{ "uniprot_canonical_ac": "O75376-1", "uniprot_ac": "O75376", "uniprot_id": "NCOR1_HUMAN", "mass": { "chemical_mass": 270210.0, "monoisotopic_mass": 270210.0 }, "refseq": { "ac": "NP_001177367", "name": "nuclear receptor corepressor 1 isoform 2", "summary": "This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 17 and 20.[provided by RefSeq, Jun 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" }, "gene_names": [ { "name": "NCOR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75376", "id": "O75376" }, { "name": "KIAA1047", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75376", "id": "O75376" }, { "name": "NCOR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367", "id": "NP_001177367" }, { "name": "hN-CoR; N-CoR; N-CoR1; PPP1R109; TRAC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367", "id": "NP_001177367" } ], "protein_names": [ { "name": "Nuclear receptor corepressor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75376" }, { "name": "N-CoR1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75376" }, { "name": "N-CoR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75376" }, { "name": "nuclear receptor corepressor 1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367", "id": "NP_001177367" }, { "name": "thyroid hormone- and retinoic acid receptor-associated corepressor 1; protein phosphatase 1, regulatory subunit 109", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367", "id": "NP_001177367" } ], "function": [ { "annotation": "Exploring TBL1XR1 and NCOR1 Expression in B-cell Lymphoma Subtypes: Interaction With DNA Damage Repair Genes.", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" }, { "database": "PubMed", "id": "37909960", "url": "https://glygen.org/publication/PubMed/37909960" } ] }, { "annotation": "Mediates transcriptional repression by certain nuclear receptors (PubMed:20812024). Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription factors. Participates in the transcriptional repressor activity produced by BCL6. Recruited by ZBTB7A to the androgen response elements/ARE on target genes, negatively regulates androgen receptor signaling and androgen-induced cell proliferation (PubMed:20812024). Mediates the NR1D1-dependent repression and circadian regulation of TSHB expression (By similarity). The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376#function" }, { "database": "UniProtKB", "id": "Q60974", "url": "https://www.uniprot.org/uniprot/Q60974#function" }, { "database": "PubMed", "id": "14527417", "url": "https://glygen.org/publication/PubMed/14527417" }, { "database": "PubMed", "id": "20812024", "url": "https://glygen.org/publication/PubMed/20812024" } ] }, { "annotation": "NCoR1 controls Mycobacterium tuberculosis growth in myeloid cells by regulating the AMPK-mTOR-TFEB axis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" }, { "database": "PubMed", "id": "37590294", "url": "https://glygen.org/publication/PubMed/37590294" } ] }, { "annotation": "NCoR1 controls immune tolerance in conventional dendritic cells by fine-tuning glycolysis and fatty acid oxidation.", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" }, { "database": "PubMed", "id": "36565644", "url": "https://glygen.org/publication/PubMed/36565644" } ] }, { "annotation": "Pulling rank with RNA: RANKL promotes the association of PGC-1beta/RNA complexes with NCoR/HDAC3 to activate gene expression in osteoclasts.", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" }, { "database": "PubMed", "id": "37802020", "url": "https://glygen.org/publication/PubMed/37802020" } ] }, { "annotation": "This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 17 and 20.[provided by RefSeq, Jun 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" } ] }, { "annotation": "This paper describes the cloning of the full-length human NCOR1 cDNA.", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" }, { "database": "PubMed", "id": "9724795", "url": "https://glygen.org/publication/PubMed/9724795" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1019, "end_pos": 1019, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NLP->NLS).", "chr_id": "17", "chr_pos": "16086404", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P1019", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs772404309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772404309" }, { "id": "rs772404309", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772404309" }, { "id": "rs772404309", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772404309" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 101, "end_pos": 101, "sequence_org": "H", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HDS->NDS).", "chr_id": "17", "chr_pos": "16171937", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H101", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1488066160", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1488066160" }, { "id": "rs1488066160", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1488066160#frequency_tab" }, { "id": "rs1488066160", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1488066160" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1030, "end_pos": 1030, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16086371", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1030", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1170194358", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170194358" }, { "id": "rs1170194358", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170194358" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1030, "end_pos": 1030, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16032423", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1030", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777455911", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777455911" }, { "id": "rs777455911", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777455911" }, { "id": "rs777455911", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777455911#frequency_tab" }, { "id": "rs777455911", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777455911" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1040, "end_pos": 1040, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16086340", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1040", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760980680", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760980680" }, { "id": "rs760980680", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760980680" }, { "id": "rs760980680", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760980680" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1042, "end_pos": 1042, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16086334", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1042", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" }, { "id": "rs376522360", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376522360" }, { "id": "rs376522360", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376522360" }, { "id": "rs376522360", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376522360#frequency_tab" }, { "id": "rs376522360", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376522360" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1043, "end_pos": 1043, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16086331", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T1043", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs200378214", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200378214" }, { "id": "rs200378214", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200378214" }, { "id": "rs200378214", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200378214" }, { "id": "rs200378214", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200378214#frequency_tab" }, { "id": "rs200378214", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200378214" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1072, "end_pos": 1072, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQA->NQS).", "chr_id": "17", "chr_pos": "16080691", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "A1072", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200378214", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200378214" }, { "id": "rs200378214", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200378214" }, { "id": "rs200378214", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200378214" }, { "id": "rs200378214", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200378214#frequency_tab" }, { "id": "rs200378214", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200378214" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1072, "end_pos": 1072, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQA->NQT).", "chr_id": "17", "chr_pos": "16080691", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "A1072", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780207196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780207196" }, { "id": "rs780207196", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780207196" }, { "id": "rs780207196", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780207196" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1073, "end_pos": 1073, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16080687", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1073", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765511693", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765511693" }, { "id": "rs765511693", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765511693" }, { "id": "rs765511693", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765511693#frequency_tab" }, { "id": "rs765511693", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765511693" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1075, "end_pos": 1075, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16080682", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1075", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1312818210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1312818210" }, { "id": "rs1312818210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1312818210" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1082, "end_pos": 1082, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "16080660", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1082", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777455911", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777455911" }, { "id": "rs777455911", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777455911" }, { "id": "rs777455911", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777455911#frequency_tab" }, { "id": "rs777455911", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777455911" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1114, "end_pos": 1114, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16086340", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1114", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371462655", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371462655" }, { "id": "rs371462655", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371462655" }, { "id": "rs371462655", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371462655#frequency_tab" }, { "id": "rs371462655", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371462655" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1114, "end_pos": 1114, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "17", "chr_pos": "16080467", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1114", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773001959", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773001959" }, { "id": "rs773001959", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773001959" }, { "id": "rs773001959", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773001959" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1152, "end_pos": 1152, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KIS->NIS).", "chr_id": "17", "chr_pos": "16080009", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1152", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1184, "end_pos": 1184, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KGS->NGS).", "chr_id": "17", "chr_pos": "16075652", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K1184", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs764668587", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764668587" }, { "id": "rs764668587", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764668587" }, { "id": "rs764668587", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764668587" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "16171870", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs954168534", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs954168534" }, { "id": "rs954168534", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs954168534#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1381, "end_pos": 1381, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).", "chr_id": "17", "chr_pos": "16071641", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1381", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1469460933", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469460933" }, { "id": "rs1469460933", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469460933" }, { "id": "rs1469460933", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469460933" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1446, "end_pos": 1446, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16070341", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1446", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1202972976", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1202972976" }, { "id": "rs1202972976", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1202972976" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1446, "end_pos": 1446, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "16070342", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1446", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746165643", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746165643" }, { "id": "rs746165643", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746165643" }, { "id": "rs746165643", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746165643#frequency_tab" }, { "id": "rs746165643", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746165643" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1449, "end_pos": 1449, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16070333", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1449", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779429826", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779429826" }, { "id": "rs779429826", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779429826" }, { "id": "rs779429826", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779429826" }, { "id": "rs779429826", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs779429826#frequency_tab" }, { "id": "rs779429826", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779429826" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1449, "end_pos": 1449, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "17", "chr_pos": "16070332", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1449", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1450, "end_pos": 1450, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "16070329", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S1450", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1479, "end_pos": 1479, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16070242", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T1479", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs200934659", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200934659" }, { "id": "rs200934659", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200934659" }, { "id": "rs200934659", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200934659#frequency_tab" }, { "id": "rs200934659", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200934659" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1480, "end_pos": 1480, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "16070240", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1480", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779634290", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779634290" }, { "id": "rs779634290", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779634290" }, { "id": "rs779634290", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779634290" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1491, "end_pos": 1491, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16070207", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1491", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs113458225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113458225" }, { "id": "rs113458225", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113458225" }, { "id": "rs113458225", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs113458225#frequency_tab" }, { "id": "rs113458225", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs113458225" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1491, "end_pos": 1491, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16070206", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1491", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140549832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140549832" }, { "id": "rs140549832", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140549832" }, { "id": "rs140549832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140549832" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1492, "end_pos": 1492, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTM->NTT).", "chr_id": "17", "chr_pos": "16070203", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M1492", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770316021", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770316021" }, { "id": "rs770316021", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770316021" }, { "id": "rs770316021", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770316021" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 14, "end_pos": 14, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "16194530", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S14", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1468953820", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1468953820" }, { "id": "rs1468953820", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1468953820" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1533, "end_pos": 1533, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "17", "chr_pos": "16068037", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1533", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759642635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759642635" }, { "id": "rs759642635", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759642635" }, { "id": "rs759642635", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759642635" }, { "id": "rs759642635", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759642635" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1545, "end_pos": 1545, "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "16068079", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1545", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1005721837", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1005721837" }, { "id": "rs1005721837", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1005721837#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 15, "end_pos": 15, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16194526", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T15", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765032832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765032832" }, { "id": "rs765032832", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765032832" }, { "id": "rs765032832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765032832" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1697, "end_pos": 1697, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SMS->NMS).", "chr_id": "17", "chr_pos": "16064959", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1697", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [], "start_pos": 1755, "end_pos": 1755, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "16062229", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R1755", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs756042970", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756042970" }, { "id": "rs756042970", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756042970" }, { "id": "rs756042970", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756042970#frequency_tab" }, { "id": "rs756042970", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756042970" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1806, "end_pos": 1806, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "16061865", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1806", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" }, { "id": "rs1429917978", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1429917978" }, { "id": "rs1429917978", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1429917978" }, { "id": "rs1429917978", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1429917978" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1812, "end_pos": 1812, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16061847", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S1812", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1817, "end_pos": 1817, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NTA->NTT).", "chr_id": "17", "chr_pos": "16061833", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A1817", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1854, "end_pos": 1854, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NLR->NLT).", "chr_id": "17", "chr_pos": "16061721", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "R1854", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1403583301", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1403583301" }, { "id": "rs1403583301", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1403583301#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1855, "end_pos": 1855, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SRS->NRS).", "chr_id": "17", "chr_pos": "16061718", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1855", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" }, { "id": "rs543425229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs543425229" }, { "id": "rs543425229", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs543425229" }, { "id": "rs543425229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs543425229" }, { "id": "rs543425229", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs543425229" }, { "id": "rs543425229", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs543425229#frequency_tab" }, { "id": "rs543425229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs543425229" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1861, "end_pos": 1861, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "16061701", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S1861", "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs762577097", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762577097" }, { "id": "rs762577097", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762577097" }, { "id": "rs762577097", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762577097" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1884, "end_pos": 1884, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16061631", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1884", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776582617", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776582617" }, { "id": "rs776582617", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776582617" }, { "id": "rs776582617", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776582617" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1889, "end_pos": 1889, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "16061617", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1889", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776582617", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776582617" }, { "id": "rs776582617", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776582617" }, { "id": "rs776582617", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776582617" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1889, "end_pos": 1889, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "17", "chr_pos": "16061617", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1889", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" }, { "id": "rs762513108", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762513108" }, { "id": "rs762513108", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762513108" }, { "id": "rs762513108", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762513108" }, { "id": "rs762513108", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762513108" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1933, "end_pos": 1933, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NFI->NFT).", "chr_id": "17", "chr_pos": "16061484", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "I1933", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs1372508105", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1372508105" }, { "id": "rs1372508105", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1372508105" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2033, "end_pos": 2033, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "16061407", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2033", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2069, "end_pos": 2069, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16057700", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2069", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs142717545", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142717545" }, { "id": "rs142717545", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142717545#frequency_tab" }, { "id": "rs142717545", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142717545" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2070, "end_pos": 2070, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "16057697", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2070", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138266823", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138266823" }, { "id": "rs138266823", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138266823" }, { "id": "rs138266823", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138266823#frequency_tab" }, { "id": "rs138266823", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138266823" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2080, "end_pos": 2080, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16057668", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2080", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs375660359", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375660359" }, { "id": "rs375660359", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375660359" }, { "id": "rs375660359", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375660359" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2080, "end_pos": 2080, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16057667", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2080", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778161542", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778161542" }, { "id": "rs778161542", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778161542" }, { "id": "rs778161542", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778161542#frequency_tab" }, { "id": "rs778161542", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778161542" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2085, "end_pos": 2085, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSP->NSS).", "chr_id": "17", "chr_pos": "16057653", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P2085", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1324427668", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1324427668" }, { "id": "rs1324427668", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1324427668" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2086, "end_pos": 2086, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16057649", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2086", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752724760", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752724760" }, { "id": "rs752724760", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752724760" }, { "id": "rs752724760", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752724760" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2090, "end_pos": 2090, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "17", "chr_pos": "16057638", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2090", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61753149", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61753149" }, { "id": "rs61753149", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61753149" }, { "id": "rs61753149", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61753149" }, { "id": "rs61753149", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61753149#frequency_tab" }, { "id": "rs61753149", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61753149" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2182, "end_pos": 2182, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "17", "chr_pos": "16047086", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.002196", "site_lbl": "A2182", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1481285610", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1481285610" }, { "id": "rs1481285610", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1481285610" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2187, "end_pos": 2187, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).", "chr_id": "17", "chr_pos": "16047070", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2187", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [], "start_pos": 2214, "end_pos": 2214, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "16046990", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R2214", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2219, "end_pos": 2219, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->C).", "chr_id": "17", "chr_pos": "16046974", "ref_nt": "G", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S2219", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1387701604", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387701604" }, { "id": "rs1387701604", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387701604#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2219, "end_pos": 2219, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "16046974", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2219", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1286959178", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1286959178" }, { "id": "rs1286959178", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1286959178#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2246, "end_pos": 2246, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "16039651", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2246", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1597648171", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1597648171" }, { "id": "rs1597648171", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1597648171" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2287, "end_pos": 2287, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "16039529", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2287", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770888727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770888727" }, { "id": "rs770888727", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770888727" }, { "id": "rs770888727", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770888727" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2299, "end_pos": 2299, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16039493", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2299", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1283451096", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1283451096" }, { "id": "rs1283451096", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1283451096" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2299, "end_pos": 2299, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "17", "chr_pos": "16039492", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2299", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762066806", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762066806" }, { "id": "rs762066806", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762066806" }, { "id": "rs762066806", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762066806" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2330, "end_pos": 2330, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "16034912", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2330", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1438975274", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1438975274" }, { "id": "rs1438975274", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1438975274" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2332, "end_pos": 2332, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "16034905", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 269, "end_pos": 269, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NQP->NQT).", "chr_id": "17", "chr_pos": "16151983", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P269", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs888646945", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs888646945" }, { "id": "rs888646945", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs888646945#frequency_tab" }, { "id": "rs888646945", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs888646945" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 28, "end_pos": 28, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16194488", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T28", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747978271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747978271" }, { "id": "rs747978271", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747978271" }, { "id": "rs747978271", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747978271#frequency_tab" }, { "id": "rs747978271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747978271" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2, "end_pos": 2, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "17", "chr_pos": "16080005", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747978271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747978271" }, { "id": "rs747978271", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747978271" }, { "id": "rs747978271", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747978271#frequency_tab" }, { "id": "rs747978271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747978271" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2, "end_pos": 2, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "16080005", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781263121", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781263121" }, { "id": "rs781263121", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781263121" }, { "id": "rs781263121", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781263121#frequency_tab" }, { "id": "rs781263121", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781263121" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "16194476", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1258611404", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1258611404" }, { "id": "rs1258611404", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1258611404" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "16194475", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781263121", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781263121" }, { "id": "rs781263121", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781263121" }, { "id": "rs781263121", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781263121#frequency_tab" }, { "id": "rs781263121", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781263121" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "17", "chr_pos": "16194476", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1223191004", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1223191004" }, { "id": "rs1223191004", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1223191004" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3, "end_pos": 3, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "16194562", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" }, { "id": "rs774409058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774409058" }, { "id": "rs774409058", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774409058" }, { "id": "rs774409058", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774409058#frequency_tab" }, { "id": "rs774409058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774409058" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 45, "end_pos": 45, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "16186663", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S45", "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 482, "end_pos": 482, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "17", "chr_pos": "16137374", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K482", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1301673402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301673402" }, { "id": "rs1301673402", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1301673402#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 51, "end_pos": 51, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "17", "chr_pos": "16186645", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S51", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 51, "end_pos": 51, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "16186644", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S51", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 54, "end_pos": 54, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "16186635", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S54", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O75376", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376" } ], "glycoeffect": [], "start_pos": 5, "end_pos": 5, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "G", "sequence_mut": "V", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "16194556", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "G5", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1289168244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1289168244" }, { "id": "rs1289168244", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1289168244#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 842, "end_pos": 842, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTK->NTT).", "chr_id": "17", "chr_pos": "16101415", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K842", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769733002", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769733002" }, { "id": "rs769733002", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769733002" }, { "id": "rs769733002", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769733002" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 949, "end_pos": 949, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIP->NIT).", "chr_id": "17", "chr_pos": "16092034", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P949", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "90.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "87.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "82.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "92.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "84.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75376" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "common_name": "Human" } ], "gene": [ { "name": "NCOR1", "url": "https://www.uniprot.org/uniprot/O75376", "locus": { "chromosome": "17", "start_pos": 16029065, "end_pos": 16218185, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000141027", "url": "https://www.ensembl.org/id/ENSG00000141027" } ] } } ], "crossref": [ { "id": "ENSG00000141027", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000141027", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75376", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75376", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00167", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00167", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3038484", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3038484", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NCOR1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NCOR1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9611", "url": "https://www.ncbi.nlm.nih.gov/gene/9611", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2903", "url": "https://glyconnect.expasy.org/browser/proteins/2903", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "7672", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7672", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "E7EVK1", "url": "https://www.ebi.ac.uk/intact/interactors/id:E7EVK1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O75376", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75376*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017930", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017930", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031557", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031557", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9611", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9611", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "600849", "url": "http://www.omim.org/entry/600849", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75376", "url": "https://www.nextprot.org/entry/NX_O75376", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AVIPPMX", "url": "https://omabrowser.org/oma/group/AVIPPMX/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5482374at2759", "url": "http://www.orthodb.org/?query=5482374at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13992", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13992", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13992:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13992:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2EQR", "url": "https://www.rcsb.org/structure/2EQR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3H52", "url": "https://www.rcsb.org/structure/3H52", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KMZ", "url": "https://www.rcsb.org/structure/3KMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3N00", "url": "https://www.rcsb.org/structure/3N00", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MDD", "url": "https://www.rcsb.org/structure/4MDD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WVD", "url": "https://www.rcsb.org/structure/4WVD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ONI", "url": "https://www.rcsb.org/structure/6ONI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WMQ", "url": "https://www.rcsb.org/structure/6WMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WMS", "url": "https://www.rcsb.org/structure/6WMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XXS", "url": "https://www.rcsb.org/structure/6XXS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XYX", "url": "https://www.rcsb.org/structure/6XYX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XZZ", "url": "https://www.rcsb.org/structure/6XZZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Y17", "url": "https://www.rcsb.org/structure/6Y17", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZBU", "url": "https://www.rcsb.org/structure/6ZBU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AS9", "url": "https://www.rcsb.org/structure/8AS9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8D8I", "url": "https://www.rcsb.org/structure/8D8I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DKN", "url": "https://www.rcsb.org/structure/8DKN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DKV", "url": "https://www.rcsb.org/structure/8DKV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00249", "url": "http://pfam.xfam.org/family/PF00249", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF15784", "url": "http://pfam.xfam.org/family/PF15784", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75376", "url": "https://pharos.nih.gov/targets/O75376", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75376", "url": "http://purl.obolibrary.org/obo/PR_O75376", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1368071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1368071", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2894862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2894862", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-350054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9022537", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022537", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9623433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9623433", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A994J5B8", "url": "https://www.uniprot.org/uniprot/A0A994J5B8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J5B8-1", "url": "https://www.uniprot.org/uniprot/A0A994J5B8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JAP0", "url": "https://www.uniprot.org/uniprot/C9JAP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JAP0-1", "url": "https://www.uniprot.org/uniprot/C9JAP0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVK1", "url": "https://www.uniprot.org/uniprot/E7EVK1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVK1-1", "url": "https://www.uniprot.org/uniprot/E7EVK1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVU5", "url": "https://www.uniprot.org/uniprot/E7EVU5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVU5-1", "url": "https://www.uniprot.org/uniprot/E7EVU5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EW50", "url": "https://www.uniprot.org/uniprot/E7EW50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EW50-1", "url": "https://www.uniprot.org/uniprot/E7EW50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y459", "url": "https://www.uniprot.org/uniprot/H0Y459", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y459-1", "url": "https://www.uniprot.org/uniprot/H0Y459-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KRE4", "url": "https://www.uniprot.org/uniprot/J3KRE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KRE4-1", "url": "https://www.uniprot.org/uniprot/J3KRE4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KS29", "url": "https://www.uniprot.org/uniprot/J3KS29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KS29-1", "url": "https://www.uniprot.org/uniprot/J3KS29-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KS51", "url": "https://www.uniprot.org/uniprot/J3KS51", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KS51-1", "url": "https://www.uniprot.org/uniprot/J3KS51-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KT44", "url": "https://www.uniprot.org/uniprot/J3KT44", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KT44-1", "url": "https://www.uniprot.org/uniprot/J3KT44-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QKP0", "url": "https://www.uniprot.org/uniprot/J3QKP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QKP0-1", "url": "https://www.uniprot.org/uniprot/J3QKP0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75376-1", "url": "https://www.uniprot.org/uniprot/O75376-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75376-2", "url": "https://www.uniprot.org/uniprot/O75376-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75376-3", "url": "https://www.uniprot.org/uniprot/O75376-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R380", "url": "https://www.uniprot.org/uniprot/S4R380", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R380-1", "url": "https://www.uniprot.org/uniprot/S4R380-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 2440, "header": "sp|O75376-1|NCOR1_HUMAN Isoform 1 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "isoforms": [ { "isoform_ac": "A0A994J5B8-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTGVPARRMMKNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 2466, "header": "tr|A0A994J5B8-1|NCOR1_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16032299, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000704745.1", "url": "https://www.ensembl.org/id/ENST00000704745.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516022.1", "url": "https://www.ensembl.org/id/ENSP00000516022.1" } ] } }, { "isoform_ac": "C9JAP0-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAA", "length": 125, "header": "tr|C9JAP0-1|C9JAP0_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16171863, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430577.2", "url": "https://www.ensembl.org/id/ENST00000430577.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000410784.2", "url": "https://www.ensembl.org/id/ENSP00000410784.2" } ] } }, { "isoform_ac": "E7EVK1-1", "url": "", "sequence": { "sequence": "XSVESIPSLRGSITQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 1071, "header": "tr|E7EVK1-1|E7EVK1_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16080007, "end_pos": 16032298, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000395849.6", "url": "https://www.ensembl.org/id/ENST00000395849.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000379190.2", "url": "https://www.ensembl.org/id/ENSP00000379190.2" } ] } }, { "isoform_ac": "E7EVU5-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTGVPARRMMKNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKK", "length": 537, "header": "tr|E7EVU5-1|NCOR1_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16126132, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436828.5", "url": "https://www.ensembl.org/id/ENST00000436828.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000387727.1", "url": "https://www.ensembl.org/id/ENSP00000387727.1" } ] } }, { "isoform_ac": "E7EW50-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDS", "length": 545, "header": "tr|E7EW50-1|E7EW50_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16126084, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000411510.5", "url": "https://www.ensembl.org/id/ENST00000411510.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000407998.1", "url": "https://www.ensembl.org/id/ENSP00000407998.1" } ] } }, { "isoform_ac": "H0Y459-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEGKSVAYMPYAEVKRALEQEAQMHNTAARSASPCRLSPREVSKAAPQPDMSAARYSVPPVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 2514, "header": "tr|H0Y459-1|H0Y459_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16032299, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436068.2", "url": "https://www.ensembl.org/id/ENST00000436068.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000389839.2", "url": "https://www.ensembl.org/id/ENSP00000389839.2" } ] } }, { "isoform_ac": "J3KRE4-1", "url": "", "sequence": { "sequence": "ENTSPMVKSKKQEIFRKLNSSGGGDSDMAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQ", "length": 183, "header": "tr|J3KRE4-1|NCOR1_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16047035, "end_pos": 16032473, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000579573.2", "url": "https://www.ensembl.org/id/ENST00000579573.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000461959.2", "url": "https://www.ensembl.org/id/ENSP00000461959.2" } ] } }, { "isoform_ac": "J3KS29-1", "url": "", "sequence": { "sequence": "XTQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTT", "length": 184, "header": "tr|J3KS29-1|J3KS29_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16057730, "end_pos": 16040445, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000579606.1", "url": "https://www.ensembl.org/id/ENST00000579606.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000462281.1", "url": "https://www.ensembl.org/id/ENSP00000462281.1" } ] } }, { "isoform_ac": "J3KS51-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTGVPARRMMKNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEE", "length": 546, "header": "tr|J3KS51-1|J3KS51_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16126108, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000582357.5", "url": "https://www.ensembl.org/id/ENST00000582357.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462308.1", "url": "https://www.ensembl.org/id/ENSP00000462308.1" } ] } }, { "isoform_ac": "J3KT44-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDSVYFLCMY", "length": 88, "header": "tr|J3KT44-1|J3KT44_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16171999, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000460276.5", "url": "https://www.ensembl.org/id/ENST00000460276.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462794.1", "url": "https://www.ensembl.org/id/ENSP00000462794.1" } ] } }, { "isoform_ac": "J3QKP0-1", "url": "", "sequence": { "sequence": "XDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFPAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPM", "length": 217, "header": "tr|J3QKP0-1|J3QKP0_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16057723, "end_pos": 16039517, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000580554.1", "url": "https://www.ensembl.org/id/ENST00000580554.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000463169.1", "url": "https://www.ensembl.org/id/ENSP00000463169.1" } ] } }, { "isoform_ac": "O75376-1", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 2440, "header": "sp|O75376-1|NCOR1_HUMAN Isoform 1 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16032299, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000268712.8", "url": "https://www.ensembl.org/id/ENST00000268712.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000268712.2", "url": "https://www.ensembl.org/id/ENSP00000268712.2" } ] } }, { "isoform_ac": "O75376-2", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKEISSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 2337, "header": "sp|O75376-2|NCOR1_HUMAN Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16032299, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000395851.5", "url": "https://www.ensembl.org/id/ENST00000395851.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000379192.1", "url": "https://www.ensembl.org/id/ENSP00000379192.1" } ] } }, { "isoform_ac": "O75376-3", "url": "", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEGR", "length": 914, "header": "sp|O75376-3|NCOR1_HUMAN Isoform 3 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16194569, "end_pos": 16091858, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000395848.5", "url": "https://www.ensembl.org/id/ENST00000395848.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000379189.1", "url": "https://www.ensembl.org/id/ENSP00000379189.1" } ] } }, { "isoform_ac": "S4R380-1", "url": "", "sequence": { "sequence": "RREEGDPSPHSGTAFILVLFCCFSPKKPVYFPNSDASLRHFIYVFMCSESPLRVSVT", "length": 57, "header": "tr|S4R380-1|S4R380_HUMAN Computationally mapped isoform of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=4 SV=1 CANONICAL=O75376-1" }, "locus": { "chromosome": "17", "start_pos": 16039466, "end_pos": 16039296, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000603989.1", "url": "https://www.ensembl.org/id/ENST00000603989.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000474008.1", "url": "https://www.ensembl.org/id/ENSP00000474008.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1026, "start_aa": "Thr", "end_pos": 1026, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1026", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1027, "start_aa": "Thr", "end_pos": 1027, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1027", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1030, "start_aa": "Thr", "end_pos": 1030, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1030", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1039, "start_aa": "Ser", "end_pos": 1039, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1039", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1040, "start_aa": "Ser", "end_pos": 1040, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1040", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1040, "start_aa": "Ser", "end_pos": 1040, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1040", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1042, "start_aa": "Thr", "end_pos": 1042, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1042", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1043, "start_aa": "Thr", "end_pos": 1043, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1043", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1046, "start_aa": "Ser", "end_pos": 1046, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1046", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1050, "start_aa": "Ser", "end_pos": 1050, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1050", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1064, "start_aa": "Thr", "end_pos": 1064, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1064", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1073, "start_aa": "Ser", "end_pos": 1073, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1073", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1075, "start_aa": "Thr", "end_pos": 1075, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1075", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1082, "start_aa": "Ser", "end_pos": 1082, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1082", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1114, "start_aa": "Ser", "end_pos": 1114, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1114", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1117, "start_aa": "Ser", "end_pos": 1117, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1117", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 123, "start_aa": "Ser", "end_pos": 123, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser123", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Ser", "end_pos": 123, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser123", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1263, "start_aa": "Ser", "end_pos": 1263, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1263", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1266, "start_aa": "Ser", "end_pos": 1266, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1266", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1446, "start_aa": "Ser", "end_pos": 1446, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1446", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1449, "start_aa": "Thr", "end_pos": 1449, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1449", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1450, "start_aa": "Ser", "end_pos": 1450, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1450", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1453, "start_aa": "Ser", "end_pos": 1453, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1453", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1453, "start_aa": "Ser", "end_pos": 1453, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1453", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1454, "start_aa": "Ser", "end_pos": 1454, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1454", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1454, "start_aa": "Ser", "end_pos": 1454, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1454", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1457, "start_aa": "Ser", "end_pos": 1457, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1457", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1479, "start_aa": "Thr", "end_pos": 1479, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1479", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1480, "start_aa": "Ser", "end_pos": 1480, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1480", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1484, "start_aa": "Thr", "end_pos": 1484, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1484", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1487, "start_aa": "Ser", "end_pos": 1487, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1487", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "2903", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2903" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1487, "start_aa": "Ser", "end_pos": 1487, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1487", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1491, "start_aa": "Thr", "end_pos": 1491, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1491", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1493, "start_aa": "Ser", "end_pos": 1493, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1493", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 14, "start_aa": "Ser", "end_pos": 14, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser14", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1533, "start_aa": "Ser", "end_pos": 1533, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1533", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1543, "start_aa": "Ser", "end_pos": 1543, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1543", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1545, "start_aa": "Ser", "end_pos": 1545, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1545", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 15, "start_aa": "Thr", "end_pos": 15, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr15", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1656, "start_aa": "Thr", "end_pos": 1656, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1656", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1806, "start_aa": "Ser", "end_pos": 1806, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1806", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1812, "start_aa": "Ser", "end_pos": 1812, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1812", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1812, "start_aa": "Ser", "end_pos": 1812, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1812", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1857, "start_aa": "Ser", "end_pos": 1857, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1857", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1861, "start_aa": "Ser", "end_pos": 1861, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1861", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1861, "start_aa": "Ser", "end_pos": 1861, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1861", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1877, "start_aa": "Ser", "end_pos": 1877, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1877", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1883, "start_aa": "Thr", "end_pos": 1883, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1883", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1884, "start_aa": "Ser", "end_pos": 1884, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1884", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1885, "start_aa": "Ser", "end_pos": 1885, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1885", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1889, "start_aa": "Ser", "end_pos": 1889, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1889", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 18, "start_aa": "Ser", "end_pos": 18, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser18", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1913, "start_aa": "Ser", "end_pos": 1913, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1913", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1925, "start_aa": "Thr", "end_pos": 1925, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1925", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1926, "start_aa": "Thr", "end_pos": 1926, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1926", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1926, "start_aa": "Thr", "end_pos": 1926, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1926", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1928, "start_aa": "Thr", "end_pos": 1928, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1928", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2033, "start_aa": "Ser", "end_pos": 2033, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2033", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2034, "start_aa": "Ser", "end_pos": 2034, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2034", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2069, "start_aa": "Ser", "end_pos": 2069, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2069", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2070, "start_aa": "Ser", "end_pos": 2070, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2070", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2078, "start_aa": "Thr", "end_pos": 2078, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2078", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2078, "start_aa": "Thr", "end_pos": 2078, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2078", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2079, "start_aa": "Ser", "end_pos": 2079, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2079", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2079, "start_aa": "Ser", "end_pos": 2079, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2079", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2080, "start_aa": "Thr", "end_pos": 2080, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2080", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2084, "start_aa": "Ser", "end_pos": 2084, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2084", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2086, "start_aa": "Ser", "end_pos": 2086, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2086", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2090, "start_aa": "Ser", "end_pos": 2090, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2090", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2219, "start_aa": "Ser", "end_pos": 2219, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2219", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2233, "start_aa": "Thr", "end_pos": 2233, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2233", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2242, "start_aa": "Thr", "end_pos": 2242, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2242", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2246, "start_aa": "Ser", "end_pos": 2246, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2246", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2287, "start_aa": "Ser", "end_pos": 2287, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2287", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2299, "start_aa": "Thr", "end_pos": 2299, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2299", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2330, "start_aa": "Ser", "end_pos": 2330, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2330", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2332, "start_aa": "Ser", "end_pos": 2332, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2332", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 24, "start_aa": "Ser", "end_pos": 24, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser24", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 24, "start_aa": "Ser", "end_pos": 24, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser24", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 28, "start_aa": "Thr", "end_pos": 28, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr28", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2, "start_aa": "Ser", "end_pos": 2, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 3, "start_aa": "Ser", "end_pos": 3, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 45, "start_aa": "Ser", "end_pos": 45, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser45", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 46, "start_aa": "Ser", "end_pos": 46, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser46", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 4, "start_aa": "Ser", "end_pos": 4, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser4", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 51, "start_aa": "Ser", "end_pos": 51, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser51", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Ser", "end_pos": 51, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser51", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 54, "start_aa": "Ser", "end_pos": 54, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser54", "evidence": [ { "id": "O75376", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "O75376", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75376" } ] } ], "phosphorylation": [ { "start_pos": 1111, "end_pos": 1111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser1111" }, { "start_pos": 1150, "end_pos": 1150, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr1150" }, { "start_pos": 1195, "end_pos": 1195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "site_lbl": "Ser1195" }, { "start_pos": 1196, "end_pos": 1196, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1196" }, { "start_pos": 1206, "end_pos": 1206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1206" }, { "start_pos": 1242, "end_pos": 1242, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "O75376", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75376*" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "35044719", "url": "" } ], "site_lbl": "Ser1242" }, { "start_pos": 1246, "end_pos": 1246, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "O75376", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75376*" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "35044719", "url": "" } ], "site_lbl": "Ser1246" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "O75376", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75376*" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "35044719", "url": "" } ], "site_lbl": "Tyr1247" }, { "start_pos": 1249, "end_pos": 1249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "site_lbl": "Ser1249" }, { "start_pos": 1263, "end_pos": 1263, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "site_lbl": "Ser1263" }, { "start_pos": 1281, "end_pos": 1281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "site_lbl": "Ser1281" }, { "start_pos": 1322, "end_pos": 1322, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1322" }, { "start_pos": 1367, "end_pos": 1367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "site_lbl": "Thr1367" }, { "start_pos": 1450, "end_pos": 1450, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "23940660", "url": "https://glygen.org/publication/PubMed/23940660" } ], "site_lbl": "Ser1450" }, { "start_pos": 1450, "end_pos": 1450, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "23940660", "url": "https://glygen.org/publication/PubMed/23940660" } ], "site_lbl": "Ser1450" }, { "start_pos": 1472, "end_pos": 1472, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser1472" }, { "start_pos": 1491, "end_pos": 1491, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr1491" }, { "start_pos": 1493, "end_pos": 1493, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser1493" }, { "start_pos": 1533, "end_pos": 1533, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser1533" }, { "start_pos": 1543, "end_pos": 1543, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1543" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser157" }, { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser158" }, { "start_pos": 1592, "end_pos": 1592, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1592" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser161" }, { "start_pos": 1672, "end_pos": 1672, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Thr1672" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser172" }, { "start_pos": 1925, "end_pos": 1925, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "23940660", "url": "https://glygen.org/publication/PubMed/23940660" } ], "site_lbl": "Thr1925" }, { "start_pos": 1977, "end_pos": 1977, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser1977" }, { "start_pos": 1980, "end_pos": 1980, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser1980" }, { "start_pos": 1981, "end_pos": 1981, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser1981" }, { "start_pos": 1991, "end_pos": 1991, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr1991" }, { "start_pos": 1992, "end_pos": 1992, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Tyr1992" }, { "start_pos": 2084, "end_pos": 2084, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser2084" }, { "start_pos": 2090, "end_pos": 2090, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser2090" }, { "start_pos": 2091, "end_pos": 2091, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr2091" }, { "start_pos": 2102, "end_pos": 2102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "site_lbl": "Ser2102" }, { "start_pos": 2120, "end_pos": 2120, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ], "site_lbl": "Ser2120" }, { "start_pos": 2136, "end_pos": 2136, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "site_lbl": "Ser2136" }, { "start_pos": 2151, "end_pos": 2151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser2151" }, { "start_pos": 2164, "end_pos": 2164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Ser2164" }, { "start_pos": 2184, "end_pos": 2184, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ], "site_lbl": "Ser2184" }, { "start_pos": 2187, "end_pos": 2187, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser2187" }, { "start_pos": 2202, "end_pos": 2202, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser2202" }, { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser224" }, { "start_pos": 2395, "end_pos": 2395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser2395" }, { "start_pos": 2396, "end_pos": 2396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Thr2396" }, { "start_pos": 2399, "end_pos": 2399, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Thr2399" }, { "start_pos": 2432, "end_pos": 2432, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Tyr2432" }, { "start_pos": 2434, "end_pos": 2434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr2434" }, { "start_pos": 2436, "end_pos": 2436, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" }, { "database": "PubMed", "id": "22675025", "url": "https://glygen.org/publication/PubMed/22675025" }, { "database": "PubMed", "id": "23669876", "url": "https://glygen.org/publication/PubMed/23669876" } ], "site_lbl": "Ser2436" }, { "start_pos": 2438, "end_pos": 2438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser2438" }, { "start_pos": 275, "end_pos": 275, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr275" }, { "start_pos": 401, "end_pos": 401, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser401" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "23129261", "url": "https://glygen.org/publication/PubMed/23129261" } ], "site_lbl": "Ser70" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser88" }, { "start_pos": 97, "end_pos": 97, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser97" }, { "start_pos": 999, "end_pos": 999, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75376", "url": "http://phospho.elm.eu.org/byAccession/O75376.html" } ], "site_lbl": "Ser999" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "p300 interacts with the N- and C-terminal part of PPARgamma2 in a ligand-independent and -dependent manner, respectively.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gelman L, Zhou G, Fajas L, Raspe E, Fruchart JC, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10075656", "url": "https://glygen.org/publication/PubMed/10075656" } ] }, { "title": "A mechanism of repression of TGFbeta/ Smad signaling by oncogenic Ras.", "journal": "Genes & development", "date": "1999", "authors": "Kretzschmar M, Doody J, Timokhina I, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10197981", "url": "https://glygen.org/publication/PubMed/10197981" } ] }, { "title": "Molecular cloning and characterization of the human CLOCK gene: expression in the suprachiasmatic nuclei.", "journal": "Genomics", "date": "1999", "authors": "Steeves TD, King DP, Zhao Y, Sangoram AM, Du F, Bowcock AM, Moore RY, Takahashi JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "10198158", "url": "https://glygen.org/publication/PubMed/10198158" } ] }, { "title": "A Smad transcriptional corepressor.", "journal": "Cell", "date": "1999", "authors": "Wotton D, Lo RS, Lee S, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10199400", "url": "https://glygen.org/publication/PubMed/10199400" } ] }, { "title": "A presenilin-1-dependent gamma-secretase-like protease mediates release of Notch intracellular domain.", "journal": "Nature", "date": "1999", "authors": "De Strooper B, Annaert W, Cupers P, Saftig P, Craessaerts K, Mumm JS, Schroeter EH, Schrijvers V, Wolfe MS, Ray WJ, Goate A, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "10206645", "url": "https://glygen.org/publication/PubMed/10206645" } ] }, { "title": "Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.", "journal": "Nature", "date": "1999", "authors": "Rachez C, Lemon BD, Suldan Z, Bromleigh V, Gamble M, Naar AM, Erdjument-Bromage H, Tempst P, Freedman LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "10235266", "url": "https://glygen.org/publication/PubMed/10235266" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "Mechanisms controlling mitochondrial biogenesis and respiration through the thermogenic coactivator PGC-1.", "journal": "Cell", "date": "1999", "authors": "Wu Z, Puigserver P, Andersson U, Zhang C, Adelmant G, Mootha V, Troy A, Cinti S, Lowell B, Scarpulla RC, Spiegelman BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "10412986", "url": "https://glygen.org/publication/PubMed/10412986" } ] }, { "title": "PPARgamma activation induces the expression of the adipocyte fatty acid binding protein gene in human monocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Pelton PD, Zhou L, Demarest KT, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10425206", "url": "https://glygen.org/publication/PubMed/10425206" } ] }, { "title": "Localization of the human nuclear receptor co-repressor (hN-CoR) gene between the CMT1A and the SMS critical regions of chromosome 17p11.2.", "journal": "Genomics", "date": "1999", "authors": "Nagaya T, Chen K S, Fujieda M, Ohmori S, Richer J K, Horwitz K B, Lupski J R, Seo H", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "10444336", "url": "https://glygen.org/publication/PubMed/10444336" } ] }, { "title": "Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.", "journal": "Genes & development", "date": "1999", "authors": "Zhang Y, Ng HH, Erdjument-Bromage H, Tempst P, Bird A, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10444591", "url": "https://glygen.org/publication/PubMed/10444591" } ] }, { "title": "CoREST: a functional corepressor required for regulation of neural-specific gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Andres ME, Burger C, Peral-Rubio MJ, Battaglioli E, Anderson ME, Grimes J, Dallman J, Ballas N, Mandel G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10449787", "url": "https://glygen.org/publication/PubMed/10449787" } ] }, { "title": "The Ski oncoprotein interacts with the Smad proteins to repress TGFbeta signaling.", "journal": "Genes & development", "date": "1999", "authors": "Luo K, Stroschein SL, Wang W, Chen D, Martens E, Zhou S, Zhou Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10485843", "url": "https://glygen.org/publication/PubMed/10485843" } ] }, { "title": "Cell culture conditions determine apolipoprotein CIII secretion and regulation by fibrates in human hepatoma HepG2 cells.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "1999", "authors": "Clavey V, Copin C, Mariotte MC, Bauge E, Chinetti G, Fruchart J, Fruchart JC, Dallongeville J, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "10494028", "url": "https://glygen.org/publication/PubMed/10494028" } ] }, { "title": "Peroxisome proliferator-activated receptors: nuclear control of metabolism.", "journal": "Endocrine reviews", "date": "1999", "authors": "Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "10529898", "url": "https://glygen.org/publication/PubMed/10529898" } ] }, { "title": "Light-independent role of CRY1 and CRY2 in the mammalian circadian clock.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Griffin EA Jr, Staknis D, Weitz CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "10531061", "url": "https://glygen.org/publication/PubMed/10531061" } ] }, { "title": "Negative feedback regulation of TGF-beta signaling by the SnoN oncoprotein.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Stroschein SL, Wang W, Zhou S, Zhou Q, Luo K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10531062", "url": "https://glygen.org/publication/PubMed/10531062" } ] }, { "title": "SnoN and Ski protooncoproteins are rapidly degraded in response to transforming growth factor beta signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sun Y, Liu X, Ng-Eaton E, Lodish HF, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10535941", "url": "https://glygen.org/publication/PubMed/10535941" } ] }, { "title": "Multimeric Coactivator Complexes for Steroid/Nuclear Receptors.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "1999", "authors": "Freedman LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "10542397", "url": "https://glygen.org/publication/PubMed/10542397" } ] }, { "title": "Interaction of the Ski oncoprotein with Smad3 regulates TGF-beta signaling.", "journal": "Molecular cell", "date": "1999", "authors": "Sun Y, Liu X, Eaton EN, Lane WS, Lodish HF, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10549282", "url": "https://glygen.org/publication/PubMed/10549282" } ] }, { "title": "Ubiquitin-dependent degradation of TGF-beta-activated smad2.", "journal": "Nature cell biology", "date": "1999", "authors": "Lo RS, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10587642", "url": "https://glygen.org/publication/PubMed/10587642" } ] }, { "title": "SMAD destruction turns off signalling.", "journal": "Nature cell biology", "date": "1999", "authors": "Heldin CH, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "10587654", "url": "https://glygen.org/publication/PubMed/10587654" } ] }, { "title": "Cloning and mRNA tissue distribution of human PPARgamma coactivator-1.", "journal": "International journal of obesity and related metabolic disorders : journal of the International Association for the Study of Obesity", "date": "1999", "authors": "Larrouy D, Vidal H, Andreelli F, Laville M, Langin D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "10643692", "url": "https://glygen.org/publication/PubMed/10643692" } ] }, { "title": "SKIP, a CBF1-associated protein, interacts with the ankyrin repeat domain of NotchIC To facilitate NotchIC function.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zhou S, Fujimuro M, Hsieh JJ, Chen L, Miyamoto A, Weinmaster G, Hayward SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "10713164", "url": "https://glygen.org/publication/PubMed/10713164" } ] }, { "title": "A tissue-specific coactivator of steroid receptors, identified in a functional genetic screen.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Knutti D, Kaul A, Kralli A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "10713165", "url": "https://glygen.org/publication/PubMed/10713165" } ] }, { "title": "Cloning and characterization of a novel human class I histone deacetylase that functions as a transcription repressor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hu E, Chen Z, Fredrickson T, Zhu Y, Kirkpatrick R, Zhang GF, Johanson K, Sung CM, Liu R, Winkler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10748112", "url": "https://glygen.org/publication/PubMed/10748112" } ] }, { "title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "10777502", "url": "https://glygen.org/publication/PubMed/10777502" } ] }, { "title": "The murine and human cholesterol 7alpha-hydroxylase gene promoters are differentially responsive to regulation by fatty acids mediated via peroxisome proliferator-activated receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cheema SK, Agellon LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "10777541", "url": "https://glygen.org/publication/PubMed/10777541" } ] }, { "title": "Phosphorylation and destabilization of human period I clock protein by human casein kinase I epsilon.", "journal": "Neuroreport", "date": "2000", "authors": "Keesler GA, Camacho F, Guo Y, Virshup D, Mondadori C, Yao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "10790862", "url": "https://glygen.org/publication/PubMed/10790862" } ] }, { "title": "Sterol-dependent transactivation of the ABC1 promoter by the liver X receptor/retinoid X receptor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Costet P, Luo Y, Wang N, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "10858438", "url": "https://glygen.org/publication/PubMed/10858438" } ] }, { "title": "Embryonic lethality in mice homozygous for a processing-deficient allele of Notch1.", "journal": "Nature", "date": "2000", "authors": "Huppert SS, Le A, Schroeter EH, Mumm JS, Saxena MT, Milner LA, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "10879540", "url": "https://glygen.org/publication/PubMed/10879540" } ] }, { "title": "A novel proteolytic cleavage involved in Notch signaling: the role of the disintegrin-metalloprotease TACE.", "journal": "Molecular cell", "date": "2000", "authors": "Brou C, Logeat F, Gupta N, Bessia C, LeBail O, Doedens JR, Cumano A, Roux P, Black RA, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "10882063", "url": "https://glygen.org/publication/PubMed/10882063" } ] }, { "title": "NuRD and SIN3 histone deacetylase complexes in development.", "journal": "Trends in genetics : TIG", "date": "2000", "authors": "Ahringer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10904264", "url": "https://glygen.org/publication/PubMed/10904264" } ] }, { "title": "Histone deacetylase inhibitors: inducers of differentiation or apoptosis of transformed cells.", "journal": "Journal of the National Cancer Institute", "date": "2000", "authors": "Marks PA, Richon VM, Rifkind RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10922406", "url": "https://glygen.org/publication/PubMed/10922406" } ] }, { "title": "Cloning and characterization of a novel human histone deacetylase, HDAC8.", "journal": "The Biochemical journal", "date": "2000", "authors": "Buggy JJ, Sideris ML, Mak P, Lorimer DD, McIntosh B, Clark JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10926844", "url": "https://glygen.org/publication/PubMed/10926844" } ] }, { "title": "Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Maier MM, Gessler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "10964718", "url": "https://glygen.org/publication/PubMed/10964718" } ] }, { "title": "Physical interaction of Delta1, Jagged1, and Jagged2 with Notch1 and Notch3 receptors.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Shimizu K, Chiba S, Saito T, Kumano K, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "11006133", "url": "https://glygen.org/publication/PubMed/11006133" } ] }, { "title": "A novel nuclear receptor corepressor complex, N-CoR, contains components of the mammalian SWI/SNF complex and the corepressor KAP-1.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Underhill C, Qutob M S, Yee S P, Torchia J", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "11013263", "url": "https://glygen.org/publication/PubMed/11013263" } ] }, { "title": "Analysis of HeyL expression in wild-type and Notch pathway mutant mouse embryos.", "journal": "Mechanisms of development", "date": "2000", "authors": "Leimeister C, Schumacher N, Steidl C, Gessler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "11044625", "url": "https://glygen.org/publication/PubMed/11044625" } ] }, { "title": "Activation of human peroxisome proliferator-activated receptor (PPAR) subtypes by pioglitazone.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Sakamoto J, Kimura H, Moriyama S, Odaka H, Momose Y, Sugiyama Y, Sawada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11095972", "url": "https://glygen.org/publication/PubMed/11095972" } ] }, { "title": "Notch signaling: from the outside in.", "journal": "Developmental biology", "date": "2000", "authors": "Mumm JS, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-350054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350054" } ], "reference": [ { "type": "PubMed", "id": "11112321", "url": "https://glygen.org/publication/PubMed/11112321" } ] }, { "title": "LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Laffitte BA, Repa JJ, Joseph SB, Wilpitz DC, Kast HR, Mangelsdorf DJ, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11149950", "url": "https://glygen.org/publication/PubMed/11149950" } ] }, { "title": "Human casein kinase Idelta phosphorylation of human circadian clock proteins period 1 and 2.", "journal": "FEBS letters", "date": "2001", "authors": "Camacho F, Cilio M, Guo Y, Virshup DM, Patel K, Khorkova O, Styren S, Morse B, Yao Z, Keesler GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "11165242", "url": "https://glygen.org/publication/PubMed/11165242" } ] }, { "title": "Fatty acids and hypolipidemic drugs regulate peroxisome proliferator-activated receptors alpha - and gamma-mediated gene expression via liver fatty acid binding protein: a signaling path to the nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Wolfrum C, Borrmann CM, Borchers T, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "11226238", "url": "https://glygen.org/publication/PubMed/11226238" } ] }, { "title": "An hPer2 phosphorylation site mutation in familial advanced sleep phase syndrome.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Toh KL, Jones CR, He Y, Eide EJ, Hinz WA, Virshup DM, Ptacek LJ, Fu YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "11232563", "url": "https://glygen.org/publication/PubMed/11232563" } ] }, { "title": "Alternative splicing and tissue-specific transcription of human and rodent ubiquitous 5-aminolevulinate synthase (ALAS1) genes.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Roberts AG, Elder GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "11267664", "url": "https://glygen.org/publication/PubMed/11267664" } ] }, { "title": "Peroxisome proliferator-activated receptors, coactivators, and downstream targets.", "journal": "Cell biochemistry and biophysics", "date": "2000", "authors": "Qi C, Zhu Y, Reddy JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "11330046", "url": "https://glygen.org/publication/PubMed/11330046" } ] }, { "title": "Pgc-1-related coactivator, a novel, serum-inducible coactivator of nuclear respiratory factor 1-dependent transcription in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Andersson U, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "11340167", "url": "https://glygen.org/publication/PubMed/11340167" } ] }, { "title": "Heme mediates derepression of Maf recognition element through direct binding to transcription repressor Bach1.", "journal": "The EMBO journal", "date": "2001", "authors": "Ogawa K, Sun J, Taketani S, Nakajima O, Nishitani C, Sassa S, Hayashi N, Yamamoto M, Shibahara S, Fujita H, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "11387216", "url": "https://glygen.org/publication/PubMed/11387216" } ] }, { "title": "TGF-beta induces assembly of a Smad2-Smurf2 ubiquitin ligase complex that targets SnoN for degradation.", "journal": "Nature cell biology", "date": "2001", "authors": "Bonni S, Wang HR, Causing CG, Kavsak P, Stroschein SL, Luo K, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "11389444", "url": "https://glygen.org/publication/PubMed/11389444" } ] }, { "title": "TGIF2 interacts with histone deacetylase 1 and represses transcription.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Melhuish TA, Gallo CM, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "11427533", "url": "https://glygen.org/publication/PubMed/11427533" } ] }, { "title": "Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Rutter J, Reick M, Wu LC, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "11441146", "url": "https://glygen.org/publication/PubMed/11441146" } ] }, { "title": "NPAS2: an analog of clock operative in the mammalian forebrain.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Reick M, Garcia JA, Dudley C, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "11441147", "url": "https://glygen.org/publication/PubMed/11441147" } ] }, { "title": "The Notch intracellular domain is ubiquitinated and negatively regulated by the mammalian Sel-10 homolog.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Oberg C, Li J, Pauley A, Wolf E, Gurney M, Lendahl U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "11461910", "url": "https://glygen.org/publication/PubMed/11461910" } ] }, { "title": "Characterization of the human ABCG1 gene: liver X receptor activates an internal promoter that produces a novel transcript encoding an alternative form of the protein.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kennedy MA, Venkateswaran A, Tarr PT, Xenarios I, Kudoh J, Shimizu N, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11500512", "url": "https://glygen.org/publication/PubMed/11500512" } ] }, { "title": "The SMRT and N-CoR corepressors are activating cofactors for histone deacetylase 3.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Guenther MG, Barak O, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11509652", "url": "https://glygen.org/publication/PubMed/11509652" } ] }, { "title": "ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Amann J M, Nip J, Strom D K, Lutterbach B, Harada H, Lenny N, Downing J R, Meyers S, Hiebert S W", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "11533236", "url": "https://glygen.org/publication/PubMed/11533236" } ] }, { "title": "SEL-10 is an inhibitor of notch signaling that targets notch for ubiquitin-mediated protein degradation.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Wu G, Lyapina S, Das I, Li J, Gurney M, Pauley A, Chui I, Deshaies RJ, Kitajewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "11585921", "url": "https://glygen.org/publication/PubMed/11585921" } ] }, { "title": "Autoregulation of the human liver X receptor alpha promoter.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Laffitte BA, Joseph SB, Walczak R, Pei L, Wilpitz DC, Collins JL, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11604492", "url": "https://glygen.org/publication/PubMed/11604492" } ] }, { "title": "gamma -Secretase cleavage and nuclear localization of ErbB-4 receptor tyrosine kinase.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Ni CY, Murphy MP, Golde TE, Carpenter G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "11679632", "url": "https://glygen.org/publication/PubMed/11679632" } ] }, { "title": "Isolation and characterization of a novel class II histone deacetylase, HDAC10.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fischer DD, Cai R, Bhatia U, Asselbergs FA, Song C, Terry R, Trogani N, Widmer R, Atadja P, Cohen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11739383", "url": "https://glygen.org/publication/PubMed/11739383" } ] }, { "title": "Drosophila neuralized is a ubiquitin ligase that promotes the internalization and degradation of delta.", "journal": "Developmental cell", "date": "2001", "authors": "Lai EC, Deblandre GA, Kintner C, Rubin GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "11740940", "url": "https://glygen.org/publication/PubMed/11740940" } ] }, { "title": "Valproic acid defines a novel class of HDAC inhibitors inducing differentiation of transformed cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Gottlicher M, Minucci S, Zhu P, Kramer OH, Schimpf A, Giavara S, Sleeman JP, Lo Coco F, Nervi C, Pelicci PG, Heinzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11742974", "url": "https://glygen.org/publication/PubMed/11742974" } ] }, { "title": "Fibrate and statin synergistically increase the transcriptional activities of PPARalpha/RXRalpha and decrease the transactivation of NFkappaB.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Inoue I, Itoh F, Aoyagi S, Tazawa S, Kusama H, Akahane M, Mastunaga T, Hayashi K, Awata T, Komoda T, Katayama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "11779144", "url": "https://glygen.org/publication/PubMed/11779144" } ] }, { "title": "A human mitochondrial transcription factor is related to RNA adenine methyltransferases and binds S-adenosylmethionine.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "McCulloch V, Seidel-Rogol BL, Shadel GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "11809803", "url": "https://glygen.org/publication/PubMed/11809803" } ] }, { "title": "Biological roles and mechanistic actions of co-repressor complexes.", "journal": "Journal of cell science", "date": "2002", "authors": "Jepsen K, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "11865025", "url": "https://glygen.org/publication/PubMed/11865025" } ] }, { "title": "Regional differences in the response of human pre-adipocytes to PPARgamma and RXRalpha agonists.", "journal": "Diabetes", "date": "2002", "authors": "Sewter CP, Blows F, Vidal-Puig A, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11872672", "url": "https://glygen.org/publication/PubMed/11872672" } ] }, { "title": "Induction of human liver X receptor alpha gene expression via an autoregulatory loop mechanism.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Li Y, Bolten C, Bhat BG, Woodring-Dietz J, Li S, Prayaga SK, Xia C, Lala DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11875109", "url": "https://glygen.org/publication/PubMed/11875109" } ] }, { "title": "Identification of mammalian Sds3 as an integral component of the Sin3/histone deacetylase corepressor complex.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Alland L, David G, Shen-Li H, Potes J, Muhle R, Lee HC, Hou H Jr, Chen K, DePinho RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11909966", "url": "https://glygen.org/publication/PubMed/11909966" } ] }, { "title": "The N-CoR-HDAC3 nuclear receptor corepressor complex inhibits the JNK pathway through the integral subunit GPS2.", "journal": "Mol. Cell", "date": "2002", "authors": "Zhang Jinsong, Kalkum Markus, Chait Brian T, Roeder Robert G", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "11931768", "url": "https://glygen.org/publication/PubMed/11931768" } ] }, { "title": "Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mak PA, Laffitte BA, Desrumaux C, Joseph SB, Curtiss LK, Mangelsdorf DJ, Tontonoz P, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12032151", "url": "https://glygen.org/publication/PubMed/12032151" } ] }, { "title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" } ] }, { "title": "Mastermind mediates chromatin-specific transcription and turnover of the Notch enhancer complex.", "journal": "Genes & development", "date": "2002", "authors": "Fryer CJ, Lamar E, Turbachova I, Kintner C, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "12050117", "url": "https://glygen.org/publication/PubMed/12050117" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Blanquart C, Barbier O, Fruchart JC, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12118000", "url": "https://glygen.org/publication/PubMed/12118000" } ] }, { "title": "Pro-oxidant and cytotoxic effects of circulating heme.", "journal": "Blood", "date": "2002", "authors": "Jeney V, Balla J, Yachie A, Varga Z, Vercellotti GM, Eaton JW, Balla G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12130498", "url": "https://glygen.org/publication/PubMed/12130498" } ] }, { "title": "Comparative genome analysis of potential regulatory elements in the ABCG5-ABCG8 gene cluster.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Remaley AT, Bark S, Walts AD, Freeman L, Shulenin S, Annilo T, Elgin E, Rhodes HE, Joyce C, Dean M, Santamarina-Fojo S, Brewer HB Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12150943", "url": "https://glygen.org/publication/PubMed/12150943" } ] }, { "title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.", "journal": "Journal of lipid research", "date": "2002", "authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12177166", "url": "https://glygen.org/publication/PubMed/12177166" } ] }, { "title": "Gamma-secretase-mediated proteolysis in cell-surface-receptor signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2002", "authors": "Fortini ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "12209127", "url": "https://glygen.org/publication/PubMed/12209127" } ] }, { "title": "Leptin gene expression in human preadipocytes is switched on by maturation-induced demethylation of distinct CpGs in its proximal promoter.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Melzner I, Scott V, Dorsch K, Fischer P, Wabitsch M, Bruderlein S, Hasel C, Moller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12213831", "url": "https://glygen.org/publication/PubMed/12213831" } ] }, { "title": "The disintegrin/metalloprotease ADAM 10 is essential for Notch signalling but not for alpha-secretase activity in fibroblasts.", "journal": "Human molecular genetics", "date": "2002", "authors": "Hartmann D, de Strooper B, Serneels L, Craessaerts K, Herreman A, Annaert W, Umans L, Lubke T, Lena Illert A, von Figura K, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "12354787", "url": "https://glygen.org/publication/PubMed/12354787" } ] }, { "title": "Hemoprotein Bach1 regulates enhancer availability of heme oxygenase-1 gene.", "journal": "The EMBO journal", "date": "2002", "authors": "Sun J, Hoshino H, Takaku K, Nakajima O, Muto A, Suzuki H, Tashiro S, Takahashi S, Shibahara S, Alam J, Taketo MM, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12356737", "url": "https://glygen.org/publication/PubMed/12356737" } ] }, { "title": "SHARP is a novel component of the Notch/RBP-Jkappa signalling pathway.", "journal": "The EMBO journal", "date": "2002", "authors": "Oswald F, Kostezka U, Astrahantseff K, Bourteele S, Dillinger K, Zechner U, Ludwig L, Wilda M, Hameister H, Knochel W, Liptay S, Schmid RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-350054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350054" } ], "reference": [ { "type": "PubMed", "id": "12374742", "url": "https://glygen.org/publication/PubMed/12374742" } ] }, { "title": "SIRT3, a human SIR2 homologue, is an NAD-dependent deacetylase localized to mitochondria.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Onyango P, Celic I, McCaffery JM, Boeke JD, Feinberg AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "12374852", "url": "https://glygen.org/publication/PubMed/12374852" } ] }, { "title": "Transcriptional regulation of human Rev-erbalpha gene expression by the orphan nuclear receptor retinoic acid-related orphan receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Raspe E, Mautino G, Duval C, Fontaine C, Duez H, Barbier O, Monte D, Fruchart J, Fruchart JC, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "12377782", "url": "https://glygen.org/publication/PubMed/12377782" } ] }, { "title": "p300 and PCAF act cooperatively to mediate transcriptional activation from chromatin templates by notch intracellular domains in vitro.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Wallberg AE, Pedersen K, Lendahl U, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "12391150", "url": "https://glygen.org/publication/PubMed/12391150" } ] }, { "title": "Identification of PLTP as an LXR target gene and apoE as an FXR target gene reveals overlapping targets for the two nuclear receptors.", "journal": "Journal of lipid research", "date": "2002", "authors": "Mak PA, Kast-Woelbern HR, Anisfeld AM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12454263", "url": "https://glygen.org/publication/PubMed/12454263" } ] }, { "title": "Regulation of P450 4A expression by peroxisome proliferator activated receptors.", "journal": "Toxicology", "date": "2002", "authors": "Johnson EF, Hsu MH, Savas U, Griffin KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12505311", "url": "https://glygen.org/publication/PubMed/12505311" } ] }, { "title": "Bach1 functions as a hypoxia-inducible repressor for the heme oxygenase-1 gene in human cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kitamuro T, Takahashi K, Ogawa K, Udono-Fujimori R, Takeda K, Furuyama K, Nakayama M, Sun J, Fujita H, Hida W, Hattori T, Shirato K, Igarashi K, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12511571", "url": "https://glygen.org/publication/PubMed/12511571" } ] }, { "title": "Mind bomb is a ubiquitin ligase that is essential for efficient activation of Notch signaling by Delta.", "journal": "Developmental cell", "date": "2003", "authors": "Itoh M, Kim CH, Palardy G, Oda T, Jiang YJ, Maust D, Yeo SY, Lorick K, Wright GJ, Ariza-McNaughton L, Weissman AM, Lewis J, Chandrasekharappa SC, Chitnis AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "12530964", "url": "https://glygen.org/publication/PubMed/12530964" } ] }, { "title": "Exercise induces transient transcriptional activation of the PGC-1alpha gene in human skeletal muscle.", "journal": "The Journal of physiology", "date": "2003", "authors": "Pilegaard H, Saltin B, Neufer PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "12563009", "url": "https://glygen.org/publication/PubMed/12563009" } ] }, { "title": "The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Barbier O, Villeneuve L, Bocher V, Fontaine C, Torra IP, Duhem C, Kosykh V, Fruchart JC, Guillemette C, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12582161", "url": "https://glygen.org/publication/PubMed/12582161" } ] }, { "title": "The histone deacetylase 9 gene encodes multiple protein isoforms.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Petrie K, Guidez F, Howell L, Healy L, Waxman S, Greaves M, Zelent A", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "12590135", "url": "https://glygen.org/publication/PubMed/12590135" } ] }, { "title": "The phospholipid transfer protein gene is a liver X receptor target expressed by macrophages in atherosclerotic lesions.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Laffitte BA, Joseph SB, Chen M, Castrillo A, Repa J, Wilpitz D, Mangelsdorf D, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12612088", "url": "https://glygen.org/publication/PubMed/12612088" } ] }, { "title": "Identification and characterization of three new components of the mSin3A corepressor complex.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Fleischer TC, Yun UJ, Ayer DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12724404", "url": "https://glygen.org/publication/PubMed/12724404" } ] }, { "title": "Understanding ATP synthesis: structure and mechanism of the F1-ATPase (Review).", "journal": "Molecular membrane biology", "date": "2003", "authors": "Leyva JA, Bianchet MA, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "12745923", "url": "https://glygen.org/publication/PubMed/12745923" } ] }, { "title": "WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Komuro A, Nagai M, Navin NE, Sudol M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "12807903", "url": "https://glygen.org/publication/PubMed/12807903" } ] }, { "title": "Induction of adiponectin, a fat-derived antidiabetic and antiatherogenic factor, by nuclear receptors.", "journal": "Diabetes", "date": "2003", "authors": "Iwaki M, Matsuda M, Maeda N, Funahashi T, Matsuzawa Y, Makishima M, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12829629", "url": "https://glygen.org/publication/PubMed/12829629" } ] }, { "title": "Microtubule network facilitates nuclear targeting of human cytomegalovirus capsid.", "journal": "Journal of virology", "date": "2003", "authors": "Ogawa-Goto K, Tanaka K, Gibson W, Moriishi E, Miura Y, Kurata T, Irie S, Sata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "12857923", "url": "https://glygen.org/publication/PubMed/12857923" } ] }, { "title": "Carbon monoxide specifically inhibits cytochrome c oxidase of human mitochondrial respiratory chain.", "journal": "Pharmacology & toxicology", "date": "2003", "authors": "Alonso JR, Cardellach F, Lopez S, Casademont J, Miro O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "12969439", "url": "https://glygen.org/publication/PubMed/12969439" } ] }, { "title": "Expression of the blue-light receptor cryptochrome in the human retina.", "journal": "Investigative ophthalmology & visual science", "date": "2003", "authors": "Thompson CL, Bowes Rickman C, Shaw SJ, Ebright JN, Kelly U, Sancar A, Rickman DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "14507900", "url": "https://glygen.org/publication/PubMed/14507900" } ] }, { "title": "DACH1 inhibits transforming growth factor-beta signaling through binding Smad4.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Wu Kongming, Yang Ying, Wang Chenguang, Davoli Maria A, D'Amico Mark, Li Anping, Cveklova Kveta, Kozmik Zbynek, Lisanti Michael P, Russell Robert G, Cvekl Ales, Pestell Richard G", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "14525983", "url": "https://glygen.org/publication/PubMed/14525983" } ] }, { "title": "N-CoR mediates DNA methylation-dependent repression through a methyl CpG binding protein Kaiso.", "journal": "Molecular cell", "date": "2003-09", "authors": "Yoon Ho-Geun, Chan Doug W, Reynolds Albert B, Qin Jun, Wong Jiemin", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "14527417", "url": "https://glygen.org/publication/PubMed/14527417" } ] }, { "title": "FXRE can function as an LXRE in the promoter of human ileal bile acid-binding protein (I-BABP) gene.", "journal": "FEBS letters", "date": "2003", "authors": "Landrier JF, Grober J, Demydchuk J, Besnard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9623433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9623433" } ], "reference": [ { "type": "PubMed", "id": "14572640", "url": "https://glygen.org/publication/PubMed/14572640" } ] }, { "title": "Liver X receptors are regulators of adipocyte gene expression but not differentiation: identification of apoD as a direct target.", "journal": "Journal of lipid research", "date": "2004", "authors": "Hummasti S, Laffitte BA, Watson MA, Galardi C, Chao LC, Ramamurthy L, Moore JT, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "14703507", "url": "https://glygen.org/publication/PubMed/14703507" } ] }, { "title": "Phosphorylation of clock protein PER1 regulates its circadian degradation in normal human fibroblasts.", "journal": "The Biochemical journal", "date": "2004", "authors": "Miyazaki K, Nagase T, Mesaki M, Narukawa J, Ohara O, Ishida N", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "14750904", "url": "https://glygen.org/publication/PubMed/14750904" } ] }, { "title": "Role of p160 coactivator complex in the activation of liver X receptor.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "Huuskonen J, Fielding PE, Fielding CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "14764426", "url": "https://glygen.org/publication/PubMed/14764426" } ] }, { "title": "A corepressor/coactivator exchange complex required for transcriptional activation by nuclear receptors and other regulated transcription factors.", "journal": "Cell", "date": "2004", "authors": "Perissi V, Aggarwal A, Glass CK, Rose DW, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "14980219", "url": "https://glygen.org/publication/PubMed/14980219" } ] }, { "title": "Ligand-regulated association of ErbB-4 to the transcriptional co-activator YAP65 controls transcription at the nuclear level.", "journal": "Experimental cell research", "date": "2004", "authors": "Omerovic J, Puggioni EM, Napoletano S, Visco V, Fraioli R, Frati L, Gulino A, Alimandi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "15023535", "url": "https://glygen.org/publication/PubMed/15023535" } ] }, { "title": "Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.", "journal": "International journal of molecular medicine", "date": "2004", "authors": "Shimamoto Y, Hirota K, Fukamizu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15067378", "url": "https://glygen.org/publication/PubMed/15067378" } ] }, { "title": "The Notch target genes Hey1 and Hey2 are required for embryonic vascular development.", "journal": "Genes & development", "date": "2004", "authors": "Fischer A, Schumacher N, Maier M, Sendtner M, Gessler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "15107403", "url": "https://glygen.org/publication/PubMed/15107403" } ] }, { "title": "Functional analysis of peroxisome-proliferator-responsive element motifs in genes of fatty acid-binding proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Schachtrup C, Emmler T, Bleck B, Sandqvist A, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15130092", "url": "https://glygen.org/publication/PubMed/15130092" } ] }, { "title": "ADP-ribosylation factor (ARF)-like 7 (ARL7) is induced by cholesterol loading and participates in apolipoprotein AI-dependent cholesterol export.", "journal": "FEBS letters", "date": "2004", "authors": "Engel T, Lueken A, Bode G, Hobohm U, Lorkowski S, Schlueter B, Rust S, Cullen P, Pech M, Assmann G, Seedorf U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "15147902", "url": "https://glygen.org/publication/PubMed/15147902" } ] }, { "title": "A unified nomenclature for protein subunits of mediator complexes linking transcriptional regulators to RNA polymerase II.", "journal": "Molecular cell", "date": "2004", "authors": "Bourbon HM, Aguilera A, Ansari AZ, Asturias FJ, Berk AJ, Bjorklund S, Blackwell TK, Borggrefe T, Carey M, Carlson M, Conaway JW, Conaway RC, Emmons SW, Fondell JD, Freedman LP, Fukasawa T, Gustafsson CM, Han M, He X, Herman PK, Hinnebusch AG, Holmberg S, Holstege FC, Jaehning JA, Kim YJ, Kuras L, Leutz A, Lis JT, Meisterernest M, Naar AM, Nasmyth K, Parvin JD, Ptashne M, Reinberg D, Ronne H, Sadowski I, Sakurai H, Sipiczki M, Sternberg PW, Stillman DJ, Strich R, Struhl K, Svejstrup JQ, Tuck S, Winston F, Roeder RG, Kornberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "15175151", "url": "https://glygen.org/publication/PubMed/15175151" } ] }, { "title": "Heme regulates gene expression by triggering Crm1-dependent nuclear export of Bach1.", "journal": "The EMBO journal", "date": "2004", "authors": "Suzuki H, Tashiro S, Hira S, Sun J, Yamazaki C, Zenke Y, Ikeda-Saito M, Yoshida M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "15175654", "url": "https://glygen.org/publication/PubMed/15175654" } ] }, { "title": "Human adipocyte fatty acid-binding protein (aP2) gene promoter-driven reporter assay discriminates nonlipogenic peroxisome proliferator-activated receptor gamma ligands.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Rival Y, Stennevin A, Puech L, Rouquette A, Cathala C, Lestienne F, Dupont-Passelaigue E, Patoiseau JF, Wurch T, Junquero D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15273253", "url": "https://glygen.org/publication/PubMed/15273253" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "MeCP2 behaves as an elongated monomer that does not stably associate with the Sin3a chromatin remodeling complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Klose RJ, Bird AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "15322089", "url": "https://glygen.org/publication/PubMed/15322089" } ] }, { "title": "MTA3 and the Mi-2/NuRD complex regulate cell fate during B lymphocyte differentiation.", "journal": "Cell", "date": "2004", "authors": "Fujita N, Jaye DL, Geigerman C, Akyildiz A, Mooney MR, Boss JM, Wade PA", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "15454082", "url": "https://glygen.org/publication/PubMed/15454082" } ] }, { "title": "The ERBB4/HER4 receptor tyrosine kinase regulates gene expression by functioning as a STAT5A nuclear chaperone.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Williams CC, Allison JG, Vidal GA, Burow ME, Beckman BS, Marrero L, Jones FE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "15534001", "url": "https://glygen.org/publication/PubMed/15534001" } ] }, { "title": "Mastermind recruits CycC:CDK8 to phosphorylate the Notch ICD and coordinate activation with turnover.", "journal": "Molecular cell", "date": "2004", "authors": "Fryer CJ, White JB, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "15546612", "url": "https://glygen.org/publication/PubMed/15546612" } ] }, { "title": "Fringe glycosyltransferases differentially modulate Notch1 proteolysis induced by Delta1 and Jagged1.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Yang LT, Nichols JT, Yao C, Manilay JO, Robey EA, Weinmaster G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15574878", "url": "https://glygen.org/publication/PubMed/15574878" } ] }, { "title": "Regulation of human hepatic hydroxysteroid sulfotransferase gene expression by the peroxisome proliferator-activated receptor alpha transcription factor.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Fang HL, Strom SC, Cai H, Falany CN, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15635043", "url": "https://glygen.org/publication/PubMed/15635043" } ] }, { "title": "System-level identification of transcriptional circuits underlying mammalian circadian clocks.", "journal": "Nature genetics", "date": "2005", "authors": "Ueda HR, Hayashi S, Chen W, Sano M, Machida M, Shigeyoshi Y, Iino M, Hashimoto S", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "15665827", "url": "https://glygen.org/publication/PubMed/15665827" } ] }, { "title": "Control of mitochondrial transcription specificity factors (TFB1M and TFB2M) by nuclear respiratory factors (NRF-1 and NRF-2) and PGC-1 family coactivators.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Gleyzer N, Vercauteren K, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "15684387", "url": "https://glygen.org/publication/PubMed/15684387" } ] }, { "title": "Two distinct E3 ubiquitin ligases have complementary functions in the regulation of delta and serrate signaling in Drosophila.", "journal": "PLoS biology", "date": "2005", "authors": "Le Borgne R, Remaud S, Hamel S, Schweisguth F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15760269", "url": "https://glygen.org/publication/PubMed/15760269" } ] }, { "title": "The orphan nuclear receptor Rev-erbalpha recruits the N-CoR/histone deacetylase 3 corepressor to regulate the circadian Bmal1 gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Yin L, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "15761026", "url": "https://glygen.org/publication/PubMed/15761026" } ] }, { "title": "Functional consequences of a CKIdelta mutation causing familial advanced sleep phase syndrome.", "journal": "Nature", "date": "2005", "authors": "Xu Y, Padiath QS, Shapiro RE, Jones CR, Wu SC, Saigoh N, Saigoh K, Ptacek LJ, Fu YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "15800623", "url": "https://glygen.org/publication/PubMed/15800623" } ] }, { "title": "Germ-layer specification and control of cell growth by Ectodermin, a Smad4 ubiquitin ligase.", "journal": "Cell", "date": "2005", "authors": "Dupont S, Zacchigna L, Cordenonsi M, Soligo S, Adorno M, Rugge M, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "15820681", "url": "https://glygen.org/publication/PubMed/15820681" } ] }, { "title": "Mind bomb-2 is an E3 ligase for Notch ligand.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Koo BK, Yoon KJ, Yoo KW, Lim HS, Song R, So JH, Kim CH, Kong YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15824097", "url": "https://glygen.org/publication/PubMed/15824097" } ] }, { "title": "The ubiquitin ligase Drosophila Mind bomb promotes Notch signaling by regulating the localization and activity of Serrate and Delta.", "journal": "Development (Cambridge, England)", "date": "2005", "authors": "Lai EC, Roegiers F, Qin X, Jan YN, Rubin GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "15829515", "url": "https://glygen.org/publication/PubMed/15829515" } ] }, { "title": "Identification of the promoter region required for human adiponectin gene transcription: Association with CCAAT/enhancer binding protein-beta and tumor necrosis factor-alpha.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kita A, Yamasaki H, Kuwahara H, Moriuchi A, Fukushima K, Kobayashi M, Fukushima T, Takahashi R, Abiru N, Uotani S, Kawasaki E, Eguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15850785", "url": "https://glygen.org/publication/PubMed/15850785" } ] }, { "title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2005", "authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "15867264", "url": "https://glygen.org/publication/PubMed/15867264" } ] }, { "title": "Dynamic regulation of pol II transcription by the mammalian Mediator complex.", "journal": "Trends in biochemical sciences", "date": "2005", "authors": "Malik S, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "15896744", "url": "https://glygen.org/publication/PubMed/15896744" } ] }, { "title": "SCFbeta-TRCP controls clock-dependent transcription via casein kinase 1-dependent degradation of the mammalian period-1 (Per1) protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shirogane T, Jin J, Ang XL, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "15917222", "url": "https://glygen.org/publication/PubMed/15917222" } ] }, { "title": "C/EBPalpha regulates human adiponectin gene transcription through an intronic enhancer.", "journal": "Diabetes", "date": "2005", "authors": "Qiao L, Maclean PS, Schaack J, Orlicky DJ, Darimont C, Pagliassotti M, Friedman JE, Shao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15919796", "url": "https://glygen.org/publication/PubMed/15919796" } ] }, { "title": "JMJD2A is a novel N-CoR-interacting protein and is involved in repression of the human transcription factor achaete scute-like homologue 2 (ASCL2/Hash2).", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Zhang D, Yoon HG, Wong J", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "16024779", "url": "https://glygen.org/publication/PubMed/16024779" } ] }, { "title": "WW domain-containing proteins, WWOX and YAP, compete for interaction with ErbB-4 and modulate its transcriptional function.", "journal": "Cancer research", "date": "2005", "authors": "Aqeilan RI, Donati V, Palamarchuk A, Trapasso F, Kaou M, Pekarsky Y, Sudol M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "16061658", "url": "https://glygen.org/publication/PubMed/16061658" } ] }, { "title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.", "journal": "Human molecular genetics", "date": "2005", "authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16079151", "url": "https://glygen.org/publication/PubMed/16079151" } ] }, { "title": "Evolutionarily conserved and nonconserved cellular localizations and functions of human SIRT proteins.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Michishita E, Park JY, Burneskis JM, Barrett JC, Horikawa I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "16079181", "url": "https://glygen.org/publication/PubMed/16079181" } ] }, { "title": "Transcription of mammalian messenger RNAs by a nuclear RNA polymerase of mitochondrial origin.", "journal": "Nature", "date": "2005", "authors": "Kravchenko JE, Rogozin IB, Koonin EV, Chumakov PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "16079853", "url": "https://glygen.org/publication/PubMed/16079853" } ] }, { "title": "The interplay between DSL proteins and ubiquitin ligases in Notch signaling.", "journal": "Development (Cambridge, England)", "date": "2005", "authors": "Pitsouli C, Delidakis C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "16093323", "url": "https://glygen.org/publication/PubMed/16093323" } ] }, { "title": "Deletion of gpUL132, a structural component of human cytomegalovirus, results in impaired virus replication in fibroblasts.", "journal": "Journal of virology", "date": "2005", "authors": "Spaderna S, Kropff B, Kodel Y, Shen S, Coley S, Lu S, Britt W, Mach M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "16140760", "url": "https://glygen.org/publication/PubMed/16140760" } ] }, { "title": "Identification and characterization of ERK MAP kinase phosphorylation sites in Smad3.", "journal": "Biochemistry", "date": "2005", "authors": "Matsuura I, Wang G, He D, Liu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "16156666", "url": "https://glygen.org/publication/PubMed/16156666" } ] }, { "title": "Hypoxia requires notch signaling to maintain the undifferentiated cell state.", "journal": "Developmental cell", "date": "2005", "authors": "Gustafsson MV, Zheng X, Pereira T, Gradin K, Jin S, Lundkvist J, Ruas JL, Poellinger L, Lendahl U, Bondesson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "16256737", "url": "https://glygen.org/publication/PubMed/16256737" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Feedback repression is required for mammalian circadian clock function.", "journal": "Nature genetics", "date": "2006", "authors": "Sato TK, Yamada RG, Ukai H, Baggs JE, Miraglia LJ, Kobayashi TJ, Welsh DK, Kay SA, Ueda HR, Hogenesch JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "16474406", "url": "https://glygen.org/publication/PubMed/16474406" } ] }, { "title": "From molecular action to physiological outputs: peroxisome proliferator-activated receptors are nuclear receptors at the crossroads of key cellular functions.", "journal": "Progress in lipid research", "date": "2006", "authors": "Feige JN, Gelman L, Michalik L, Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "16476485", "url": "https://glygen.org/publication/PubMed/16476485" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha) and athero-sclerosis.", "journal": "Current drug targets. Cardiovascular & haematological disorders", "date": "2005", "authors": "Gouni-Berthold I, Krone W", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "16503871", "url": "https://glygen.org/publication/PubMed/16503871" } ] }, { "title": "Structural basis for cooperativity in recruitment of MAML coactivators to Notch transcription complexes.", "journal": "Cell", "date": "2006", "authors": "Nam Y, Sliz P, Song L, Aster JC, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "16530044", "url": "https://glygen.org/publication/PubMed/16530044" } ] }, { "title": "Crystal structure of the CSL-Notch-Mastermind ternary complex bound to DNA.", "journal": "Cell", "date": "2006", "authors": "Wilson JJ, Kovall RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-350054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350054" } ], "reference": [ { "type": "PubMed", "id": "16530045", "url": "https://glygen.org/publication/PubMed/16530045" } ] }, { "title": "MicroRNA fingerprints during human megakaryocytopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16549775", "url": "https://glygen.org/publication/PubMed/16549775" } ] }, { "title": "Identification of STAT3 as a specific substrate of breast tumor kinase.", "journal": "Oncogene", "date": "2006", "authors": "Liu L, Gao Y, Qiu H, Miller WT, Poli V, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "16568091", "url": "https://glygen.org/publication/PubMed/16568091" } ] }, { "title": "Leukemia-associated mutations within the NOTCH1 heterodimerization domain fall into at least two distinct mechanistic classes.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Malecki MJ, Sanchez-Irizarry C, Mitchell JL, Histen G, Xu ML, Aster JC, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2894862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2894862" } ], "reference": [ { "type": "PubMed", "id": "16738328", "url": "https://glygen.org/publication/PubMed/16738328" } ] }, { "title": "PPM1A functions as a Smad phosphatase to terminate TGFbeta signaling.", "journal": "Cell", "date": "2006", "authors": "Lin X, Duan X, Liang YY, Su Y, Wrighton KH, Long J, Hu M, Davis CM, Wang J, Brunicardi FC, Shi Y, Chen YG, Meng A, Feng XH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "16751101", "url": "https://glygen.org/publication/PubMed/16751101" } ] }, { "title": "Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway.", "journal": "Cell", "date": "2006", "authors": "He W, Dorn DC, Erdjument-Bromage H, Tempst P, Moore MA, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "16751102", "url": "https://glygen.org/publication/PubMed/16751102" } ] }, { "title": "Sensors and signals: a coactivator/corepressor/epigenetic code for integrating signal-dependent programs of transcriptional response.", "journal": "Genes & development", "date": "2006", "authors": "Rosenfeld MG, Lunyak VV, Glass CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "16751179", "url": "https://glygen.org/publication/PubMed/16751179" } ] }, { "title": "Reversible lysine acetylation controls the activity of the mitochondrial enzyme acetyl-CoA synthetase 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Schwer B, Bunkenborg J, Verdin RO, Andersen JS, Verdin E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "16788062", "url": "https://glygen.org/publication/PubMed/16788062" } ] }, { "title": "The liver X-receptor alpha controls hepatic expression of the human bile acid-glucuronidating UGT1A3 enzyme in human cells and transgenic mice.", "journal": "Hepatology (Baltimore, Md.)", "date": "2006", "authors": "Verreault M, Senekeo-Effenberger K, Trottier J, Bonzo JA, Belanger J, Kaeding J, Staels B, Caron P, Tukey RH, Barbier O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9623433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9623433" } ], "reference": [ { "type": "PubMed", "id": "16871576", "url": "https://glygen.org/publication/PubMed/16871576" } ] }, { "title": "Control of the ATP synthase beta subunit expression by RNA-binding proteins TIA-1, TIAR, and HuR.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Izquierdo JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "16890199", "url": "https://glygen.org/publication/PubMed/16890199" } ] }, { "title": "PGC-1-related coactivator: immediate early expression and characterization of a CREB/NRF-1 binding domain associated with cytochrome c promoter occupancy and respiratory growth.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Vercauteren K, Pasko RA, Gleyzer N, Marino VM, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "16908542", "url": "https://glygen.org/publication/PubMed/16908542" } ] }, { "title": "Mitochondrial preprotein translocases as dynamic molecular machines.", "journal": "FEMS yeast research", "date": "2006", "authors": "van der Laan M, Rissler M, Rehling P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "16911507", "url": "https://glygen.org/publication/PubMed/16911507" } ] }, { "title": "Coregulation of estrogen receptor by ERBB4/HER4 establishes a growth-promoting autocrine signal in breast tumor cells.", "journal": "Cancer research", "date": "2006", "authors": "Zhu Y, Sullivan LL, Nair SS, Williams CC, Pandey AK, Marrero L, Vadlamudi RK, Jones FE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "16912174", "url": "https://glygen.org/publication/PubMed/16912174" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "The arylhydrocarbon receptor repressor (AhRR): structure, expression, and function.", "journal": "Biological chemistry", "date": "2006", "authors": "Haarmann-Stemmann T, Abel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16972786", "url": "https://glygen.org/publication/PubMed/16972786" } ] }, { "title": "Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Song R, Koo BK, Yoon KJ, Yoon MJ, Yoo KW, Kim HT, Oh HJ, Kim YY, Han JK, Kim CH, Kong YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17003037", "url": "https://glygen.org/publication/PubMed/17003037" } ] }, { "title": "Selectivity of fatty acid ligands for PPARalpha which correlates both with binding to cis-element and DNA binding-independent transactivity in Caco-2 cells.", "journal": "Life sciences", "date": "2006", "authors": "Mochizuki K, Suruga K, Fukami H, Kiso Y, Takase S, Goda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "17007889", "url": "https://glygen.org/publication/PubMed/17007889" } ] }, { "title": "Transcriptional control of adipocyte formation.", "journal": "Cell metabolism", "date": "2006", "authors": "Farmer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17011499", "url": "https://glygen.org/publication/PubMed/17011499" } ] }, { "title": "Presenilin-dependent ErbB4 nuclear signaling regulates the timing of astrogenesis in the developing brain.", "journal": "Cell", "date": "2006", "authors": "Sardi SP, Murtie J, Koirala S, Patten BA, Corfas G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "17018285", "url": "https://glygen.org/publication/PubMed/17018285" } ] }, { "title": "Evidence for an early gene duplication event in the evolution of the mitochondrial transcription factor B family and maintenance of rRNA methyltransferase activity in human mtTFB1 and mtTFB2.", "journal": "Journal of molecular evolution", "date": "2006", "authors": "Cotney J, Shadel GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "17031457", "url": "https://glygen.org/publication/PubMed/17031457" } ] }, { "title": "Brain-specific phosphorylation of MeCP2 regulates activity-dependent Bdnf transcription, dendritic growth, and spine maturation.", "journal": "Neuron", "date": "2006", "authors": "Zhou Z, Hong EJ, Cohen S, Zhao WN, Ho HY, Schmidt L, Chen WG, Lin Y, Savner E, Griffith EC, Hu L, Steen JA, Weitz CJ, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "17046689", "url": "https://glygen.org/publication/PubMed/17046689" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "NOTCH1 directly regulates c-MYC and activates a feed-forward-loop transcriptional network promoting leukemic cell growth.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Palomero T, Lim WK, Odom DT, Sulis ML, Real PJ, Margolin A, Barnes KC, O'Neil J, Neuberg D, Weng AP, Aster JC, Sigaux F, Soulier J, Look AT, Young RA, Califano A, Ferrando AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "17114293", "url": "https://glygen.org/publication/PubMed/17114293" } ] }, { "title": "Structures of CSL, Notch and Mastermind proteins: piecing together an active transcription complex.", "journal": "Current opinion in structural biology", "date": "2007", "authors": "Kovall RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-350054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350054" } ], "reference": [ { "type": "PubMed", "id": "17157496", "url": "https://glygen.org/publication/PubMed/17157496" } ] }, { "title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17185360", "url": "https://glygen.org/publication/PubMed/17185360" } ] }, { "title": "Selective up-regulation of LXR-regulated genes ABCA1, ABCG1, and APOE in macrophages through increased endogenous synthesis of 24(S),25-epoxycholesterol.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Beyea MM, Heslop CL, Sawyez CG, Edwards JY, Markle JG, Hegele RA, Huff MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "17186944", "url": "https://glygen.org/publication/PubMed/17186944" } ] }, { "title": "Dimethyl sulfoxide to vorinostat: development of this histone deacetylase inhibitor as an anticancer drug.", "journal": "Nature biotechnology", "date": "2007", "authors": "Marks PA, Breslow R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "17211407", "url": "https://glygen.org/publication/PubMed/17211407" } ] }, { "title": "Modeling of a human circadian mutation yields insights into clock regulation by PER2.", "journal": "Cell", "date": "2007", "authors": "Xu Y, Toh KL, Jones CR, Shin JY, Fu YH, Ptacek LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "17218255", "url": "https://glygen.org/publication/PubMed/17218255" } ] }, { "title": "Carbon monoxide signals via inhibition of cytochrome c oxidase and generation of mitochondrial reactive oxygen species.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2007", "authors": "Zuckerbraun BS, Chin BY, Bilban M, d'Avila JC, Rao J, Billiar TR, Otterbein LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "17264172", "url": "https://glygen.org/publication/PubMed/17264172" } ] }, { "title": "Transcription coactivators for peroxisome proliferator-activated receptors.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Yu S, Reddy JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "17306620", "url": "https://glygen.org/publication/PubMed/17306620" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Structural basis for autoinhibition of Notch.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Gordon WR, Vardar-Ulu D, Histen G, Sanchez-Irizarry C, Aster JC, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17401372", "url": "https://glygen.org/publication/PubMed/17401372" } ] }, { "title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17428788", "url": "https://glygen.org/publication/PubMed/17428788" } ] }, { "title": "SirT3 is a nuclear NAD+-dependent histone deacetylase that translocates to the mitochondria upon cellular stress.", "journal": "Genes & development", "date": "2007", "authors": "Scher MB, Vaquero A, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "17437997", "url": "https://glygen.org/publication/PubMed/17437997" } ] }, { "title": "Smad7 antagonizes transforming growth factor beta signaling in the nucleus by interfering with functional Smad-DNA complex formation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Zhang S, Fei T, Zhang L, Zhang R, Chen F, Ning Y, Han Y, Feng XH, Meng A, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "17438144", "url": "https://glygen.org/publication/PubMed/17438144" } ] }, { "title": "Regulation of P-TEFb elongation complex activity by CDK9 acetylation.", "journal": "Mol. Cell. Biol.", "date": "2007", "authors": "Fu J, Yoon HG, Qin J, Wong J", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "17452463", "url": "https://glygen.org/publication/PubMed/17452463" } ] }, { "title": "Arkadia induces degradation of SnoN and c-Ski to enhance transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Nagano Y, Mavrakis KJ, Lee KL, Fujii T, Koinuma D, Sase H, Yuki K, Isogaya K, Saitoh M, Imamura T, Episkopou V, Miyazono K, Miyazawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "17510063", "url": "https://glygen.org/publication/PubMed/17510063" } ] }, { "title": "Novel regulatory role for human Acf1 in transcriptional repression of vitamin D3 receptor-regulated genes.", "journal": "Mol. Endocrinol.", "date": "2007", "authors": "Ewing Amy K, Attner Michelle, Chakravarti Debabrata", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "17519354", "url": "https://glygen.org/publication/PubMed/17519354" } ] }, { "title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.", "journal": "The EMBO journal", "date": "1991", "authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1756725", "url": "https://glygen.org/publication/PubMed/1756725" } ] }, { "title": "Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "17591695", "url": "https://glygen.org/publication/PubMed/17591695" } ] }, { "title": "Evolution of Na,K-ATPase beta m-subunit into a coregulator of transcription in placental mammals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Pestov NB, Ahmad N, Korneenko TV, Zhao H, Radkov R, Schaer D, Roy S, Bibert S, Geering K, Modyanov NN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "17592128", "url": "https://glygen.org/publication/PubMed/17592128" } ] }, { "title": "The SCFFBW7 ubiquitin ligase complex as a tumor suppressor in T cell leukemia.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Thompson BJ, Buonamici S, Sulis ML, Palomero T, Vilimas T, Basso G, Ferrando A, Aifantis I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17646408", "url": "https://glygen.org/publication/PubMed/17646408" } ] }, { "title": "FBW7 mutations in leukemic cells mediate NOTCH pathway activation and resistance to gamma-secretase inhibitors.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "O'Neil J, Grim J, Strack P, Rao S, Tibbitts D, Winter C, Hardwick J, Welcker M, Meijerink JP, Pieters R, Draetta G, Sears R, Clurman BE, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "17646409", "url": "https://glygen.org/publication/PubMed/17646409" } ] }, { "title": "DNA methylation regulates MicroRNA expression.", "journal": "Cancer biology & therapy", "date": "2007", "authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17660710", "url": "https://glygen.org/publication/PubMed/17660710" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "Regulation of insulin secretion by SIRT4, a mitochondrial ADP-ribosyltransferase.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Ahuja N, Schwer B, Carobbio S, Waltregny D, North BJ, Castronovo V, Maechler P, Verdin E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "17715127", "url": "https://glygen.org/publication/PubMed/17715127" } ] }, { "title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17761849", "url": "https://glygen.org/publication/PubMed/17761849" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Mammalian Sir2 homolog SIRT3 regulates global mitochondrial lysine acetylation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Lombard DB, Alt FW, Cheng HL, Bunkenborg J, Streeper RS, Mostoslavsky R, Kim J, Yancopoulos G, Valenzuela D, Murphy A, Yang Y, Chen Y, Hirschey MD, Bronson RT, Haigis M, Guarente LP, Farese RV Jr, Weissman S, Verdin E, Schwer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "17923681", "url": "https://glygen.org/publication/PubMed/17923681" } ] }, { "title": "Effect of heterodimer partner RXRalpha on PPARgamma activation function-2 helix in solution.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Lu J, Chen M, Stanley SE, Li E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17980149", "url": "https://glygen.org/publication/PubMed/17980149" } ] }, { "title": "Homeostatic regulation of MeCP2 expression by a CREB-induced microRNA.", "journal": "Nature neuroscience", "date": "2007", "authors": "Klein ME, Lioy DT, Ma L, Impey S, Mandel G, Goodman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "17994015", "url": "https://glygen.org/publication/PubMed/17994015" } ] }, { "title": "Activation of human period-1 by PKA or CLOCK/BMAL1 is conferred by separate signal transduction pathways.", "journal": "Chronobiology international", "date": "2007", "authors": "Motzkus D, Loumi S, Cadenas C, Vinson C, Forssmann WG, Maronde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "17994337", "url": "https://glygen.org/publication/PubMed/17994337" } ] }, { "title": "Rev-erbalpha, a heme sensor that coordinates metabolic and circadian pathways.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Yin L, Wu N, Curtin JC, Qatanani M, Szwergold NR, Reid RA, Waitt GM, Parks DJ, Pearce KH, Wisely GB, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "18006707", "url": "https://glygen.org/publication/PubMed/18006707" } ] }, { "title": "Identification of heme as the ligand for the orphan nuclear receptors REV-ERBalpha and REV-ERBbeta.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Raghuram S, Stayrook KR, Huang P, Rogers PM, Nosie AK, McClure DB, Burris LL, Khorasanizadeh S, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "18037887", "url": "https://glygen.org/publication/PubMed/18037887" } ] }, { "title": "An obligatory role of mind bomb-1 in notch signaling of mammalian development.", "journal": "PloS one", "date": "2007", "authors": "Koo BK, Yoon MJ, Yoon KJ, Im SK, Kim YY, Kim CH, Suh PG, Jan YN, Kong YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18043734", "url": "https://glygen.org/publication/PubMed/18043734" } ] }, { "title": "Neuralized-like 1 (Neurl1) targeted to the plasma membrane by N-myristoylation regulates the Notch ligand Jagged1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Koutelou E, Sato S, Tomomori-Sato C, Florens L, Swanson SK, Washburn MP, Kokkinaki M, Conaway RC, Conaway JW, Moschonas NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18077452", "url": "https://glygen.org/publication/PubMed/18077452" } ] }, { "title": "FBW7 ubiquitin ligase: a tumour suppressor at the crossroads of cell division, growth and differentiation.", "journal": "Nature reviews. Cancer", "date": "2008", "authors": "Welcker M, Clurman BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "18094723", "url": "https://glygen.org/publication/PubMed/18094723" } ] }, { "title": "Entry route of HCMV into endothelial cells.", "journal": "Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology", "date": "2008", "authors": "Sinzger C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18203656", "url": "https://glygen.org/publication/PubMed/18203656" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "The human SIRT3 protein deacetylase is exclusively mitochondrial.", "journal": "The Biochemical journal", "date": "2008", "authors": "Cooper HM, Spelbrink JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "18215119", "url": "https://glygen.org/publication/PubMed/18215119" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "Peroxisome proliferator activated receptors and lipoprotein metabolism.", "journal": "PPAR research", "date": "2008", "authors": "Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "18288277", "url": "https://glygen.org/publication/PubMed/18288277" } ] }, { "title": "A natural polymorphism in peroxisome proliferator-activated receptor-alpha hinge region attenuates transcription due to defective release of nuclear receptor corepressor from chromatin.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2008", "authors": "Liu MH, Li J, Shen P, Husna B, Tai ES, Yong EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "18292238", "url": "https://glygen.org/publication/PubMed/18292238" } ] }, { "title": "Localization of the delta-like-1-binding site in human Notch-1 and its modulation by calcium affinity.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cordle J, Redfieldz C, Stacey M, van der Merwe PA, Willis AC, Champion BR, Hambleton S, Handford PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18296446", "url": "https://glygen.org/publication/PubMed/18296446" } ] }, { "title": "Cryptochrome and Period Proteins Are Regulated by the CLOCK/BMAL1 Gene: Crosstalk between the PPARs/RXRalpha-Regulated and CLOCK/BMAL1-Regulated Systems.", "journal": "PPAR research", "date": "2008", "authors": "Nakamura K, Inoue I, Takahashi S, Komoda T, Katayama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "18317514", "url": "https://glygen.org/publication/PubMed/18317514" } ] }, { "title": "PGC-1-related coactivator complexes with HCF-1 and NRF-2beta in mediating NRF-2(GABP)-dependent respiratory gene expression.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Vercauteren K, Gleyzer N, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "18343819", "url": "https://glygen.org/publication/PubMed/18343819" } ] }, { "title": "TBL1 and TBLR1 phosphorylation on regulated gene promoters overcomes dual CtBP and NCoR/SMRT transcriptional repression checkpoints.", "journal": "Molecular cell", "date": "2008", "authors": "Perissi V, Scafoglio C, Zhang J, Ohgi KA, Rose DW, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "18374649", "url": "https://glygen.org/publication/PubMed/18374649" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Tegument proteins of human cytomegalovirus.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2008", "authors": "Kalejta RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18535146", "url": "https://glygen.org/publication/PubMed/18535146" } ] }, { "title": "The aryl hydrocarbon receptor complex and the control of gene expression.", "journal": "Critical reviews in eukaryotic gene expression", "date": "2008", "authors": "Beischlag TV, Luis Morales J, Hollingshead BD, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18540824", "url": "https://glygen.org/publication/PubMed/18540824" } ] }, { "title": "TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.", "journal": "Nature cell biology", "date": "2008", "authors": "Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "18568018", "url": "https://glygen.org/publication/PubMed/18568018" } ] }, { "title": "Prolactin and ErbB4/HER4 signaling interact via Janus kinase 2 to induce mammary epithelial cell gene expression differentiation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2008", "authors": "Muraoka-Cook RS, Sandahl M, Hunter D, Miraglia L, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "18653779", "url": "https://glygen.org/publication/PubMed/18653779" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Substrates and regulation mechanisms for the human mitochondrial sirtuins Sirt3 and Sirt5.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Schlicker C, Gertz M, Papatheodorou P, Kachholz B, Becker CF, Steegborn C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "18680753", "url": "https://glygen.org/publication/PubMed/18680753" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Differential regulation of human ALAS1 mRNA and protein levels by heme and cobalt protoporphyrin.", "journal": "Molecular and cellular biochemistry", "date": "2008", "authors": "Zheng J, Shan Y, Lambrecht RW, Donohue SE, Bonkovsky HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18719978", "url": "https://glygen.org/publication/PubMed/18719978" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Yekta S, Tabin CJ, Bartel DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "18781158", "url": "https://glygen.org/publication/PubMed/18781158" } ] }, { "title": "Direct interaction of nuclear liver X receptor-beta with ABCA1 modulates cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hozoji M, Munehira Y, Ikeda Y, Makishima M, Matsuo M, Kioka N, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "18782758", "url": "https://glygen.org/publication/PubMed/18782758" } ] }, { "title": "Delta-like 4 is indispensable in thymic environment specific for T cell development.", "journal": "The Journal of experimental medicine", "date": "2008", "authors": "Hozumi K, Mailhos C, Negishi N, Hirano K, Yahata T, Ando K, Zuklys S, Hollander GA, Shima DT, Habu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18824583", "url": "https://glygen.org/publication/PubMed/18824583" } ] }, { "title": "Delta-like 4 is the essential, nonredundant ligand for Notch1 during thymic T cell lineage commitment.", "journal": "The Journal of experimental medicine", "date": "2008", "authors": "Koch U, Fiorini E, Benedito R, Besseyrias V, Schuster-Gossler K, Pierres M, Manley NR, Duarte A, Macdonald HR, Radtke F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "18824585", "url": "https://glygen.org/publication/PubMed/18824585" } ] }, { "title": "Regulation of constitutive and inducible AHR signaling: complex interactions involving the AHR repressor.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Hahn ME, Allan LL, Sherr DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18848529", "url": "https://glygen.org/publication/PubMed/18848529" } ] }, { "title": "Identification of a novel distal enhancer in human adiponectin gene.", "journal": "The Journal of endocrinology", "date": "2009", "authors": "Segawa K, Matsuda M, Fukuhara A, Morita K, Okuno Y, Komuro R, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "18931025", "url": "https://glygen.org/publication/PubMed/18931025" } ] }, { "title": "Loss of the Ca2+/calmodulin-dependent protein kinase type IV in dopaminoceptive neurons enhances behavioral effects of cocaine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Bilbao A, Parkitna JR, Engblom D, Perreau-Lenz S, Sanchis-Segura C, Schneider M, Konopka W, Westphal M, Breen G, Desrivieres S, Klugmann M, Guindalini C, Vallada H, Laranjeira R, de Fonseca FR, Schumann G, Schutz G, Spanagel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "19001277", "url": "https://glygen.org/publication/PubMed/19001277" } ] }, { "title": "Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.", "journal": "Nature", "date": "2008", "authors": "Chandra V, Huang P, Hamuro Y, Raghuram S, Wang Y, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19043829", "url": "https://glygen.org/publication/PubMed/19043829" } ] }, { "title": "The E3 ubiquitin ligase WWP1 selectively targets HER4 and its proteolytically derived signaling isoforms for degradation.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Feng SM, Muraoka-Cook RS, Hunter D, Sandahl MA, Caskey LS, Miyazawa K, Atfi A, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "19047365", "url": "https://glygen.org/publication/PubMed/19047365" } ] }, { "title": "Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2008", "authors": "Vock C, Doring F, Nitz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19088433", "url": "https://glygen.org/publication/PubMed/19088433" } ] }, { "title": "A-FABP, a candidate progression marker of human transitional cell carcinoma of the bladder, is differentially regulated by PPAR in urothelial cancer cells.", "journal": "International journal of cancer", "date": "2009", "authors": "Boiteux G, Lascombe I, Roche E, Plissonnier ML, Clairotte A, Bittard H, Fauconnet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19115207", "url": "https://glygen.org/publication/PubMed/19115207" } ] }, { "title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.", "journal": "Journal of cellular biochemistry", "date": "2009", "authors": "Fernandez CC, Gudas LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19115252", "url": "https://glygen.org/publication/PubMed/19115252" } ] }, { "title": "FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.", "journal": "Cell", "date": "2009", "authors": "Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "19135894", "url": "https://glygen.org/publication/PubMed/19135894" } ] }, { "title": "The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer.", "journal": "Nature cell biology", "date": "2009", "authors": "Rustighi A, Tiberi L, Soldano A, Napoli M, Nuciforo P, Rosato A, Kaplan F, Capobianco A, Pece S, Di Fiore PP, Del Sal G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "19151708", "url": "https://glygen.org/publication/PubMed/19151708" } ] }, { "title": "Structural basis for the activation of PPARgamma by oxidized fatty acids.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Itoh T, Fairall L, Amin K, Inaba Y, Szanto A, Balint BL, Nagy L, Yamamoto K, Schwabe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19172745", "url": "https://glygen.org/publication/PubMed/19172745" } ] }, { "title": "Phosphorylation of MeCP2 at Serine 80 regulates its chromatin association and neurological function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Tao J, Hu K, Chang Q, Wu H, Sherman NE, Martinowich K, Klose RJ, Schanen C, Jaenisch R, Wang W, Sun YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "19225110", "url": "https://glygen.org/publication/PubMed/19225110" } ] }, { "title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.", "journal": "BMC molecular biology", "date": "2009", "authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19232136", "url": "https://glygen.org/publication/PubMed/19232136" } ] }, { "title": "L-FABP directly interacts with PPARalpha in cultured primary hepatocytes.", "journal": "Journal of lipid research", "date": "2009", "authors": "Hostetler HA, McIntosh AL, Atshaves BP, Storey SM, Payne HR, Kier AB, Schroeder F", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "19289416", "url": "https://glygen.org/publication/PubMed/19289416" } ] }, { "title": "Interaction between the inner nuclear membrane lamin B receptor and the heterochromatic methyl binding protein, MeCP2.", "journal": "Experimental cell research", "date": "2009", "authors": "Guarda A, Bolognese F, Bonapace IM, Badaracco G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "19331822", "url": "https://glygen.org/publication/PubMed/19331822" } ] }, { "title": "Methylation of 12S rRNA is necessary for in vivo stability of the small subunit of the mammalian mitochondrial ribosome.", "journal": "Cell metabolism", "date": "2009", "authors": "Metodiev MD, Lesko N, Park CB, Camara Y, Shi Y, Wibom R, Hultenby K, Gustafsson CM, Larsson NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "19356719", "url": "https://glygen.org/publication/PubMed/19356719" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Elucidation of separate, but collaborative functions of the rRNA methyltransferase-related human mitochondrial transcription factors B1 and B2 in mitochondrial biogenesis reveals new insight into maternally inherited deafness.", "journal": "Human molecular genetics", "date": "2009", "authors": "Cotney J, McKay SE, Shadel GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "19417006", "url": "https://glygen.org/publication/PubMed/19417006" } ] }, { "title": "GPS2 is required for cholesterol efflux by triggering histone demethylation, LXR recruitment, and coregulator assembly at the ABCG1 locus.", "journal": "Molecular cell", "date": "2009", "authors": "Jakobsson T, Venteclef N, Toresson G, Damdimopoulos AE, Ehrlund A, Lou X, Sanyal S, Steffensen KR, Gustafsson JA, Treuter E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "19481530", "url": "https://glygen.org/publication/PubMed/19481530" } ] }, { "title": "The notch ligands Dll4 and Jagged1 have opposing effects on angiogenesis.", "journal": "Cell", "date": "2009", "authors": "Benedito R, Roca C, Sorensen I, Adams S, Gossler A, Fruttiger M, Adams RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "19524514", "url": "https://glygen.org/publication/PubMed/19524514" } ] }, { "title": "ErbB4 splice variants Cyt1 and Cyt2 differ by 16 amino acids and exert opposing effects on the mammary epithelium in vivo.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Muraoka-Cook RS, Sandahl MA, Strunk KE, Miraglia LC, Husted C, Hunter DM, Elenius K, Chodosh LA, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "19596786", "url": "https://glygen.org/publication/PubMed/19596786" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Chromatin structure regulates human cytomegalovirus gene expression during latency, reactivation and lytic infection.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "19682613", "url": "https://glygen.org/publication/PubMed/19682613" } ] }, { "title": "Limited role for the bilirubin-biliverdin redox amplification cycle in the cellular antioxidant protection by biliverdin reductase.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Maghzal GJ, Leck MC, Collinson E, Li C, Stocker R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "19690164", "url": "https://glygen.org/publication/PubMed/19690164" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Negative feedback maintenance of heme homeostasis by its receptor, Rev-erbalpha.", "journal": "Genes & development", "date": "2009", "authors": "Wu N, Yin L, Hanniman EA, Joshi S, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "19710360", "url": "https://glygen.org/publication/PubMed/19710360" } ] }, { "title": "Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.", "journal": "PloS one", "date": "2009", "authors": "Rakhshandehroo M, Hooiveld G, Muller M, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19710929", "url": "https://glygen.org/publication/PubMed/19710929" } ] }, { "title": "Metalloprotease ADAM10 is required for Notch1 site 2 cleavage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "van Tetering G, van Diest P, Verlaan I, van der Wall E, Kopan R, Vooijs M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "19726682", "url": "https://glygen.org/publication/PubMed/19726682" } ] }, { "title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.", "journal": "Gastroenterology", "date": "2009", "authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19747919", "url": "https://glygen.org/publication/PubMed/19747919" } ] }, { "title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.", "journal": "Nature", "date": "1990", "authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1975088", "url": "https://glygen.org/publication/PubMed/1975088" } ] }, { "title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.", "journal": "Molecular cell", "date": "2009", "authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19782034", "url": "https://glygen.org/publication/PubMed/19782034" } ] }, { "title": "CKIepsilon/delta-dependent phosphorylation is a temperature-insensitive, period-determining process in the mammalian circadian clock.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Isojima Y, Nakajima M, Ukai H, Fujishima H, Yamada RG, Masumoto KH, Kiuchi R, Ishida M, Ukai-Tadenuma M, Minami Y, Kito R, Nakao K, Kishimoto W, Yoo SH, Shimomura K, Takao T, Takano A, Kojima T, Nagai K, Sakaki Y, Takahashi JS, Ueda HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "19805222", "url": "https://glygen.org/publication/PubMed/19805222" } ] }, { "title": "Methyl-CpG-binding protein 2 is phosphorylated by homeodomain-interacting protein kinase 2 and contributes to apoptosis.", "journal": "EMBO reports", "date": "2009", "authors": "Bracaglia G, Conca B, Bergo A, Rusconi L, Zhou Z, Greenberg ME, Landsberger N, Soddu S, Kilstrup-Nielsen C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "19820693", "url": "https://glygen.org/publication/PubMed/19820693" } ] }, { "title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.", "journal": "Molecular cell", "date": "2009", "authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19854132", "url": "https://glygen.org/publication/PubMed/19854132" } ] }, { "title": "Ubiquitin ligase Nedd4L targets activated Smad2/3 to limit TGF-beta signaling.", "journal": "Molecular cell", "date": "2009", "authors": "Gao S, Alarcon C, Sapkota G, Rahman S, Chen PY, Goerner N, Macias MJ, Erdjument-Bromage H, Tempst P, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "19917253", "url": "https://glygen.org/publication/PubMed/19917253" } ] }, { "title": "Activating peroxisome proliferator-activated receptor gamma mutant promotes tumor growth in vivo by enhancing angiogenesis.", "journal": "Cancer research", "date": "2009", "authors": "Tian L, Zhou J, Casimiro MC, Liang B, Ojeifo JO, Wang M, Hyslop T, Wang C, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19934321", "url": "https://glygen.org/publication/PubMed/19934321" } ] }, { "title": "Nuclear respiratory factor 2 induces the expression of many but not all human proteins acting in mitochondrial DNA transcription and replication.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Bruni F, Polosa PL, Gadaleta MN, Cantatore P, Roberti M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "19951946", "url": "https://glygen.org/publication/PubMed/19951946" } ] }, { "title": "Biopreservation of red blood cells--the struggle with hemoglobin oxidation.", "journal": "The FEBS journal", "date": "2010", "authors": "Kanias T, Acker JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "19968714", "url": "https://glygen.org/publication/PubMed/19968714" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "database": "GlyConnect", "id": "2903", "url": "https://glyconnect.expasy.org/browser/proteins/2903" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.", "journal": "FEBS letters", "date": "2010", "authors": "Yates JA, Menon T, Thompson BA, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "20085832", "url": "https://glygen.org/publication/PubMed/20085832" } ] }, { "title": "Human fetal mesenchymal stem cells differentiate into brown and white adipocytes: a role for ERRalpha in human UCP1 expression.", "journal": "Cell research", "date": "2010", "authors": "Morganstein DL, Wu P, Mane MR, Fisk NM, White R, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "20101261", "url": "https://glygen.org/publication/PubMed/20101261" } ] }, { "title": "Profiling of promoter occupancy by PPARalpha in human hepatoma cells via ChIP-chip analysis.", "journal": "Nucleic acids research", "date": "2010", "authors": "van der Meer DL, Degenhardt T, Vaisanen S, de Groot PJ, Heinaniemi M, de Vries SC, Muller M, Carlberg C, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "20110263", "url": "https://glygen.org/publication/PubMed/20110263" } ] }, { "title": "MicroRNA-33 and the SREBP host genes cooperate to control cholesterol homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Najafi-Shoushtari SH, Kristo F, Li Y, Shioda T, Cohen DE, Gerszten RE, Naar AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20466882", "url": "https://glygen.org/publication/PubMed/20466882" } ] }, { "title": "MiR-33 contributes to the regulation of cholesterol homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Rayner KJ, Suarez Y, Davalos A, Parathath S, Fitzgerald ML, Tamehiro N, Fisher EA, Moore KJ, Fernandez-Hernando C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20466885", "url": "https://glygen.org/publication/PubMed/20466885" } ] }, { "title": "LXRalpha regulates human CETP expression in vitro and in transgenic mice.", "journal": "Atherosclerosis", "date": "2010", "authors": "Honzumi S, Shima A, Hiroshima A, Koieyama T, Ubukata N, Terasaka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20494359", "url": "https://glygen.org/publication/PubMed/20494359" } ] }, { "title": "A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor.", "journal": "Nat. Struct. Mol. Biol.", "date": "2010", "authors": "le Maire A, Teyssier C, Erb C, Grimaldi M, Alvarez S, de Lera AR, Balaguer P, Gronemeyer H, Royer CA, Germain P, Bourguet W", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "20543827", "url": "https://glygen.org/publication/PubMed/20543827" } ] }, { "title": "miR-33 links SREBP-2 induction to repression of sterol transporters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Marquart TJ, Allen RM, Ory DS, Baldan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20566875", "url": "https://glygen.org/publication/PubMed/20566875" } ] }, { "title": "Structure of Rev-erbalpha bound to N-CoR reveals a unique mechanism of nuclear receptor-co-repressor interaction.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Phelan CA, Gampe RT Jr, Lambert MH, Parks DJ, Montana V, Bynum J, Broderick TM, Hu X, Williams SP, Nolte RT, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "20581824", "url": "https://glygen.org/publication/PubMed/20581824" } ] }, { "title": "FBI-1 functions as a novel AR co-repressor in prostate cancer cells.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Cui J, Yang Y, Zhang C, Hu P, Kan W, Bai X, Liu X, Song H", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "20812024", "url": "https://glygen.org/publication/PubMed/20812024" } ] }, { "title": "Characterization of the core mammalian clock component, NPAS2, as a REV-ERBalpha/RORalpha target gene.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Crumbley C, Wang Y, Kojetin DJ, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "20817722", "url": "https://glygen.org/publication/PubMed/20817722" } ] }, { "title": "MicroRNA-33 encoded by an intron of sterol regulatory element-binding protein 2 (Srebp2) regulates HDL in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Horie T, Ono K, Horiguchi M, Nishi H, Nakamura T, Nagao K, Kinoshita M, Kuwabara Y, Marusawa H, Iwanaga Y, Hasegawa K, Yokode M, Kimura T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20855588", "url": "https://glygen.org/publication/PubMed/20855588" } ] }, { "title": "Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ikeda O, Sekine Y, Mizushima A, Nakasuji M, Miyasaka Y, Yamamoto C, Muromoto R, Nanbo A, Oritani K, Yoshimura A, Matsuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "20929863", "url": "https://glygen.org/publication/PubMed/20929863" } ] }, { "title": "Structural and mechanistic insights into cooperative assembly of dimeric Notch transcription complexes.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Arnett KL, Hass M, McArthur DG, Ilagan MX, Aster JC, Kopan R, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "20972443", "url": "https://glygen.org/publication/PubMed/20972443" } ] }, { "title": "PARP-1 attenuates Smad-mediated transcription.", "journal": "Molecular cell", "date": "2010", "authors": "Lonn P, van der Heide LP, Dahl M, Hellman U, Heldin CH, Moustakas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "21095583", "url": "https://glygen.org/publication/PubMed/21095583" } ] }, { "title": "Constitutive activation of LXR in macrophages regulates metabolic and inflammatory gene expression: identification of ARL7 as a direct target.", "journal": "Journal of lipid research", "date": "2011", "authors": "Hong C, Walczak R, Dhamko H, Bradley MN, Marathe C, Boyadjian R, Salazar JV, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21187453", "url": "https://glygen.org/publication/PubMed/21187453" } ] }, { "title": "MicroRNA hsa-miR-613 targets the human LXRalpha gene and mediates a feedback loop of LXRalpha autoregulation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Ou Z, Wada T, Gramignoli R, Li S, Strom SC, Huang M, Xie W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21310851", "url": "https://glygen.org/publication/PubMed/21310851" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Direct regulation of CLOCK expression by REV-ERB.", "journal": "PloS one", "date": "2011", "authors": "Crumbley C, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "21479263", "url": "https://glygen.org/publication/PubMed/21479263" } ] }, { "title": "Liver X receptor beta (LXRbeta) interacts directly with ATP-binding cassette A1 (ABCA1) to promote high density lipoprotein formation during acute cholesterol accumulation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Hozoji-Inada M, Munehira Y, Nagao K, Kioka N, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21507939", "url": "https://glygen.org/publication/PubMed/21507939" } ] }, { "title": "Romidepsin (Istodax, NSC 630176, FR901228, FK228, depsipeptide): a natural product recently approved for cutaneous T-cell lymphoma.", "journal": "The Journal of antibiotics", "date": "2011", "authors": "VanderMolen KM, McCulloch W, Pearce CJ, Oberlies NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "21587264", "url": "https://glygen.org/publication/PubMed/21587264" } ] }, { "title": "Modulation of clock gene expression by the transcriptional coregulator receptor interacting protein 140 (RIP140).", "journal": "Journal of biological rhythms", "date": "2011", "authors": "Poliandri AH, Gamsby JJ, Christian M, Spinella MJ, Loros JJ, Dunlap JC, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "21628546", "url": "https://glygen.org/publication/PubMed/21628546" } ] }, { "title": "Heparan sulfate proteoglycans.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Sarrazin S, Lamanna WC, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "21690215", "url": "https://glygen.org/publication/PubMed/21690215" } ] }, { "title": "Discovery of gemfibrozil analogues that activate PPARalpha and enhance the expression of gene CPT1A involved in fatty acids catabolism.", "journal": "European journal of medicinal chemistry", "date": "2011", "authors": "De Filippis B, Giancristofaro A, Ammazzalorso A, D'Angelo A, Fantacuzzi M, Giampietro L, Maccallini C, Petruzzelli M, Amoroso R", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "21889235", "url": "https://glygen.org/publication/PubMed/21889235" } ] }, { "title": "Ablation of Smurf2 reveals an inhibition in TGF-beta signalling through multiple mono-ubiquitination of Smad3.", "journal": "The EMBO journal", "date": "2011", "authors": "Tang LY, Yamashita M, Coussens NP, Tang Y, Wang X, Li C, Deng CX, Cheng SY, Zhang YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "22045334", "url": "https://glygen.org/publication/PubMed/22045334" } ] }, { "title": "The human cytomegalovirus UL11 protein interacts with the receptor tyrosine phosphatase CD45, resulting in functional paralysis of T cells.", "journal": "PLoS pathogens", "date": "2011", "authors": "Gabaev I, Steinbruck L, Pokoyski C, Pich A, Stanton RJ, Schwinzer R, Schulz TF, Jacobs R, Messerle M, Kay-Fedorov PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "22174689", "url": "https://glygen.org/publication/PubMed/22174689" } ] }, { "title": "Anti-inflammatory and PPAR transactivational effects of secondary metabolites from the roots of Asarum sieboldii.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2012", "authors": "Quang TH, Ngan NT, Minh CV, Kiem PV, Tai BH, Thao NP, Song SB, Kim YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "22381047", "url": "https://glygen.org/publication/PubMed/22381047" } ] }, { "title": "Carbon monoxide promotes respiratory hemoproteins iron reduction using peroxides as electron donors.", "journal": "PloS one", "date": "2012", "authors": "Sher EA, Shaklai M, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "22427940", "url": "https://glygen.org/publication/PubMed/22427940" } ] }, { "title": "Liver X receptor biology and pharmacology: new pathways, challenges and opportunities.", "journal": "Trends in pharmacological sciences", "date": "2012", "authors": "Jakobsson T, Treuter E, Gustafsson JA, Steffensen KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9623433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9623433" } ], "reference": [ { "type": "PubMed", "id": "22541735", "url": "https://glygen.org/publication/PubMed/22541735" } ] }, { "title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.", "journal": "Nature communications", "date": "2012", "authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22569366", "url": "https://glygen.org/publication/PubMed/22569366" } ] }, { "title": "MiR-26 controls LXR-dependent cholesterol efflux by targeting ABCA1 and ARL7.", "journal": "FEBS letters", "date": "2012", "authors": "Sun D, Zhang J, Xie J, Wei W, Chen M, Zhao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "22673513", "url": "https://glygen.org/publication/PubMed/22673513" } ] }, { "title": "Nuclear hormone receptor corepressor promotes esophageal cancer cell invasion by transcriptional repression of interferon-gamma-inducible protein 10 in a casein kinase 2-dependent manner.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Yoo JY, Choi HK, Choi KC, Park SY, Ota I, Yook JI, Lee YH, Kim K, Yoon HG", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "22675025", "url": "https://glygen.org/publication/PubMed/22675025" } ] }, { "title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Li Q, Zhu F, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22705304", "url": "https://glygen.org/publication/PubMed/22705304" } ] }, { "title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.", "journal": "PloS one", "date": "2012", "authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22879880", "url": "https://glygen.org/publication/PubMed/22879880" } ] }, { "title": "Protein kinase A phosphorylates NCoR to enhance its nuclear translocation and repressive function in human prostate cancer cells.", "journal": "Journal of cellular physiology", "date": "2013", "authors": "Choi HK, Yoo JY, Jeong MH, Park SY, Shin DM, Jang SW, Yoon HG, Choi KC", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "23129261", "url": "https://glygen.org/publication/PubMed/23129261" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.", "journal": "Cancer letters", "date": "2013", "authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23219899", "url": "https://glygen.org/publication/PubMed/23219899" } ] }, { "title": "Nuclear ErbB4 signaling through H3K9me3 is antagonized by EGFR-activated c-Src.", "journal": "Journal of cell science", "date": "2013", "authors": "Ishibashi K, Fukumoto Y, Hasegawa H, Abe K, Kubota S, Aoyama K, Kubota S, Nakayama Y, Yamaguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "23230144", "url": "https://glygen.org/publication/PubMed/23230144" } ] }, { "title": "A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPARgamma and C/EBPalpha.", "journal": "Journal of bioenergetics and biomembranes", "date": "2013", "authors": "Ni Y, Ji C, Wang B, Qiu J, Wang J, Guo X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "23239344", "url": "https://glygen.org/publication/PubMed/23239344" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Structural and functional analysis of the DEAF-1 and BS69 MYND domains.", "journal": "PLoS ONE", "date": "2013", "authors": "Kateb F, Perrin H, Tripsianes K, Zou P, Spadaccini R, Bottomley M, Franzmann TM, Buchner J, Ansieau S, Sattler M", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "23372760", "url": "https://glygen.org/publication/PubMed/23372760" } ] }, { "title": "MicroRNA-613 represses lipogenesis in HepG2 cells by downregulating LXRalpha.", "journal": "Lipids in health and disease", "date": "2013", "authors": "Zhong D, Zhang Y, Zeng YJ, Gao M, Wu GZ, Hu CJ, Huang G, He FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23496987", "url": "https://glygen.org/publication/PubMed/23496987" } ] }, { "title": "MicroRNA-144 regulates hepatic ATP binding cassette transporter A1 and plasma high-density lipoprotein after activation of the nuclear receptor farnesoid X receptor.", "journal": "Circulation research", "date": "2013", "authors": "de Aguiar Vallim TQ, Tarling EJ, Kim T, Civelek M, Baldan A, Esau C, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23519696", "url": "https://glygen.org/publication/PubMed/23519696" } ] }, { "title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2013", "authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23534758", "url": "https://glygen.org/publication/PubMed/23534758" } ] }, { "title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23630040", "url": "https://glygen.org/publication/PubMed/23630040" } ] }, { "title": "CK2-NCoR signaling cascade promotes prostate tumorigenesis.", "journal": "Oncotarget", "date": "2013", "authors": "Yoo JY, Lim BJ, Choi HK, Hong SW, Jang HS, Kim C, Chun KH, Choi KC, Yoon HG", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "23669876", "url": "https://glygen.org/publication/PubMed/23669876" } ] }, { "title": "Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor.", "journal": "Nature neuroscience", "date": "2013", "authors": "Lyst MJ, Ekiert R, Ebert DH, Merusi C, Nowak J, Selfridge J, Guy J, Kastan NR, Robinson ND, de Lima Alves F, Rappsilber J, Greenberg ME, Bird A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "23770565", "url": "https://glygen.org/publication/PubMed/23770565" } ] }, { "title": "Activity-dependent phosphorylation of MeCP2 threonine 308 regulates interaction with NCoR.", "journal": "Nature", "date": "2013", "authors": "Ebert DH, Gabel HW, Robinson ND, Kastan NR, Hu LS, Cohen S, Navarro AJ, Lyst MJ, Ekiert R, Bird AP, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "23770587", "url": "https://glygen.org/publication/PubMed/23770587" } ] }, { "title": "Cooperative transcriptional activation of ATP-binding cassette sterol transporters ABCG5 and ABCG8 genes by nuclear receptors including Liver-X-Receptor.", "journal": "BMB reports", "date": "2013", "authors": "Back SS, Kim J, Choi D, Lee ES, Choi SY, Han K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23790976", "url": "https://glygen.org/publication/PubMed/23790976" } ] }, { "title": "A hybrid mechanism of action for BCL6 in B cells defined by formation of functionally distinct complexes at enhancers and promoters.", "journal": "Cell Rep.", "date": "2013", "authors": "Hatzi K, Jiang Y, Huang C, Garrett-Bakelman F, Gearhart MD, Giannopoulou EG, Zumbo P, Kirouac K, Bhaskara S, Polo JM, Kormaksson M, MacKerell AD Jr, Xue F, Mason CE, Hiebert SW, Prive GG, Cerchietti L, Bardwell VJ, Elemento O, Melnick A", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "23911289", "url": "https://glygen.org/publication/PubMed/23911289" } ] }, { "title": "Akt-induced phosphorylation of N-CoR at serine 1450 contributes to its misfolded conformational dependent loss (MCDL) in acute myeloid leukemia of the M5 subtype.", "journal": "PloS one", "date": "2013", "authors": "Nin DS, Ali AB, Okumura K, Asou N, Chen CS, Chng WJ, Khan M", "evidence": [ { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "23940660", "url": "https://glygen.org/publication/PubMed/23940660" } ] }, { "title": "Hox in motion: tracking HoxA cluster conformation during differentiation.", "journal": "Nucleic acids research", "date": "2014", "authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24174538", "url": "https://glygen.org/publication/PubMed/24174538" } ] }, { "title": "Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Matsumura R, Matsubara C, Node K, Takumi T, Akashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "24196956", "url": "https://glygen.org/publication/PubMed/24196956" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "iPTMnet", "id": "O75376", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75376" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Molecular origin of the binding of WWOX tumor suppressor to ErbB4 receptor tyrosine kinase.", "journal": "Biochemistry", "date": "2013", "authors": "Schuchardt BJ, Bhat V, Mikles DC, McDonald CB, Sudol M, Farooq A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "24308844", "url": "https://glygen.org/publication/PubMed/24308844" } ] }, { "title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.", "journal": "PloS one", "date": "2013", "authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24312487", "url": "https://glygen.org/publication/PubMed/24312487" } ] }, { "title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.", "journal": "PLoS genetics", "date": "2014", "authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24586203", "url": "https://glygen.org/publication/PubMed/24586203" } ] }, { "title": "Convergent and divergent cellular responses by ErbB4 isoforms in mammary epithelial cells.", "journal": "Molecular cancer research : MCR", "date": "2014", "authors": "Wali VB, Haskins JW, Gilmore-Hebert M, Platt JT, Liu Z, Stern DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "24829397", "url": "https://glygen.org/publication/PubMed/24829397" } ] }, { "title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.", "journal": "PLoS genetics", "date": "2014", "authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25101834", "url": "https://glygen.org/publication/PubMed/25101834" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25135475", "url": "https://glygen.org/publication/PubMed/25135475" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "Two erbA homologs encoding proteins with different T3 binding capacities are transcribed from opposite DNA strands of the same genetic locus.", "journal": "Cell", "date": "1989", "authors": "Miyajima N, Horiuchi R, Shibuya Y, Fukushige S, Matsubara K, Toyoshima K, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "2539258", "url": "https://glygen.org/publication/PubMed/2539258" } ] }, { "title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.", "journal": "Differentiation; research in biological diversity", "date": "1989", "authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "2570724", "url": "https://glygen.org/publication/PubMed/2570724" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.", "journal": "FEBS letters", "date": "2015", "authors": "Lonfat N, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25913784", "url": "https://glygen.org/publication/PubMed/25913784" } ] }, { "title": "Belinostat in Patients With Relapsed or Refractory Peripheral T-Cell Lymphoma: Results of the Pivotal Phase II BELIEF (CLN-19) Study.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2015", "authors": "O'Connor OA, Horwitz S, Masszi T, Van Hoof A, Brown P, Doorduijn J, Hess G, Jurczak W, Knoblauch P, Chawla S, Bhat G, Choi MR, Walewski J, Savage K, Foss F, Allen LF, Shustov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "26101246", "url": "https://glygen.org/publication/PubMed/26101246" } ] }, { "title": "MeCP2 controls hippocampal brain-derived neurotrophic factor expression via homeostatic interactions with microRNA132 in rats with depression.", "journal": "Molecular medicine reports", "date": "2015", "authors": "Su M, Hong J, Zhao Y, Liu S, Xue X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "26239616", "url": "https://glygen.org/publication/PubMed/26239616" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "Cytomegalovirus latency and reactivation: recent insights into an age old problem.", "journal": "Reviews in medical virology", "date": "2016", "authors": "Dupont L, Reeves MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "26572645", "url": "https://glygen.org/publication/PubMed/26572645" } ] }, { "title": "Serum CETP status is independently associated with reduction rates in LDL-C in pitavastatin-treated diabetic patients and possible involvement of LXR in its association.", "journal": "Lipids in health and disease", "date": "2016", "authors": "Shimada A, Kimura H, Oida K, Kanehara H, Bando Y, Sakamoto S, Wakasugi T, Saga T, Ito Y, Kamiyama K, Mikami D, Iwano M, Hirano T, Yoshida H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "26984517", "url": "https://glygen.org/publication/PubMed/26984517" } ] }, { "title": "Bilirubin Binding to PPARalpha Inhibits Lipid Accumulation.", "journal": "PloS one", "date": "2016", "authors": "Stec DE, John K, Trabbic CJ, Luniwal A, Hankins MW, Baum J, Hinds TD Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "27071062", "url": "https://glygen.org/publication/PubMed/27071062" } ] }, { "title": "The biochemical pharmacology of fenofibrate.", "journal": "Cardiology", "date": "1989", "authors": "Caldwell J", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "2713875", "url": "https://glygen.org/publication/PubMed/2713875" } ] }, { "title": "The role of specific Smad linker region phosphorylation in TGF-beta mediated expression of glycosaminoglycan synthesizing enzymes in vascular smooth muscle.", "journal": "Cellular signalling", "date": "2016", "authors": "Rostam MA, Kamato D, Piva TJ, Zheng W, Little PJ, Osman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "27153775", "url": "https://glygen.org/publication/PubMed/27153775" } ] }, { "title": "Human Cytomegalovirus Latency: Approaching the Gordian Knot.", "journal": "Annual review of virology", "date": "2016", "authors": "Goodrum F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "27501258", "url": "https://glygen.org/publication/PubMed/27501258" } ] }, { "title": "Global Analysis of O-GlcNAc Glycoproteins in Activated Human T Cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Lund PJ, Elias JE, Davis MM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "27655845", "url": "https://glygen.org/publication/PubMed/27655845" } ] }, { "title": "Identification of a novel putative interaction partner of the nucleoporin ALADIN.", "journal": "Biology open", "date": "2016", "authors": "Juhlen R, Landgraf D, Huebner A, Koehler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "27754849", "url": "https://glygen.org/publication/PubMed/27754849" } ] }, { "title": "EEPD1 Is a Novel LXR Target Gene in Macrophages Which Regulates ABCA1 Abundance and Cholesterol Efflux.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2017", "authors": "Nelson JK, Koenis DS, Scheij S, Cook EC, Moeton M, Santos A, Lobaccaro JA, Baron S, Zelcer N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28082258", "url": "https://glygen.org/publication/PubMed/28082258" } ] }, { "title": "Ligand and Target Discovery by Fragment-Based Screening in Human Cells.", "journal": "Cell", "date": "2017", "authors": "Parker CG, Galmozzi A, Wang Y, Correia BE, Sasaki K, Joslyn CM, Kim AS, Cavallaro CL, Lawrence RM, Johnson SR, Narvaiza I, Saez E, Cravatt BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "28111073", "url": "https://glygen.org/publication/PubMed/28111073" } ] }, { "title": "Viral gene products actively promote latent infection by epigenetic silencing mechanisms.", "journal": "Current opinion in virology", "date": "2017", "authors": "Knipe DM, Raja P, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "28415052", "url": "https://glygen.org/publication/PubMed/28415052" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Crystal structure of CO-bound cytochrome c oxidase determined by serial femtosecond X-ray crystallography at room temperature.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Ishigami I, Zatsepin NA, Hikita M, Conrad CE, Nelson G, Coe JD, Basu S, Grant TD, Seaberg MH, Sierra RG, Hunter MS, Fromme P, Fromme R, Yeh SR, Rousseau DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "28698372", "url": "https://glygen.org/publication/PubMed/28698372" } ] }, { "title": "Functional analyses of a novel missense and other mutations of the vitamin D receptor in association with alopecia.", "journal": "Sci. Rep.", "date": "2017", "authors": "Tamura M, Ishizawa M, Isojima T, Ozen S, Oka A, Makishima M, Kitanaka S", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "28698609", "url": "https://glygen.org/publication/PubMed/28698609" } ] }, { "title": "Activation of liver X receptor suppresses angiogenesis via induction of ApoD.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2017", "authors": "Lai CJ, Cheng HC, Lin CY, Huang SH, Chen TH, Chung CJ, Chang CH, Wang HD, Chuu CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28842423", "url": "https://glygen.org/publication/PubMed/28842423" } ] }, { "title": "Critical Role of the Human ATP-Binding Cassette G1 Transporter in Cardiometabolic Diseases.", "journal": "International journal of molecular sciences", "date": "2017", "authors": "Hardy LM, Frisdal E, Le Goff W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28869506", "url": "https://glygen.org/publication/PubMed/28869506" } ] }, { "title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2018", "authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "29237092", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Thrombin promotes PAI-1 expression and migration in keratinocytes via ERK dependent Smad linker region phosphorylation.", "journal": "Cellular signalling", "date": "2018", "authors": "Talati N, Kamato D, Piva TJ, Little PJ, Osman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173795", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795" } ], "reference": [ { "type": "PubMed", "id": "29577978", "url": "https://glygen.org/publication/PubMed/29577978" } ] }, { "title": "Epigenetic regulation of genes involved in the reverse cholesterol transport through interaction with miRNAs.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2018", "authors": "Zaiou M, Rihn BH, Bakillah A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "29772548", "url": "https://glygen.org/publication/PubMed/29772548" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "HCMV miRNA Targets Reveal Important Cellular Pathways for Viral Replication, Latency, and Reactivation.", "journal": "Non-coding RNA", "date": "2018", "authors": "Diggins NL, Hancock MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30360396", "url": "https://glygen.org/publication/PubMed/30360396" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "HCMV latency: what regulates the regulators?", "journal": "Medical microbiology and immunology", "date": "2019", "authors": "Elder E, Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30761409", "url": "https://glygen.org/publication/PubMed/30761409" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "Global profiling of O-GlcNAcylated and/or phosphorylated proteins in hepatoblastoma.", "journal": "Signal transduction and targeted therapy", "date": "2019", "authors": "Song H, Ma J, Bian Z, Chen S, Zhu J, Wang J, Huang N, Yin M, Sun F, Xu M, Pan Q", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "31637018", "url": "https://glygen.org/publication/PubMed/31637018" } ] }, { "title": "PGRMC2 is an intracellular haem chaperone critical for adipocyte function.", "journal": "Nature", "date": "2019", "authors": "Galmozzi A, Kok BP, Kim AS, Montenegro-Burke JR, Lee JY, Spreafico R, Mosure S, Albert V, Cintron-Colon R, Godio C, Webb WR, Conti B, Solt LA, Kojetin D, Parker CG, Peluso JJ, Pru JK, Siuzdak G, Cravatt BF, Saez E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "31748741", "url": "https://glygen.org/publication/PubMed/31748741" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Heme induces human and mouse platelet activation through C-type-lectin-like receptor-2.", "journal": "Haematologica", "date": "2021", "authors": "Bourne JH, Colicchia M, Di Y, Martin E, Slater A, Roumenina LT, Dimitrov JD, Watson SP, Rayes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32354867", "url": "https://glygen.org/publication/PubMed/32354867" } ] }, { "title": "A Chemoenzymatic Method Based on Easily Accessible Enzymes for Profiling Protein O-GlcNAcylation.", "journal": "Analytical chemistry", "date": "2020", "authors": "Xu S, Sun F, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "32574038", "url": "https://glygen.org/publication/PubMed/32574038" } ] }, { "title": "Identification of a Heme Activation Site on the MD-2/TLR4 Complex.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Belcher JD, Zhang P, Nguyen J, Kiser ZM, Nath KA, Hu J, Trent JO, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32695117", "url": "https://glygen.org/publication/PubMed/32695117" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Human heme oxygenase cDNA and induction of its mRNA by hemin.", "journal": "European journal of biochemistry", "date": "1988", "authors": "Yoshida T, Biro P, Cohen T, Muller RM, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "3345742", "url": "https://glygen.org/publication/PubMed/3345742" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Carbon monoxide binding to human hemoglobin A0.", "journal": "Biochemistry", "date": "1987", "authors": "Di Cera E, Doyle ML, Connelly PR, Gill SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "3427020", "url": "https://glygen.org/publication/PubMed/3427020" } ] }, { "title": "Antioxidant activity of albumin-bound bilirubin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Stocker R, Glazer AN, Ames BN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "3475708", "url": "https://glygen.org/publication/PubMed/3475708" } ] }, { "title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.", "journal": "Analytical chemistry", "date": "2021", "authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" }, { "database": "O-GlcNAc Atlas", "id": "O75376", "url": "https://oglcnac.org/atlas/detail/O75376" } ], "reference": [ { "type": "PubMed", "id": "34846842", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "NCoR1 controls immune tolerance in conventional dendritic cells by fine-tuning glycolysis and fatty acid oxidation.", "journal": "Redox biology", "date": "2022-12-16", "authors": "Sen Kaushik, Pati Rashmirekha, Jha Atimukta, Mishra Gyan Prakash, Prusty Subhasish, Chaudhary Shweta, Swetalika Swati, Podder Sreeparna, Sen Aishwarya, Swain Mamuni, Nanda Ranjan Kumar, Raghav Sunil K", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" } ], "reference": [ { "type": "PubMed", "id": "36565644", "url": "https://glygen.org/publication/PubMed/36565644" } ] }, { "title": "`Two Birds One Stone` Strategy for the Site-Specific Analysis of Core Fucosylation and O-GlcNAcylation.", "journal": "Journal of the American Chemical Society", "date": "2023-07-26", "authors": "Luo Yawen, Wang Yuqiu, Tian Yinping, Zhou Hu, Wen Liuqing", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75376", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75376" } ], "reference": [ { "type": "PubMed", "id": "37340703", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "title": "NCoR1 controls Mycobacterium tuberculosis growth in myeloid cells by regulating the AMPK-mTOR-TFEB axis.", "journal": "PLoS biology", "date": "2023-08", "authors": "Biswas Viplov Kumar, Sen Kaushik, Ahad Abdul, Ghosh Arup, Verma Surbhi, Pati Rashmirekha, Prusty Subhasish, Nayak Sourya Prakash, Podder Sreeparna, Kumar Dhiraj, Gupta Bhawna, Raghav Sunil Kumar", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" } ], "reference": [ { "type": "PubMed", "id": "37590294", "url": "https://glygen.org/publication/PubMed/37590294" } ] }, { "title": "Pulling rank with RNA: RANKL promotes the association of PGC-1\u03b2/RNA complexes with NCoR/HDAC3 to activate gene expression in osteoclasts.", "journal": "Molecular cell", "date": "2023-10-05", "authors": "Torres Haydee M, Yeo Dongwook, Westendorf Jennifer J", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" } ], "reference": [ { "type": "PubMed", "id": "37802020", "url": "https://glygen.org/publication/PubMed/37802020" } ] }, { "title": "Exploring TBL1XR1 and NCOR1 Expression in B-cell Lymphoma Subtypes: Interaction With DNA Damage Repair Genes.", "journal": "Anticancer research", "date": "2023-11", "authors": "Mansoor Adnan, Akhter Ariz, Hamidi Mahboobsadat, Roshan Tariq Mahmood, Shabani-Rad Meer-Taher, Stewart Douglas", "evidence": [ { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" } ], "reference": [ { "type": "PubMed", "id": "37909960", "url": "https://glygen.org/publication/PubMed/37909960" } ] }, { "title": "Hemoglobin. A biologic fenton reagent.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Sadrzadeh SM, Graf E, Panter SS, Hallaway PE, Eaton JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564" } ], "reference": [ { "type": "PubMed", "id": "6094553", "url": "https://glygen.org/publication/PubMed/6094553" } ] }, { "title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7488013", "url": "https://glygen.org/publication/PubMed/7488013" } ] }, { "title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "1996", "authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7501971", "url": "https://glygen.org/publication/PubMed/7501971" } ] }, { "title": "FR901228, a novel antitumor bicyclic depsipeptide produced by Chromobacterium violaceum No. 968. I. Taxonomy, fermentation, isolation, physico-chemical and biological properties, and antitumor activity.", "journal": "The Journal of antibiotics", "date": "1994", "authors": "Ueda H, Nakajima H, Hori Y, Fujita T, Nishimura M, Goto T, Okuhara M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "7513682", "url": "https://glygen.org/publication/PubMed/7513682" } ] }, { "title": "Signalling downstream of activated mammalian Notch.", "journal": "Nature", "date": "1995", "authors": "Jarriault S, Brou C, Logeat F, Schroeter EH, Kopan R, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "7566092", "url": "https://glygen.org/publication/PubMed/7566092" } ] }, { "title": "Disruption of the mouse RBP-J kappa gene results in early embryonic death.", "journal": "Development (Cambridge, England)", "date": "1995", "authors": "Oka C, Nakano T, Wakeham A, de la Pompa JL, Mori C, Sakai T, Okazaki S, Kawaichi M, Shiota K, Mak TW, Honjo T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "7588063", "url": "https://glygen.org/publication/PubMed/7588063" } ] }, { "title": "Structure, expression, and chromosomal assignment of the human gene encoding nuclear respiratory factor 1.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gopalakrishnan L, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "7629110", "url": "https://glygen.org/publication/PubMed/7629110" } ] }, { "title": "Transcriptional regulation by lovastatin and 25-hydroxycholesterol in HepG2 cells and molecular cloning and expression of the cDNA for the human hepatic squalene synthase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Jiang G, McKenzie TL, Conrad DG, Shechter I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7685352", "url": "https://glygen.org/publication/PubMed/7685352" } ] }, { "title": "Four structurally distinct, non-DNA-binding subunits of human nuclear respiratory factor 2 share a conserved transcriptional activation domain.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Gugneja S, Virbasius JV, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "7799916", "url": "https://glygen.org/publication/PubMed/7799916" } ] }, { "title": "A retinoic acid-triggered cascade of HOXB1 gene activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ogura T, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7831296", "url": "https://glygen.org/publication/PubMed/7831296" } ] }, { "title": "Human liver mitochondrial carnitine palmitoyltransferase I: characterization of its cDNA and chromosomal localization and partial analysis of the gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Britton CH, Schultz RA, Zhang B, Esser V, Foster DW, McGarry JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7892212", "url": "https://glygen.org/publication/PubMed/7892212" } ] }, { "title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.", "journal": "Blood", "date": "1994", "authors": "Sengupta PK, Lavelle DE, DeSimone J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7906964", "url": "https://glygen.org/publication/PubMed/7906964" } ] }, { "title": "Regulation of the human HOXD4 gene by retinoids.", "journal": "Mechanisms of development", "date": "1993", "authors": "Moroni MC, Vigano MA, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7908827", "url": "https://glygen.org/publication/PubMed/7908827" } ] }, { "title": "Isoform-specific amino-terminal domains dictate DNA-binding properties of ROR alpha, a novel family of orphan hormone nuclear receptors.", "journal": "Genes & development", "date": "1994", "authors": "Giguere V, Tini M, Flock G, Ong E, Evans RM, Otulakowski G", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "7926749", "url": "https://glygen.org/publication/PubMed/7926749" } ] }, { "title": "Groucho is required for Drosophila neurogenesis, segmentation, and sex determination and interacts directly with hairy-related bHLH proteins.", "journal": "Cell", "date": "1994", "authors": "Paroush Z, Finley RL Jr, Kidd T, Wainwright SM, Ingham PW, Brent R, Ish-Horowicz D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "8001118", "url": "https://glygen.org/publication/PubMed/8001118" } ] }, { "title": "Activation of the human mitochondrial transcription factor A gene by nuclear respiratory factors: a potential regulatory link between nuclear and mitochondrial gene expression in organelle biogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Virbasius JV, Scarpulla RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "8108407", "url": "https://glygen.org/publication/PubMed/8108407" } ] }, { "title": "Insulin-responsive human adipocytes express two glucose transporter isoforms and target them to different vesicles.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Pilch PF, Wilkinson W, Garvey WT, Ciaraldi TP, Hueckstaedt TP, Olefsky JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8325954", "url": "https://glygen.org/publication/PubMed/8325954" } ] }, { "title": "Smaller isoform of human mitochondrial transcription factor 1: its wide distribution and production by alternative splicing.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Tominaga K, Hayashi J, Kagawa Y, Ohta S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "8333869", "url": "https://glygen.org/publication/PubMed/8333869" } ] }, { "title": "PPAR-RXR heterodimer activates a peroxisome proliferator response element upstream of the bifunctional enzyme gene.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Bardot O, Aldridge TC, Latruffe N, Green S", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "8386511", "url": "https://glygen.org/publication/PubMed/8386511" } ] }, { "title": "Endothelial-cell heme uptake from heme proteins: induction of sensitization and desensitization to oxidant damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Balla J, Jacob HS, Balla G, Nath K, Eaton JW, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8415693", "url": "https://glygen.org/publication/PubMed/8415693" } ] }, { "title": "A functional Rev-erb alpha responsive element located in the human Rev-erb alpha promoter mediates a repressing activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Adelmant G, Begue A, Stehelin D, Laudet V", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "8622974", "url": "https://glygen.org/publication/PubMed/8622974" } ] }, { "title": "The adipocyte specific transcription factor C/EBPalpha modulates human ob gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Miller SG, De Vos P, Guerre-Millo M, Wong K, Hermann T, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8643605", "url": "https://glygen.org/publication/PubMed/8643605" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "The WRPW motif of the hairy-related basic helix-loop-helix repressor proteins acts as a 4-amino-acid transcription repression and protein-protein interaction domain.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Fisher AL, Ohsako S, Caudy M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "8649374", "url": "https://glygen.org/publication/PubMed/8649374" } ] }, { "title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.", "journal": "Development (Cambridge, England)", "date": "1996", "authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8674428", "url": "https://glygen.org/publication/PubMed/8674428" } ] }, { "title": "Molecular interaction between TLE1 and the carboxyl-terminal domain of HES-1 containing the WRPW motif.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Grbavec D, Stifani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "8687460", "url": "https://glygen.org/publication/PubMed/8687460" } ] }, { "title": "A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Lambe KG, Tugwood JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8706692", "url": "https://glygen.org/publication/PubMed/8706692" } ] }, { "title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.", "journal": "Nucleic acids research", "date": "1996", "authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8759021", "url": "https://glygen.org/publication/PubMed/8759021" } ] }, { "title": "Thiazolidinediones repress ob gene expression in rodents via activation of peroxisome proliferator-activated receptor gamma.", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "De Vos P, Lefebvre AM, Miller SG, Guerre-Millo M, Wong K, Saladin R, Hamann LG, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8770873", "url": "https://glygen.org/publication/PubMed/8770873" } ] }, { "title": "Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Oyake T, Itoh K, Motohashi H, Hayashi N, Hoshino H, Nishizawa M, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8887638", "url": "https://glygen.org/publication/PubMed/8887638" } ] }, { "title": "Cloning, tissue expression, and mapping of a human photolyase homolog with similarity to plant blue-light receptors.", "journal": "Genomics", "date": "1996", "authors": "van der Spek PJ, Kobayashi K, Bootsma D, Takao M, Eker AP, Yasui A", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "8921389", "url": "https://glygen.org/publication/PubMed/8921389" } ] }, { "title": "Peroxisome proliferator-activated receptors: a nuclear receptor signaling pathway in lipid physiology.", "journal": "Annual review of cell and developmental biology", "date": "1996", "authors": "Lemberger T, Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8970730", "url": "https://glygen.org/publication/PubMed/8970730" } ] }, { "title": "Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhou YD, Barnard M, Tian H, Li X, Ring HZ, Francke U, Shelton J, Richardson J, Russell DW, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9012850", "url": "https://glygen.org/publication/PubMed/9012850" } ] }, { "title": "Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mukherjee R, Jow L, Croston GE, Paterniti JR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9065481", "url": "https://glygen.org/publication/PubMed/9065481" } ] }, { "title": "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hogenesch JB, Chan WK, Jackiw VH, Brown RC, Gu YZ, Pray-Grant M, Perdew GH, Bradfield CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9079689", "url": "https://glygen.org/publication/PubMed/9079689" } ] }, { "title": "cDNA cloning and tissue-specific expression of a novel basic helix-loop-helix/PAS protein (BMAL1) and identification of alternatively spliced variants with alternative translation initiation site usage.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Ikeda M, Nomura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9144434", "url": "https://glygen.org/publication/PubMed/9144434" } ] }, { "title": "Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.", "journal": "Cell", "date": "1997", "authors": "Zhang Y, Iratni R, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9150135", "url": "https://glygen.org/publication/PubMed/9150135" } ] }, { "title": "Fatty acids, eicosanoids, and hypolipidemic agents identified as ligands of peroxisome proliferator-activated receptors by coactivator-dependent receptor ligand assay.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Krey G, Braissant O, L'Horset F, Kalkhoven E, Perroud M, Parker MG, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "9171241", "url": "https://glygen.org/publication/PubMed/9171241" } ] }, { "title": "The ERR-1 orphan receptor is a transcriptional activator expressed during bone development.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Bonnelye E, Vanacker JM, Dittmar T, Begue A, Desbiens X, Denhardt DT, Aubin JE, Laudet V, Fournier B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "9178750", "url": "https://glygen.org/publication/PubMed/9178750" } ] }, { "title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Di Rocco G, Mavilio F, Zappavigna V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9218805", "url": "https://glygen.org/publication/PubMed/9218805" } ] }, { "title": "Kuzbanian controls proteolytic processing of Notch and mediates lateral inhibition during Drosophila and vertebrate neurogenesis.", "journal": "Cell", "date": "1997", "authors": "Pan D, Rubin GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9244301", "url": "https://glygen.org/publication/PubMed/9244301" } ] }, { "title": "HOXD4 and regulation of the group 4 paralog genes.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9272954", "url": "https://glygen.org/publication/PubMed/9272954" } ] }, { "title": "Human estrogen receptor-like 1 (ESRL1) gene: genomic organization, chromosomal localization, and promoter characterization.", "journal": "Genomics", "date": "1997", "authors": "Shi H, Shigeta H, Yang N, Fu K, O'Brian G, Teng CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2151201", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201" } ], "reference": [ { "type": "PubMed", "id": "9286700", "url": "https://glygen.org/publication/PubMed/9286700" } ] }, { "title": "Isolation and functional analysis of a cDNA for human Jagged2, a gene encoding a ligand for the Notch1 receptor.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Luo B, Aster JC, Hasserjian RP, Kuo F, Sklar J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9315665", "url": "https://glygen.org/publication/PubMed/9315665" } ] }, { "title": "Transcriptional activation and repression by RORalpha, an orphan nuclear receptor required for cerebellar development.", "journal": "Mol. Endocrinol.", "date": "1997", "authors": "Harding H P, Atkins G B, Jaffe A B, Seo W J, Lazar M A", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "reference": [ { "type": "PubMed", "id": "9328355", "url": "https://glygen.org/publication/PubMed/9328355" } ] }, { "title": "Circadian oscillation of a mammalian homologue of the Drosophila period gene.", "journal": "Nature", "date": "1997", "authors": "Tei H, Okamura H, Shigeyoshi Y, Fukuhara C, Ozawa R, Hirose M, Sakaki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9333243", "url": "https://glygen.org/publication/PubMed/9333243" } ] }, { "title": "Two period homologs: circadian expression and photic regulation in the suprachiasmatic nuclei.", "journal": "Neuron", "date": "1997", "authors": "Shearman LP, Zylka MJ, Weaver DR, Kolakowski LF Jr, Reppert SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9427249", "url": "https://glygen.org/publication/PubMed/9427249" } ] }, { "title": "Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1998", "authors": "Young PW, Buckle DR, Cantello BC, Chapman H, Clapham JC, Coyle PJ, Haigh D, Hindley RM, Holder JC, Kallender H, Latter AJ, Lawrie KW, Mossakowska D, Murphy GJ, Roxbee Cox L, Smith SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9454824", "url": "https://glygen.org/publication/PubMed/9454824" } ] }, { "title": "The human homolog of rat Jagged1 expressed by marrow stroma inhibits differentiation of 32D cells through interaction with Notch1.", "journal": "Immunity", "date": "1998", "authors": "Li L, Milner LA, Deng Y, Iwata M, Banta A, Graf L, Marcovina S, Friedman C, Trask BJ, Hood L, Torok-Storb B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9462510", "url": "https://glygen.org/publication/PubMed/9462510" } ] }, { "title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.", "journal": "The EMBO journal", "date": "1998", "authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9482740", "url": "https://glygen.org/publication/PubMed/9482740" } ] }, { "title": "The basic-helix-loop-helix-PAS orphan MOP3 forms transcriptionally active complexes with circadian and hypoxia factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Hogenesch JB, Gu YZ, Jain S, Bradfield CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9576906", "url": "https://glygen.org/publication/PubMed/9576906" } ] }, { "title": "Nuclear access and action of notch in vivo.", "journal": "Cell", "date": "1998", "authors": "Struhl G, Adachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9604939", "url": "https://glygen.org/publication/PubMed/9604939" } ] }, { "title": "Role of the CLOCK protein in the mammalian circadian mechanism.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Gekakis N, Staknis D, Nguyen HB, Davis FC, Wilsbacher LD, King DP, Takahashi JS, Weitz CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9616112", "url": "https://glygen.org/publication/PubMed/9616112" } ] }, { "title": "Notch-1 signalling requires ligand-induced proteolytic release of intracellular domain.", "journal": "Nature", "date": "1998", "authors": "Schroeter EH, Kisslinger JA, Kopan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9620803", "url": "https://glygen.org/publication/PubMed/9620803" } ] }, { "title": "Transcriptional repression by the methyl-CpG-binding protein MeCP2 involves a histone deacetylase complex.", "journal": "Nature", "date": "1998", "authors": "Nan X, Ng HH, Johnson CA, Laherty CD, Turner BM, Eisenman RN, Bird A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9022692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692" } ], "reference": [ { "type": "PubMed", "id": "9620804", "url": "https://glygen.org/publication/PubMed/9620804" } ] }, { "title": "SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.", "journal": "Molecular cell", "date": "1998", "authors": "Zhang Y, Sun ZW, Iratni R, Erdjument-Bromage H, Tempst P, Hampsey M, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9651585", "url": "https://glygen.org/publication/PubMed/9651585" } ] }, { "title": "Indirect evidence for Delta-dependent intracellular processing of notch in Drosophila embryos.", "journal": "Current biology : CB", "date": "1998", "authors": "Lecourtois M, Schweisguth F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9651681", "url": "https://glygen.org/publication/PubMed/9651681" } ] }, { "title": "The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Yuan CX, Ito M, Fondell JD, Fu ZY, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "9653119", "url": "https://glygen.org/publication/PubMed/9653119" } ] }, { "title": "A histone deacetylase corepressor complex regulates the Notch signal transduction pathway.", "journal": "Genes & development", "date": "1998", "authors": "Kao HY, Ordentlich P, Koyano-Nakagawa N, Tang Z, Downes M, Kintner CR, Evans RM, Kadesch T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2122947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947" } ], "reference": [ { "type": "PubMed", "id": "9694793", "url": "https://glygen.org/publication/PubMed/9694793" } ] }, { "title": "ETO, fusion partner in t(8;21) acute myeloid leukemia, represses transcription by interaction with the human N-CoR/mSin3/HDAC1 complex.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Wang J, Hoshino T, Redner RL, Kajigaya S, Liu JM", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" }, { "database": "RefSeq", "id": "NP_001177367", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177367" } ], "reference": [ { "type": "PubMed", "id": "9724795", "url": "https://glygen.org/publication/PubMed/9724795" } ] }, { "title": "The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Vu-Dac N, Chopin-Delannoy S, Gervois P, Bonnelye E, Martin G, Fruchart JC, Laudet V, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9748239", "url": "https://glygen.org/publication/PubMed/9748239" } ] }, { "title": "The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, LeRoy G, Seelig HP, Lane WS, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9790534", "url": "https://glygen.org/publication/PubMed/9790534" } ] }, { "title": "Characterization of photolyase/blue-light receptor homologs in mouse and human cells.", "journal": "Nucleic acids research", "date": "1998", "authors": "Kobayashi K, Kanno S, Smit B, van der Horst GT, Takao M, Yasui A", "evidence": [ { "database": "Reactome", "id": "R-HSA-400253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253" } ], "reference": [ { "type": "PubMed", "id": "9801304", "url": "https://glygen.org/publication/PubMed/9801304" } ] }, { "title": "Delta-1 activation of notch-1 signaling results in HES-1 transactivation.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Jarriault S, Le Bail O, Hirsinger E, Pourquie O, Logeat F, Strong CF, Brou C, Seidah NG, Isra l A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2644606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606" } ], "reference": [ { "type": "PubMed", "id": "9819428", "url": "https://glygen.org/publication/PubMed/9819428" } ] }, { "title": "N-(2-Benzoylphenyl)-L-tyrosine PPARgamma agonists. 1. Discovery of a novel series of potent antihyperglycemic and antihyperlipidemic agents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Henke BR, Blanchard SG, Brackeen MF, Brown KK, Cobb JE, Collins JL, Harrington WW Jr, Hashim MA, Hull-Ryde EA, Kaldor I, Kliewer SA, Lake DH, Leesnitzer LM, Lehmann JM, Lenhard JM, Orband-Miller LA, Miller JF, Mook RA Jr, Noble SA, Oliver W Jr, Parks DJ, Plunket KD, Szewczyk JR, Willson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-400206", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206" } ], "reference": [ { "type": "PubMed", "id": "9836620", "url": "https://glygen.org/publication/PubMed/9836620" } ] } ], "pathway": [ { "id": "hsa:9611", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9611", "resource": "KEGG Pathway" }, { "id": "R-HSA-1251985", "name": "Nuclear signaling by ERBB4", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985", "resource": "Reactome", "description": "Nuclear signaling by ERBB4" }, { "id": "R-HSA-1368071", "name": "NR1D1 (REV-ERBA) represses gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1368071", "resource": "Reactome", "description": "NR1D1 (REV-ERBA) represses gene expression" }, { "id": "R-HSA-1989781", "name": "PPARA activates gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "description": "PPARA activates gene expression" }, { "id": "R-HSA-2122947", "name": "NOTCH1 Intracellular Domain Regulates Transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2122947", "resource": "Reactome", "description": "NOTCH1 Intracellular Domain Regulates Transcription" }, { "id": "R-HSA-2151201", "name": "Transcriptional activation of mitochondrial biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2151201", "resource": "Reactome", "description": "Transcriptional activation of mitochondrial biogenesis" }, { "id": "R-HSA-2173795", "name": "Downregulation of SMAD2/3:SMAD4 transcriptional activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173795", "resource": "Reactome", "description": "Downregulation of SMAD2/3:SMAD4 transcriptional activity" }, { "id": "R-HSA-2644606", "name": "Constitutive Signaling by NOTCH1 PEST Domain Mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2644606", "resource": "Reactome", "description": "Constitutive Signaling by NOTCH1 PEST Domain Mutants" }, { "id": "R-HSA-2894862", "name": "Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2894862", "resource": "Reactome", "description": "Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants" }, { "id": "R-HSA-3214815", "name": "HDACs deacetylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "resource": "Reactome", "description": "HDACs deacetylate histones" }, { "id": "R-HSA-350054", "name": "Notch-HLH transcription pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350054", "resource": "Reactome", "description": "Notch-HLH transcription pathway" }, { "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "description": "Transcriptional regulation of white adipocyte differentiation" }, { "id": "R-HSA-383280", "name": "Nuclear Receptor transcription pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280", "resource": "Reactome", "description": "Nuclear Receptor transcription pathway" }, { "id": "R-HSA-400206", "name": "Regulation of lipid metabolism by PPARalpha", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400206", "resource": "Reactome", "description": "Regulation of lipid metabolism by PPARalpha" }, { "id": "R-HSA-400253", "name": "Circadian Clock", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400253", "resource": "Reactome", "description": "Circadian Clock" }, { "id": "R-HSA-5617472", "name": "Activation of anterior HOX genes in hindbrain development during early embryogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "resource": "Reactome", "description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis" }, { "id": "R-HSA-9022537", "name": "Loss of MECP2 binding ability to the NCoR/SMRT complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022537", "resource": "Reactome", "description": "Loss of MECP2 binding ability to the NCoR/SMRT complex" }, { "id": "R-HSA-9022692", "name": "Regulation of MECP2 expression and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9022692", "resource": "Reactome", "description": "Regulation of MECP2 expression and activity" }, { "id": "R-HSA-9029569", "name": "NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569", "resource": "Reactome", "description": "NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux" }, { "id": "R-HSA-9609690", "name": "HCMV Early Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "resource": "Reactome", "description": "HCMV Early Events" }, { "id": "R-HSA-9623433", "name": "NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9623433", "resource": "Reactome", "description": "NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis" }, { "id": "R-HSA-9707564", "name": "Cytoprotection by HMOX1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564", "resource": "Reactome", "description": "Cytoprotection by HMOX1" }, { "id": "R-HSA-9707616", "name": "Heme signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "resource": "Reactome", "description": "Heme signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q60974-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "Ncor1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD", "length": 2453 }, "evidence": [ { "id": "45923784", "url": "http://www.informatics.jax.org/homology/45923784", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WUB5-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "Ncor1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "KDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYEAPSDAIEVISPASSPAPPQEKPQTYQPEMVKANQAENESPQQYEGPLTHYRSQQGSPSPQQQPPLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGMDPAEQRSDSRSPGSISYLPYFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMPHPVGVVPGSASTSVVTSSETRRDEGDPSPHSGVCKPKLINKSNSRKSKSPIPGQNYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTPIACAPSAITQAAPHQQSRIWEREPAPLLSAQYETLSDSDD", "length": 533 }, "evidence": [ { "id": "45923784", "url": "http://www.informatics.jax.org/homology/45923784", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "transcription repressor complex", "id": "GO:0017053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017053", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "histone deacetylase complex", "id": "GO:0000118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000118", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "mitotic spindle", "id": "GO:0072686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072686", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "negative regulation of fatty acid metabolic process", "id": "GO:0045922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045922", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "negative regulation of glycolytic process", "id": "GO:0045820", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045820", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "locomotor rhythm", "id": "GO:0045475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045475", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "negative regulation of JNK cascade", "id": "GO:0046329", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046329", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "spindle assembly", "id": "GO:0051225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051225", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "negative regulation of androgen receptor signaling pathway", "id": "GO:0060766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060766", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "negative regulation of miRNA transcription", "id": "GO:1902894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902894", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "nuclear thyroid hormone receptor binding", "id": "GO:0046966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046966", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" }, { "name": "nuclear receptor binding", "id": "GO:0016922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016922", "evidence": [ { "database": "UniProtKB", "id": "O75376", "url": "https://www.uniprot.org/uniprot/O75376" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1392, "end_pos": 1394, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1500, "end_pos": 1502, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1510, "end_pos": 1512, "annotation": "n_glycosylation_sequon" }, { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1779, "end_pos": 1781, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2200, "end_pos": 2202, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2217, "end_pos": 2219, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2298, "end_pos": 2300, "annotation": "n_glycosylation_sequon" }, { "start_pos": 740, "end_pos": 742, "annotation": "n_glycosylation_sequon" }, { "start_pos": 785, "end_pos": 787, "annotation": "n_glycosylation_sequon" }, { "start_pos": 877, "end_pos": 879, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 2, 3, 4, 14, 15, 18, 24, 28, 32, 45, 46, 51, 54, 123, 1026, 1027, 1030, 1039, 1040, 1042, 1043, 1046, 1050, 1064, 1073, 1075, 1082, 1114, 1117, 1263, 1266, 1446, 1449, 1450, 1453, 1454, 1457, 1479, 1480, 1484, 1487, 1491, 1493, 1533, 1543, 1545, 1656, 1806, 1812, 1857, 1861, 1877, 1883, 1884, 1885, 1889, 1913, 1925, 1926, 1928, 2033, 2034, 2069, 2070, 2078, 2079, 2080, 2084, 2086, 2090, 2219, 2233, 2242, 2246, 2287, 2299, 2330, 2332 ], "snv_sites": [ 2, 3, 5, 14, 15, 28, 32, 45, 51, 54, 101, 123, 269, 482, 842, 949, 1019, 1030, 1040, 1042, 1043, 1072, 1073, 1075, 1082, 1114, 1152, 1184, 1381, 1446, 1449, 1450, 1479, 1480, 1491, 1492, 1533, 1545, 1697, 1755, 1806, 1812, 1817, 1854, 1855, 1861, 1884, 1889, 1933, 2033, 2069, 2070, 2080, 2085, 2086, 2090, 2182, 2187, 2214, 2219, 2246, 2287, 2299, 2330, 2332 ], "glycation_sites": [], "phosphorylation_sites": [ 70, 88, 97, 157, 158, 161, 172, 224, 275, 401, 999, 1111, 1150, 1195, 1196, 1206, 1242, 1246, 1247, 1249, 1263, 1281, 1322, 1367, 1450, 1472, 1491, 1493, 1533, 1543, 1592, 1672, 1925, 1977, 1980, 1981, 1991, 1992, 2084, 2090, 2091, 2102, 2120, 2136, 2151, 2164, 2184, 2187, 2202, 2395, 2396, 2399, 2432, 2434, 2436, 2438 ], "sequon_annotation_sites": [ { "start_pos": 1392, "end_pos": 1394 }, { "start_pos": 1500, "end_pos": 1502 }, { "start_pos": 1510, "end_pos": 1512 }, { "start_pos": 170, "end_pos": 172 }, { "start_pos": 1779, "end_pos": 1781 }, { "start_pos": 2200, "end_pos": 2202 }, { "start_pos": 2217, "end_pos": 2219 }, { "start_pos": 2298, "end_pos": 2300 }, { "start_pos": 740, "end_pos": 742 }, { "start_pos": 785, "end_pos": 787 }, { "start_pos": 877, "end_pos": 879 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 90 }, { "field": "total_sites", "count": 78 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 78 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 90 }, { "field": "total_sites", "count": 78 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 78 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 57 }, { "field": "total_sites", "count": 56 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 79 }, { "field": "total_sites", "count": 65 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 20 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 59 }, { "field": "total_sites", "count": 47 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 456 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }