendodermal genes.", "journal": "Stem cell research & therapy", "date": "2020", "authors": "Liang H, Zhang P, Bai HJ, Huang J, Yang HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "32448362", "url": "https://glygen.org/publication/PubMed/32448362" } ] }, { "title": "Large-scale whole-exome sequencing association study identifies FOXH1 gene and sphingolipid metabolism pathway influencing major depressive disorder.", "journal": "CNS neuroscience & therapeutics", "date": "2021", "authors": "Zhou W, Chen L, Jiang B, Sun Y, Li M, Wu H, Zhang N, Sun X, Qin S", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" } ], "reference": [ { "type": "PubMed", "id": "34633764", "url": "https://glygen.org/publication/PubMed/34633764" } ] }, { "title": "A comprehensive analysis of FOX family in HCC and experimental evidence to support the oncogenic role of FOXH1.", "journal": "Aging", "date": "2022", "authors": "Ouyang X, Feng L, Yao L, Zhang J, Xiao Y, Liu G, Zhang G, Wang Z", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" } ], "reference": [ { "type": "PubMed", "id": "35255005", "url": "https://glygen.org/publication/PubMed/35255005" } ] }, { "title": "Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.", "journal": "Nature communications", "date": "2022-11-26", "authors": "Pluta Radoslaw, Arag\u00f3n Eric, Prescott Nicholas A, Ruiz Lidia, Mees Rebeca A, Baginski Blazej, Flood Julia R, Martin-Malpartida Pau, Massagu\u00e9 Joan, David Yael, Macias Maria J", "evidence": [ { "database": "RefSeq", "id": "NP_003914", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003914" } ], "reference": [ { "type": "PubMed", "id": "36435807", "url": "https://glygen.org/publication/PubMed/36435807" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75593", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75593" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Type I receptors specify growth-inhibitory and transcriptional responses to transforming growth factor beta and activin.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Carcamo J, Weis FM, Ventura F, Wieser R, Wrana JL, Attisano L, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "8196624", "url": "https://glygen.org/publication/PubMed/8196624" } ] }, { "title": "Activation of signalling by the activin receptor complex.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Attisano L, Wrana JL, Montalvo E, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "8622651", "url": "https://glygen.org/publication/PubMed/8622651" } ] }, { "title": "Formation and activation by phosphorylation of activin receptor complexes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1996", "authors": "Willis SA, Zimmerman CM, Li LI, Mathews LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "8721982", "url": "https://glygen.org/publication/PubMed/8721982" } ] }, { "title": "A transcriptional partner for MAD proteins in TGF-beta signalling.", "journal": "Nature", "date": "1996", "authors": "Chen X, Rubock MJ, Whitman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "8878477", "url": "https://glygen.org/publication/PubMed/8878477" } ] }, { "title": "Activin and inhibin have antagonistic effects on ligand-dependent heteromerization of the type I and type II activin receptors and human erythroid differentiation.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Lebrun JJ, Vale WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "9032295", "url": "https://glygen.org/publication/PubMed/9032295" } ] }, { "title": "Smad4 and FAST-1 in the assembly of activin-responsive factor.", "journal": "Nature", "date": "1997", "authors": "Chen X, Weisberg E, Fridmacher V, Watanabe M, Naco G, Whitman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "9288972", "url": "https://glygen.org/publication/PubMed/9288972" } ] }, { "title": "TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.", "journal": "The EMBO journal", "date": "1997", "authors": "Nakao A, Imamura T, Souchelnytskyi S, Kawabata M, Ishisaki A, Oeda E, Tamaki K, Hanai J, Heldin CH, Miyazono K, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "9311995", "url": "https://glygen.org/publication/PubMed/9311995" } ] }, { "title": "Negative autoregulation of the organizer-specific homeobox gene goosecoid.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Danilov V, Blum M, Schweickert A, Campione M, Steinbeisser H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9754189", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189" } ], "reference": [ { "type": "PubMed", "id": "9417125", "url": "https://glygen.org/publication/PubMed/9417125" } ] }, { "title": "Regulation of activin type I receptor function by phosphorylation of residues outside the GS domain.", "journal": "FEBS letters", "date": "1997", "authors": "Willis SA, Mathews LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1502540", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540" } ], "reference": [ { "type": "PubMed", "id": "9459292", "url": "https://glygen.org/publication/PubMed/9459292" } ] }, { "title": "Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors.", "journal": "The EMBO journal", "date": "1998", "authors": "Kawabata M, Inoue H, Hanyu A, Imamura T, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "9670020", "url": "https://glygen.org/publication/PubMed/9670020" } ] }, { "title": "Characterization of human FAST-1, a TGF beta and activin signal transducer.", "journal": "Molecular cell", "date": "1998", "authors": "Zhou S, Zawel L, Lengauer C, Kinzler KW, Vogelstein B", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" }, { "database": "Reactome", "id": "R-HSA-1181150", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150" } ], "reference": [ { "type": "PubMed", "id": "9702198", "url": "https://glygen.org/publication/PubMed/9702198" } ] } ], "pathway": [ { "id": "hsa:8928", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8928", "resource": "KEGG Pathway" }, { "id": "R-HSA-1181150", "name": "Signaling by NODAL", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1181150", "resource": "Reactome", "description": "Signaling by NODAL" }, { "id": "R-HSA-1502540", "name": "Signaling by Activin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1502540", "resource": "Reactome", "description": "Signaling by Activin" }, { "id": "R-HSA-9754189", "name": "Germ layer formation at gastrulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754189", "resource": "Reactome", "description": "Germ layer formation at gastrulation" }, { "id": "R-HSA-9796292", "name": "Formation of axial mesoderm", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9796292", "resource": "Reactome", "description": "Formation of axial mesoderm" } ], "orthologs": [ { "uniprot_canonical_ac": "G3V7Y6-1", "protein_name": "Forkhead box H1", "gene_name": "Foxh1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASGWDLASTYSPTTLSPQLVQALAQGYIPCMGPLDNSQLRPPEAESLSKTPKRRKKRYLRHDKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHRAFAKDLSPYVLHGQPYRPPSPPPPSREDFSIKSLLGDPGKASTWPQHPRLAGQSTPAQASTLSKGEEGIGAGPSNVSDKPLWPLSSLPRPTRIEGETSQGEVIRPSPVSSDQGSWPLHLLQDSSDSMGMSRRGSRASLWGQLPTSYLPIYTPNVVMPLATLPPTSCPRCPSSASPAYWSVGTESQGSQDLLCDLDSLFQGVPPNKSIYDVWVSHPRDLAAPAPGWLLSWYSM", "length": 401 }, "evidence": [ { "id": "45917507", "url": "http://www.informatics.jax.org/homology/45917507", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O88621-1", "protein_name": "Forkhead box protein H1", "gene_name": "Foxh1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASGWDLASTYTPTTPSPQLALAPAQGYLPCMGPRDNSQLRPPEAESLSKTPKRRKKRYLRHDKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFHKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHRAFAKDLSPYVLHGQPYQPPSPPPPPREGFSIKSLLGDPGKESTWPQHPGLPGQSTAAQAGTLSKGEEGMGTGPSSSSETPLWPLCSLPGPTIIEGESSQGEVIRPSPVTPDQGSWPLHLLEDSADSRGVPRRGSRASLWGQLPTSYLPIYTPNVVMPLATLPTTSCPQCPSSASPAYWSVGTESQGSQDLLCDLDSLFQGVPPNKSIYDVWVSHPRDLAAPAPGWLLSWYSM", "length": 401 }, "evidence": [ { "id": "45917507", "url": "http://www.informatics.jax.org/homology/45917507", "database": "MGI" }, { "id": "O75593", "url": "https://omabrowser.org/oma/group/O75593/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "co-SMAD binding", "id": "GO:0070410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070410", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "SMAD binding", "id": "GO:0046332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046332", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "cis-regulatory region sequence-specific DNA binding", "id": "GO:0000987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000987", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "nuclear androgen receptor binding", "id": "GO:0050681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050681", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "R-SMAD binding", "id": "GO:0070412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070412", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "bHLH transcription factor binding", "id": "GO:0043425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043425", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 19, "go_terms": [ { "name": "determination of left/right asymmetry in lateral mesoderm", "id": "GO:0003140", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003140", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "transforming growth factor beta receptor signaling pathway", "id": "GO:0007179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007179", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "nodal signaling pathway", "id": "GO:0038092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038092", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "heart looping", "id": "GO:0001947", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001947", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "cellular response to cytokine stimulus", "id": "GO:0071345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071345", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "aorta morphogenesis", "id": "GO:0035909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035909", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "hepatocyte differentiation", "id": "GO:0070365", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070365", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "outflow tract morphogenesis", "id": "GO:0003151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003151", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "secondary heart field specification", "id": "GO:0003139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003139", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "negative regulation of DNA-binding transcription factor activity", "id": "GO:0043433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043433", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "cardiac right ventricle morphogenesis", "id": "GO:0003215", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003215", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "ventricular trabecula myocardium morphogenesis", "id": "GO:0003222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003222", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "negative regulation of intracellular estrogen receptor signaling pathway", "id": "GO:0033147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033147", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "embryonic heart tube anterior/posterior pattern specification", "id": "GO:0035054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035054", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "negative regulation of androgen receptor signaling pathway", "id": "GO:0060766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060766", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "axial mesoderm development", "id": "GO:0048318", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048318", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" }, { "name": "activin responsive factor complex", "id": "GO:0032444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032444", "evidence": [ { "database": "UniProtKB", "id": "O75593", "url": "https://www.uniprot.org/uniprot/O75593" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 337, "end_pos": 339, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 257 ], "glycation_sites": [], "phosphorylation_sites": [ 265, 266 ], "sequon_annotation_sites": [ { "start_pos": 337, "end_pos": 339 }, { "start_pos": 84, "end_pos": 86 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 62 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }