{ "uniprot_canonical_ac": "O60507-1", "uniprot_ac": "O60507", "uniprot_id": "TPST1_HUMAN", "mass": { "chemical_mass": 42188.0, "monoisotopic_mass": 42188.0 }, "refseq": { "ac": "NP_003587", "name": "protein-tyrosine sulfotransferase 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, "gene_names": [ { "name": "TPST1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60507", "id": "O60507" }, { "name": "TANGO13A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587", "id": "NP_003587" }, { "name": "TPST1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587", "id": "NP_003587" } ], "protein_names": [ { "name": "Protein-tyrosine sulfotransferase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60507" }, { "name": "2.8.2.20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60507" }, { "name": "TPST-1; transport and golgi organization 13 homolog A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587", "id": "NP_003587" }, { "name": "TPST-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60507" }, { "name": "Tyrosylprotein sulfotransferase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60507" }, { "name": "protein-tyrosine sulfotransferase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587", "id": "NP_003587" } ], "function": [ { "annotation": "Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.", "evidence": [ { "database": "UniProtKB", "id": "C9J3I4", "url": "https://www.uniprot.org/uniprot/C9J3I4#function" }, { "database": "UniProtKB", "id": "ARBA00003886", "url": "https://www.uniprot.org/uniprot/ARBA00003886#function" }, { "database": "UniProtKB", "id": "RU365018", "url": "https://www.uniprot.org/uniprot/RU365018#function" }, { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507#function" }, { "database": "PubMed", "id": "28821720", "url": "https://glygen.org/publication/PubMed/28821720" }, { "database": "PubMed", "id": "9501187", "url": "https://glygen.org/publication/PubMed/9501187" }, { "database": "PubMed", "id": "9733778", "url": "https://glygen.org/publication/PubMed/9733778" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, { "database": "PubMed", "id": "19343046", "url": "https://glygen.org/publication/PubMed/19343046" } ] }, { "annotation": "Results exclude TPST1 as the causative gene for Shwachman-Diamond syndrome", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, { "database": "PubMed", "id": "12032733", "url": "https://glygen.org/publication/PubMed/12032733" } ] }, { "annotation": "Shear stress-dependent downregulation of TPST1 in human endothelium involves protein kinase C Erratum:[Biochem Biophys Res Commun 2002 Jul 26;295(4):1033]", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, { "database": "PubMed", "id": "12056800", "url": "https://glygen.org/publication/PubMed/12056800" } ] }, { "annotation": "TPST1 rs3757417T>G polymorphisms are associated with colorectal cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, { "database": "PubMed", "id": "25079514", "url": "https://glygen.org/publication/PubMed/25079514" } ] }, { "annotation": "TPST1 was significantly negatively correlated with the expression of cMet in lung cancer and may be a negative prognostic biomarker of lung cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, { "database": "PubMed", "id": "26238632", "url": "https://glygen.org/publication/PubMed/26238632" } ] }, { "annotation": "Up-regulation of TPST-1 and tyrosine sulfation of CXCR4 by LMP1 might be a potential mechanism contributing to nasopharyngeal carcinoma metastasis", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" }, { "database": "PubMed", "id": "23472069", "url": "https://glygen.org/publication/PubMed/23472069" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O60507", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60507" } ], "glycoeffect": [], "start_pos": 123, "end_pos": 123, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "7", "chr_pos": "66240793", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R123", "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] }, { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs777930990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777930990" }, { "id": "rs777930990", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777930990" }, { "id": "rs777930990", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777930990#frequency_tab" }, { "id": "rs777930990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777930990" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 178, "end_pos": 178, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAK->NAT).", "chr_id": "7", "chr_pos": "66240958", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K178", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769664448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769664448" }, { "id": "rs769664448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769664448" }, { "id": "rs769664448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769664448" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 199, "end_pos": 199, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "7", "chr_pos": "66241021", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T199", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779862337", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779862337" }, { "id": "rs779862337", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779862337" }, { "id": "rs779862337", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779862337" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 286, "end_pos": 286, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "7", "chr_pos": "66286521", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S286", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1181871262", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181871262" }, { "id": "rs1181871262", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1181871262#frequency_tab" }, { "id": "rs1181871262", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181871262" }, { "id": "22980975", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22980975" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 287, "end_pos": 287, "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "7", "chr_pos": "66286524", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T287", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1363018148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1363018148" }, { "id": "rs1363018148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1363018148" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 46, "end_pos": 46, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "7", "chr_pos": "66240561", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S46", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757293518", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757293518" }, { "id": "rs757293518", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757293518" }, { "id": "rs757293518", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757293518#frequency_tab" }, { "id": "rs757293518", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757293518" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 46, "end_pos": 46, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "7", "chr_pos": "66240562", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S46", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140628446", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140628446" }, { "id": "rs140628446", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs140628446" }, { "id": "rs140628446", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140628446" }, { "id": "rs140628446", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140628446#frequency_tab" }, { "id": "rs140628446", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140628446" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 49, "end_pos": 49, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "7", "chr_pos": "66240570", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T49", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1465935417", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1465935417" }, { "id": "rs1465935417", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1465935417" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 53, "end_pos": 53, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "7", "chr_pos": "66240582", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T53", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768997726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768997726" }, { "id": "rs768997726", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768997726" }, { "id": "rs768997726", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768997726#frequency_tab" }, { "id": "rs768997726", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768997726" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 53, "end_pos": 53, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "7", "chr_pos": "66240583", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T53", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773861172", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773861172" }, { "id": "rs773861172", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773861172" }, { "id": "rs773861172", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773861172" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 60, "end_pos": 60, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->IKT).", "chr_id": "7", "chr_pos": "66240604", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N60", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773861172", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773861172" }, { "id": "rs773861172", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773861172" }, { "id": "rs773861172", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773861172" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 60, "end_pos": 60, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "7", "chr_pos": "66240604", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N60", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 262, "end_pos": 262, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of one glycosylation site. Loss of N-glycosylation; when associated with A-60.", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" }, { "database": "PubMed", "id": "16859706", "url": "https://glygen.org/publication/PubMed/16859706" } ] }, { "start_pos": 60, "end_pos": 60, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of one glycosylation site. Loss of N-glycosylation; when associated with A-262.", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" }, { "database": "PubMed", "id": "16859706", "url": "https://glygen.org/publication/PubMed/16859706" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "76.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "58.49", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "77.81", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "62.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "90.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "57.31", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "87.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "57.49", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "83.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "82.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60507" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "common_name": "Human" } ], "gene": [ { "name": "TPST1", "url": "https://www.uniprot.org/uniprot/O60507", "locus": { "chromosome": "7", "start_pos": 66420543, "end_pos": 66205317, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000169902", "url": "https://www.ensembl.org/id/ENSG00000169902" } ] } } ], "crossref": [ { "id": "ENSG00000169902", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169902", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O60507", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60507", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.8.2.20", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.8.2.20&UniProtAcc=O60507", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "TPST1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TPST1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8460", "url": "https://www.ncbi.nlm.nih.gov/gene/8460", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12020", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12020", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60507", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60507*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR026634", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026634", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8460", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8460", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603125", "url": "http://www.omim.org/entry/603125", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60507", "url": "https://www.nextprot.org/entry/NX_O60507", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O60507", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60507", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LNDFRQC", "url": "https://omabrowser.org/oma/group/LNDFRQC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5391764at2759", "url": "http://www.orthodb.org/?query=5391764at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12788", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12788", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12788:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12788:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5WRI", "url": "https://www.rcsb.org/structure/5WRI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WRJ", "url": "https://www.rcsb.org/structure/5WRJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13469", "url": "http://pfam.xfam.org/family/PF13469", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60507", "url": "https://pharos.nih.gov/targets/O60507", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60507", "url": "http://purl.obolibrary.org/obo/PR_O60507", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9674519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16801", "url": "https://www.rhea-db.org/rhea/16801", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O60507", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "C9J3I4", "url": "https://www.uniprot.org/uniprot/C9J3I4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J3I4-1", "url": "https://www.uniprot.org/uniprot/C9J3I4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9K0F3", "url": "https://www.uniprot.org/uniprot/C9K0F3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9K0F3-1", "url": "https://www.uniprot.org/uniprot/C9K0F3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60507-1", "url": "https://www.uniprot.org/uniprot/O60507-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE", "length": 370, "header": "sp|O60507-1|TPST1_HUMAN Isoform 1 of Protein-tyrosine sulfotransferase 1 OS=Homo sapiens OX=9606 GN=TPST1 PE=1 SV=1 CANONICAL=O60507-1" }, "isoforms": [ { "isoform_ac": "C9J3I4-1", "url": "", "sequence": { "sequence": "MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQA", "length": 140, "header": "tr|C9J3I4-1|C9J3I4_HUMAN Computationally mapped isoform of Protein-tyrosine sulfotransferase OS=Homo sapiens OX=9606 GN=TPST1 PE=1 SV=1 CANONICAL=O60507-1" }, "locus": { "chromosome": "7", "start_pos": 66240845, "end_pos": 66240426, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000451388.1", "url": "https://www.ensembl.org/id/ENST00000451388.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000391338.1", "url": "https://www.ensembl.org/id/ENSP00000391338.1" } ] } }, { "isoform_ac": "C9K0F3-1", "url": "", "sequence": { "sequence": "MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQP", "length": 41, "header": "tr|C9K0F3-1|TPST1_HUMAN Computationally mapped isoform of Protein-tyrosine sulfotransferase 1 OS=Homo sapiens OX=9606 GN=TPST1 PE=1 SV=8 CANONICAL=O60507-1" }, "locus": { "chromosome": "7", "start_pos": 66240548, "end_pos": 66240426, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000442120.1", "url": "https://www.ensembl.org/id/ENST00000442120.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000399642.1", "url": "https://www.ensembl.org/id/ENSP00000399642.1" } ] } }, { "isoform_ac": "O60507-1", "url": "", "sequence": { "sequence": "MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE", "length": 370, "header": "sp|O60507-1|TPST1_HUMAN Isoform 1 of Protein-tyrosine sulfotransferase 1 OS=Homo sapiens OX=9606 GN=TPST1 PE=1 SV=1 CANONICAL=O60507-1" }, "locus": { "chromosome": "7", "start_pos": 66356839, "end_pos": 66240426, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000304842.6", "url": "https://www.ensembl.org/id/ENST00000304842.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000302413.5", "url": "https://www.ensembl.org/id/ENSP00000302413.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "KVTIAGFDLNSYR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 197, "start_aa": "Lys", "end_pos": 209, "end_aa": "Arg", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 262, "start_aa": "Asn", "end_pos": 262, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn262", "evidence": [ { "id": "O60507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60507#ptm_processing" }, { "id": "16859706", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16859706" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 286, "start_aa": "Ser", "end_pos": 286, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser286", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ST", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 286, "start_aa": "Ser", "end_pos": 287, "end_aa": "Thr", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "STDQVIKPVNVGALSK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 286, "start_aa": "Ser", "end_pos": 301, "end_aa": "Lys", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 287, "start_aa": "Thr", "end_pos": 287, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr287", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LESTRTTVR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 44, "start_aa": "Leu", "end_pos": 52, "end_aa": "Arg", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LESTRTTVRTGLDLK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 44, "start_aa": "Leu", "end_pos": 58, "end_aa": "Lys", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 46, "start_aa": "Ser", "end_pos": 46, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser46", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ST", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 46, "start_aa": "Ser", "end_pos": 47, "end_aa": "Thr", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 47, "start_aa": "Thr", "end_pos": 47, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr47", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 49, "start_aa": "Thr", "end_pos": 49, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr49", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 50, "start_aa": "Thr", "end_pos": 50, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr50", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 53, "start_aa": "Thr", "end_pos": 53, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr53", "evidence": [ { "id": "O60507", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 60, "start_aa": "Asn", "end_pos": 60, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn60", "evidence": [ { "id": "O60507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60507#ptm_processing" }, { "id": "16859706", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16859706" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O60507", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60507" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60507", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60507" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser286" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "O60507", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "O60507", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Characterization of human iodothyronine sulfotransferases.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1999", "authors": "Kester MH, Kaptein E, Roest TJ, van Dijk CH, Tibboel D, Meinl W, Glatt H, Coughtrie MW, Visser TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10199779", "url": "https://glygen.org/publication/PubMed/10199779" } ] }, { "title": "Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Spiegelberg BD, Xiong JP, Smith JJ, Gu RF, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10224133", "url": "https://glygen.org/publication/PubMed/10224133" } ] }, { "title": "Sulfotransferase catalyzing sulfation of heterocyclic amines.", "journal": "Cancer letters", "date": "1999", "authors": "Yamazoe Y, Nagata K, Yoshinari K, Fujita K, Shiraga T, Iwasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10503886", "url": "https://glygen.org/publication/PubMed/10503886" } ] }, { "title": "Sulfation of iodothyronines by recombinant human liver steroid sulfotransferases.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Li X, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10512730", "url": "https://glygen.org/publication/PubMed/10512730" } ] }, { "title": "Identification, cloning, and heterologous expression of a mammalian fructosamine-3-kinase.", "journal": "Diabetes", "date": "2000", "authors": "Delpierre G, Rider MH, Collard F, Stroobant V, Vanstapel F, Santos H, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "11016445", "url": "https://glygen.org/publication/PubMed/11016445" } ] }, { "title": "Sulfation of iodothyronines by human sulfotransferase 1C1 (SULT1C1)*.", "journal": "Biochemical pharmacology", "date": "2000", "authors": "Li X, Clemens DL, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11077054", "url": "https://glygen.org/publication/PubMed/11077054" } ] }, { "title": "Sulfotransferases in the bioactivation of xenobiotics.", "journal": "Chemico-biological interactions", "date": "2000", "authors": "Glatt H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11154739", "url": "https://glygen.org/publication/PubMed/11154739" } ] }, { "title": "Expression and characterization of the human 3 beta-hydroxysteroid sulfotransferases (SULT2B1a and SULT2B1b).", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2001", "authors": "Meloche CA, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11457664", "url": "https://glygen.org/publication/PubMed/11457664" } ] }, { "title": "Characterization of human liver thermostable phenol sulfotransferase (SULT1A1) allozymes with 3,3',5-triiodothyronine as the substrate.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Li X, Clemens DL, Cole JR, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11739018", "url": "https://glygen.org/publication/PubMed/11739018" } ] }, { "title": "Fine mapping of the locus for Shwachman-Diamond syndrome at 7q11, identification of shared disease haplotypes, and exclusion of TPST1 as a candidate gene.", "journal": "European journal of human genetics : EJHG", "date": "2002", "authors": "Popovic M, Goobie S, Morrison J, Ellis L, Ehtesham N, Richards N, Boocock G, Durie PR, Rommens JM", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" } ], "reference": [ { "type": "PubMed", "id": "12032733", "url": "https://glygen.org/publication/PubMed/12032733" } ] }, { "title": "Highly conserved mouse and human brain sulfotransferases: molecular cloning, expression, and functional characterization.", "journal": "Gene", "date": "2002", "authors": "Sakakibara Y, Suiko M, Pai TG, Nakayama T, Takami Y, Katafuchi J, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12039030", "url": "https://glygen.org/publication/PubMed/12039030" } ] }, { "title": "Shear stress mediates tyrosylprotein sulfotransferase isoform shift in human endothelial cells.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Goettsch S, Goettsch W, Morawietz H, Bayer P", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" } ], "reference": [ { "type": "PubMed", "id": "12056800", "url": "https://glygen.org/publication/PubMed/12056800" } ] }, { "title": "Mutational analysis of human hydroxysteroid sulfotransferase SULT2B1 isoforms reveals that exon 1B of the SULT2B1 gene produces cholesterol sulfotransferase, whereas exon 1A yields pregnenolone sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fuda H, Lee YC, Shimizu C, Javitt NB, Strott CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12145317", "url": "https://glygen.org/publication/PubMed/12145317" } ] }, { "title": "Sulfonation and molecular action.", "journal": "Endocrine reviews", "date": "2002", "authors": "Strott CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12372849", "url": "https://glygen.org/publication/PubMed/12372849" } ] }, { "title": "Endoglycan, a member of the CD34 family, functions as an L-selectin ligand through modification with tyrosine sulfation and sialyl Lewis x.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Fieger CB, Sassetti CM, Rosen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12889478", "url": "https://glygen.org/publication/PubMed/12889478" } ] }, { "title": "Human catecholamine sulfotransferase (SULT1A3) pharmacogenetics: functional genetic polymorphism.", "journal": "Journal of neurochemistry", "date": "2003", "authors": "Thomae BA, Rifki OF, Theobald MA, Eckloff BW, Wieben ED, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "14622112", "url": "https://glygen.org/publication/PubMed/14622112" } ] }, { "title": "A mammalian protein homologous to fructosamine-3-kinase is a ketosamine-3-kinase acting on psicosamines and ribulosamines but not on fructosamines.", "journal": "Diabetes", "date": "2003", "authors": "Collard F, Delpierre G, Stroobant V, Matthijs G, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "14633848", "url": "https://glygen.org/publication/PubMed/14633848" } ] }, { "title": "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Padmanabhan B, Kuzuhara T, Adachi N, Horikoshi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "14672934", "url": "https://glygen.org/publication/PubMed/14672934" } ] }, { "title": "Identification of fructosamine residues deglycated by fructosamine-3-kinase in human hemoglobin.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Delpierrre G, Vertommen D, Communi D, Rider MH, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "15102834", "url": "https://glygen.org/publication/PubMed/15102834" } ] }, { "title": "Fructosamine 3-kinase-related protein and deglycation in human erythrocytes.", "journal": "The Biochemical journal", "date": "2004", "authors": "Collard F, Wiame E, Bergans N, Fortpied J, Vertommen D, Vanstapel F, Delpierre G, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "15137908", "url": "https://glygen.org/publication/PubMed/15137908" } ] }, { "title": "Human SULT1A3 pharmacogenetics: gene duplication and functional genomic studies.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Hildebrandt MA, Salavaggione OE, Martin YN, Flynn HC, Jalal S, Wieben ED, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "15358107", "url": "https://glygen.org/publication/PubMed/15358107" } ] }, { "title": "Identification and functional importance of tyrosine sulfate residues within recombinant factor VIII.", "journal": "Biochemistry", "date": "1992", "authors": "Pittman DD, Wang JH, Kaufman RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "1554716", "url": "https://glygen.org/publication/PubMed/1554716" } ] }, { "title": "Human TPST1 transmembrane domain triggers enzyme dimerisation and localisation to the Golgi compartment.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Goettsch S, Badea RA, Mueller JW, Wotzlaw C, Schoelermann B, Schulz L, Rabiller M, Bayer P, Hartmann-Fatu C", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507#ptm_processing" }, { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "reference": [ { "type": "PubMed", "id": "16859706", "url": "https://glygen.org/publication/PubMed/16859706" } ] }, { "title": "Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Kerr SC, Fieger CB, Snapp KR, Rosen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "18606703", "url": "https://glygen.org/publication/PubMed/18606703" } ] }, { "title": "Mass spectrometric kinetic analysis of human tyrosylprotein sulfotransferase-1 and -2.", "journal": "Journal of the American Society for Mass Spectrometry", "date": "2008", "authors": "Danan LM, Yu Z, Hoffhines AJ, Moore KL, Leary JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "18672380", "url": "https://glygen.org/publication/PubMed/18672380" } ] }, { "title": "Sulfation of Tyr1680 of human blood coagulation factor VIII is essential for the interaction of factor VIII with von Willebrand factor.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Leyte A, van Schijndel HB, Niehrs C, Huttner WB, Verbeet MP, Mertens K, van Mourik JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674519" } ], "reference": [ { "type": "PubMed", "id": "1898735", "url": "https://glygen.org/publication/PubMed/1898735" } ] }, { "title": "Topology of mammalian isoprenylcysteine carboxyl methyltransferase determined in live cells with a fluorescent probe.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Wright LP, Court H, Mor A, Ahearn IM, Casey PJ, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "19158273", "url": "https://glygen.org/publication/PubMed/19158273" } ] }, { "title": "Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.", "journal": "Journal of human genetics", "date": "2009", "authors": "Saito A, Kawamoto M, Kamatani N", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" } ], "reference": [ { "type": "PubMed", "id": "19343046", "url": "https://glygen.org/publication/PubMed/19343046" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O60507", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60507" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Mechanism of isoprenylcysteine carboxyl methylation from the crystal structure of the integral membrane methyltransferase ICMT.", "journal": "Molecular cell", "date": "2011", "authors": "Yang J, Kulkarni K, Manolaridis I, Zhang Z, Dodd RB, Mas-Droux C, Barford D", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "22195972", "url": "https://glygen.org/publication/PubMed/22195972" } ] }, { "title": "Human liver steroid sulphotransferase sulphates bile acids.", "journal": "The Biochemical journal", "date": "1990", "authors": "Radominska A, Comer KA, Zimniak P, Falany J, Iscan M, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "2268288", "url": "https://glygen.org/publication/PubMed/2268288" } ] }, { "title": "Mapping the hallmarks of lung adenocarcinoma with massively parallel sequencing.", "journal": "Cell", "date": "2012", "authors": "Imielinski M, Berger AH, Hammerman PS, Hernandez B, Pugh TJ, Hodis E, Cho J, Suh J, Capelletti M, Sivachenko A, Sougnez C, Auclair D, Lawrence MS, Stojanov P, Cibulskis K, Choi K, de Waal L, Sharifnia T, Brooks A, Greulich H, Banerji S, Zander T, Seidel D, Leenders F, Ansen S, Ludwig C, Engel-Riedel W, Stoelben E, Wolf J, Goparju C, Thompson K, Winckler W, Kwiatkowski D, Johnson BE, Janne PA, Miller VA, Pao W, Travis WD, Pass HI, Gabriel SB, Lander ES, Thomas RK, Garraway LA, Getz G, Meyerson M", "evidence": [ { "database": "dbSNP", "id": "rs1181871262", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181871262" } ], "reference": [ { "type": "PubMed", "id": "22980975", "url": "https://glygen.org/publication/PubMed/22980975" } ] }, { "title": "Tyrosylprotein sulfotransferase-1 and tyrosine sulfation of chemokine receptor 4 are induced by Epstein-Barr virus encoded latent membrane protein 1 and associated with the metastatic potential of human nasopharyngeal carcinoma.", "journal": "PloS one", "date": "2013", "authors": "Xu J, Deng X, Tang M, Li L, Xiao L, Yang L, Zhong J, Bode AM, Dong Z, Tao Y, Cao Y", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" } ], "reference": [ { "type": "PubMed", "id": "23472069", "url": "https://glygen.org/publication/PubMed/23472069" } ] }, { "title": "Role for cytoplasmic nucleotide hydrolysis in hepatic function and protein synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Hudson BH, Frederick JP, Drake LY, Megosh LC, Irving RP, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "23479625", "url": "https://glygen.org/publication/PubMed/23479625" } ] }, { "title": "Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.", "journal": "Nature communications", "date": "2013", "authors": "Teramoto T, Fujikawa Y, Kawaguchi Y, Kurogi K, Soejima M, Adachi R, Nakanishi Y, Mishiro-Sato E, Liu MC, Sakakibara Y, Suiko M, Kimura M, Kakuta Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "23481380", "url": "https://glygen.org/publication/PubMed/23481380" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "O60507", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "An improved isoprenylcysteine carboxylmethyltransferase inhibitor induces cancer cell death and attenuates tumor growth in vivo.", "journal": "Cancer biology & therapy", "date": "2014", "authors": "Lau HY, Ramanujulu PM, Guo D, Yang T, Wirawan M, Casey PJ, Go ML, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "24971579", "url": "https://glygen.org/publication/PubMed/24971579" } ] }, { "title": "Mutational analysis of the integral membrane methyltransferase isoprenylcysteine carboxyl methyltransferase (ICMT) reveals potential substrate binding sites.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Diver MM, Long SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "25059662", "url": "https://glygen.org/publication/PubMed/25059662" } ] }, { "title": "Genetic variation in microRNA-binding site and prognosis of patients with colorectal cancer.", "journal": "Journal of cancer research and clinical oncology", "date": "2015", "authors": "Kim JG, Chae YS, Lee SJ, Kang BW, Park JY, Lee EJ, Jeon HS, Park JS, Choi GS", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" } ], "reference": [ { "type": "PubMed", "id": "25079514", "url": "https://glygen.org/publication/PubMed/25079514" } ] }, { "title": "Heterodimers of tyrosylprotein sulfotransferases suggest existence of a higher organization level of transferases in the membrane of the trans-Golgi apparatus.", "journal": "J. Mol. Biol.", "date": "2015", "authors": "Hartmann-Fatu Cristina, Trusch Franziska, Moll Carina N, Michin Irina, Hassinen Antti, Kellokumpu Sakari, Bayer Peter", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "reference": [ { "type": "PubMed", "id": "25660941", "url": "https://glygen.org/publication/PubMed/25660941" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "O60507", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Tyrosylprotein sulfotransferase 1 expression is negatively correlated with cMet and lymph node metastasis in human lung cancer.", "journal": "Molecular medicine reports", "date": "2015", "authors": "Jiang Z, Zhu J, Ma Y, Hong C, Xiao S, Jin L", "evidence": [ { "database": "RefSeq", "id": "NP_003587", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003587" } ], "reference": [ { "type": "PubMed", "id": "26238632", "url": "https://glygen.org/publication/PubMed/26238632" } ] }, { "title": "Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1.", "journal": "Scientific reports", "date": "2017", "authors": "Tanaka S, Nishiyori T, Kojo H, Otsubo R, Tsuruta M, Kurogi K, Liu MC, Suiko M, Sakakibara Y, Kakuta Y", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "reference": [ { "type": "PubMed", "id": "28821720", "url": "https://glygen.org/publication/PubMed/28821720" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60507", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60507" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Thermolabile and thermostable human platelet phenol sulfotransferase. Substrate specificity and physical separation.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "1983", "authors": "Reiter C, Mwaluko G, Dunnette J, Van Loon J, Weinshilboum R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "6139755", "url": "https://glygen.org/publication/PubMed/6139755" } ] }, { "title": "Radioenzymatic assay of sulfate conjugates of catecholamines and DOPA in plasma.", "journal": "Life sciences", "date": "1980", "authors": "Johnson GA, Baker CA, Smith RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "6770210", "url": "https://glygen.org/publication/PubMed/6770210" } ] }, { "title": "Cloning and expression of human liver dehydroepiandrosterone sulphotransferase.", "journal": "The Biochemical journal", "date": "1993", "authors": "Comer KA, Falany JL, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "7678732", "url": "https://glygen.org/publication/PubMed/7678732" } ] }, { "title": "Bacterial expression and characterization of a cDNA for human liver estrogen sulfotransferase.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1995", "authors": "Falany CN, Krasnykh V, Falany JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "7779757", "url": "https://glygen.org/publication/PubMed/7779757" } ] }, { "title": "Identification of individual tyrosine sulfation sites within factor VIII required for optimal activity and efficient thrombin cleavage.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Michnick DA, Pittman DD, Wise RJ, Kaufman RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "8051097", "url": "https://glygen.org/publication/PubMed/8051097" } ] }, { "title": "Human liver estrogen sulfotransferase: identification by cDNA cloning and expression.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Aksoy IA, Wood TC, Weinshilboum R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "8185618", "url": "https://glygen.org/publication/PubMed/8185618" } ] }, { "title": "cDNA cloning and expression of a new form of human aryl sulfotransferase.", "journal": "The international journal of biochemistry & cell biology", "date": "1996", "authors": "Zhu X, Veronese ME, Iocco P, McManus ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "8697101", "url": "https://glygen.org/publication/PubMed/8697101" } ] }, { "title": "Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1997", "authors": "Weinshilboum RM, Otterness DM, Aksoy IA, Wood TC, Her C, Raftogianis RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9034160", "url": "https://glygen.org/publication/PubMed/9034160" } ] }, { "title": "Expression and characterization of a novel thyroid hormone-sulfating form of cytosolic sulfotransferase from human liver.", "journal": "Molecular pharmacology", "date": "1998", "authors": "Wang J, Falany JL, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9463486", "url": "https://glygen.org/publication/PubMed/9463486" } ] }, { "title": "Tyrosylprotein sulfotransferase: purification and molecular cloning of an enzyme that catalyzes tyrosine O-sulfation, a common posttranslational modification of eukaryotic proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ouyang Yb, Lane WS, Moore KL", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" }, { "database": "Reactome", "id": "R-HSA-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841" } ], "reference": [ { "type": "PubMed", "id": "9501187", "url": "https://glygen.org/publication/PubMed/9501187" } ] }, { "title": "Structural and functional characterisation of human sulfotransferases.", "journal": "Chemico-biological interactions", "date": "1998", "authors": "Brix LA, Nicoll R, Zhu X, McManus ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9566739", "url": "https://glygen.org/publication/PubMed/9566739" } ] }, { "title": "Molecular cloning and expression of human and mouse tyrosylprotein sulfotransferase-2 and a tyrosylprotein sulfotransferase homologue in Caenorhabditis elegans.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ouyang YB, Moore KL", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "reference": [ { "type": "PubMed", "id": "9733778", "url": "https://glygen.org/publication/PubMed/9733778" } ] }, { "title": "Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Sakakibara Y, Yanagisawa K, Katafuchi J, Ringer DP, Takami Y, Nakayama T, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9852044", "url": "https://glygen.org/publication/PubMed/9852044" } ] } ], "pathway": [ { "id": "hsa:8460", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8460", "resource": "KEGG Pathway" }, { "id": "R-HSA-156584", "name": "Cytosolic sulfonation of small molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584", "resource": "Reactome", "description": "Cytosolic sulfonation of small molecules" }, { "id": "R-HSA-163841", "name": "Gamma carboxylation, hypusinylation, hydroxylation, and arylsulfatase activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163841", "resource": "Reactome", "description": "Gamma carboxylation, hypusinylation, hydroxylation, and arylsulfatase activation" }, { "id": "R-HSA-9674519", "name": "Defective F8 sulfation at Y1699", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674519", "resource": "Reactome", "description": "Defective F8 sulfation at Y1699" } ], "orthologs": [ { "uniprot_canonical_ac": "O70281-1", "protein_name": "Protein-tyrosine sulfotransferase 1", "gene_name": "Tpst1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPARLENPKATVRAGLDIKANKTFTYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEVIVKHGEPAPYLCNKDPFALKSLTYLARLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLHIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKILENTRRVYKGEFQLPDFLKEKPQTEQVE", "length": 370 }, "evidence": [ { "id": "45916581", "url": "http://www.informatics.jax.org/homology/45916581", "database": "MGI" }, { "id": "O60507", "url": "https://omabrowser.org/oma/group/O60507/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q3KR92-1", "protein_name": "Protein-tyrosine sulfotransferase 1", "gene_name": "Tpst1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPARLENPKATVRTGLDIKANKTFTYHKNMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEVIVKHGEPAPYLCNKDPFALKSLTYLARLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLHIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKILENTRRVHKGEFQLPDFLKEKPQTEQVE", "length": 370 }, "evidence": [ { "id": "45916581", "url": "http://www.informatics.jax.org/homology/45916581", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein-tyrosine sulfotransferase activity", "id": "GO:0008476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008476", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" }, { "name": "3'-phosphoadenosine 5'-phosphosulfate metabolic process", "id": "GO:0050427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050427", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" }, { "name": "peptidyl-tyrosine sulfation", "id": "GO:0006478", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006478", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 262, "end_pos": 264, "annotation": "n_glycosylation_sequon" }, { "start_pos": 60, "end_pos": 62, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "O60507", "url": "https://www.uniprot.org/uniprot/O60507" }, { "database": "PubMed", "id": "16859706", "url": "https://glygen.org/publication/PubMed/16859706" }, { "database": "PubMed", "id": "9501187", "url": "https://glygen.org/publication/PubMed/9501187" } ] } ], "interactions": [], "reactions": [ { "id": "16801", "name": "", "equation": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q3KR92-1", "Q5RJS8-1", "O60704-1", "O60507-1", "O70281-1", "O88856-1", "Q9VYB7-1" ], "evidence": [ { "id": "16801", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16801" } ] }, { "id": "R-HSA-8954262", "name": "TPST1,2 transfer SO4(2-) from PAPS to PODXL2", "equation": "", "summary": "Podocalyxin-like protein 2 (PODXL2 aka endoglycan) acts as a ligand for vascular selectins which mediate the rapid rolling of leukocytes over vascular surfaces. PODXL2 interacts with selectins through sulfation on two tyrosine residues (97 and 118) (Fieger et al. 2003, Kerr et al. 2008) and O-linked carbohydrate structures within its acidic amino-terminal region (latter not shown here). Protein-tyrosine sulfotransferases 1 and 2 (TPST1 and TPST2) are Golgi membrane-resident proteins which catalyse the transfer of sulfate from 3'-phospho-5'-adenylyl sulfate (PAPS) to tyrosine residues within acidic motifs of polypeptides such as PODXL2 (Ouyang et al. 1998, Danan et al. 2008, Teramoto et al. 2013).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-HSA-8954248" ], "output_participant_list": [ "R-HSA-8954273" ], "enzyme_list": [ "O60704-1", "O60507-1" ], "evidence": [ { "id": "R-HSA-8954262", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8954262" } ] }, { "id": "R-HSA-9668023", "name": "TPST1,2 transfer SO4(2-) from PAPS to FVIII", "equation": "", "summary": "Post-translational cellular processing of the factor VIII (FVIII or F8) precursor enables O-sulfation of tyrosine residues (Pittman DD et al. 1992; Michnick DA et al. 1994). Biochemical characterization demonstrated that recombinant human FVIII when metabolically labeled with [35S]-sulfate upon expression in Chinese hamster ovary (CHO) cells or monkey kidney tissue COS-1 cells contains six potential tyrosine sulfation sites, ie, four on the heavy chain (at amino acid residues 365, 737, 738, and 742) and two in the a3 subdomain of the light chain (residues 1683 and 1699) (Pittman DD et al. 1992; Michnick DA et al. 1994). The presence of six tyrosine sulfate residues in FVIII was further confirmed by a combination of liquid chromatography and electrospray ionization mass spectrometry (LC/ESI-MS) studies of the recombinant human FVIII protein derived from baby hamster kidney (BHK) cells (Severs JC et al. 1999) or CHO cells (Schmidbauer S et al. 2015). Site-directed mutagenesis of individual or multiple tyrosine residues showed that all the six sulfation sites are required to modulate FVIII activity (Pittman DD et al. 1992; Michnick DA et al. 1994). Further, treatment of CHO cells that express FVIII with sodium chlorate, an inhibitor of ATP sulphurylase involved in the synthesis of PAPS, did not affect FVIII secretion, but reduced the functional activity by 5-fold, indicating that sulfation was not required for FVIII secretion (Pittman DD et al. 1992). In addition, mutagenesis of Tyr1699 to Phe (Y1699F) demonstrated that sulfation at that residue was required for high affinity interaction of FVIII with von Willebrand factor (vWF) (Leyte A et al. 1991). In the absence of tyrosine sulfation at 1699 in FVIII, the affinity for vWF was reduced by 5-fold (Leyte A et al. 1991). The nuclear magnetic resonance (NMR) spectrum studies of the complex between FVIII and vWF showed significantly larger residue-specific chemical shift changes when Y1699 was sulfated further highlighting the importance of FVIII sulfation at Y1699 for the binding affinity to vWF (Dagil L et al. 2019). The significance of FVIII sulfation at Y1699 in vivo is made evident by the presence of a Y1699F mutation that causes a moderate hemophilia A, likely due to reduced interaction with vWF and decreased plasma half-life (Higuchi M et al. 1990; van den Biggelaar M et al. 2011). Sulfation at tyrosine residues 365 and 1683 increased FVIII activity by increasing the rate of thrombin cleavage at the adjacent thrombin cleavage sites 391 and 1708, respectively (Michnick DA et al. 1994). Mutation of tyrosine residues 737, 738, and 742 had no effect on the thromhin activation rate, even though the cleavage rate at Arg759 was slightly reduced (Michnick et al. 1994). Further. lower FXa-generation activity (86% of the wild-type activity) and lower clotting activity (51% of the wild-type activity) was observed for the FVIII triple point mutant at Tyr residues 737, 738, and 742 (Michnick et al. 1994). This result is in contrast to other study in which no functional differences were found between full-length FVIIl lacking sulfation at one or more of these three residues (Y737, Y738, and Y742) and the fully sulfated form of FVIII (Mikkelsen J et al. 1991).

Protein tyrosine O-sulfation is a common post-translational modification that is catalyzed by a tyrosyl protein sulfotransferase (TPST) (Moore KL 2003; Yang YS et al. 2015). In humans, two TPST isoforms, termed TPST1 and TPST2, have been identified (Ouyang Yb et al. 1998; Mishiro E et al. 2006). The enzyme was shown to catalyze the transfer of sulfate from the universal sulfate donor adenosine 3\u2032-phosphate 5\u2032-phosphosulfate (PAPS) to the hydroxyl group of a peptidyltyrosine residue to form a tyrosine O4-sulfate ester and 3\u2032,5\u2032-ADP (Lee RW & Huttner WB 1983). Structural studies showed that human TPSTs share the same catalytic mechanism (Teramoto T et al. 2013; Tanaka S et al. 2017). In mammalian cells, tyrosine O-sulfation of membrane and secretory proteins was found to occur in the trans-Golgi network, and biochemical studies indicated that the enzyme was membrane-bound (Lee RW & Huttner WB 1985; Baeuerle PA & Huttner WB 1987).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-HSA-9668037" ], "output_participant_list": [ "R-ALL-742343", "R-HSA-9668036" ], "enzyme_list": [ "O60704-1", "O60507-1" ], "evidence": [ { "id": "R-HSA-9668023", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9668023" } ] }, { "id": "R-HSA-9668148", "name": "F8 variant is not sulfonated at Y1699", "equation": "", "summary": "Post-translational cellular processing of the factor VIII (FVIII or F8) precursor enables O-sulfation of tyrosine residues (Pittman DD et al. 1992; Michnick DA et al. 1994). Biochemical and structural studies demonstrated that human FVIII contains six potential tyrosine sulfation sites on the FVIII molecule, ie, four on the heavy chain (at amino acid residues 365, 737, 738, and 742) and two in the a3 subdomain of the light chain (residues 1683 and 1699) (Pittman DD et al. 1992; Michnick DA et al. 1994; Severs JC et al. 1999; Schmidbauer S et al. 2015). Site-directed mutagenesis of individual or multiple tyrosine residues showed that all the six sulfation sites are required to modulate FVIII activity (Pittman DD et al. 1992; Michnick DA et al. 1994). Further, mutagenesis of Tyr1699 to Phe (Y1699F) demonstrated that sulfation at that residue was required for high affinity interaction of FVIII with von Willebrand factor (vWF) (Leyte A et al. 1991). In the absence of tyrosine sulfation at 1699 in FVIII, the affinity for vWF was reduced by 5-fold (Leyte A et al. 1991). Nuclear magnetic resonance (NMR) spectrum studies of the complex between FVIII and vWF showed significantly larger residue-specific chemical shift changes when Y1699 was sulfated further highlighting the importance of FVIII sulfation at Y1699 for the binding affinity to vWF (Dagil L et al. 2019). The significance of the sulfation of FVIII at Y1699 in vivo is made evident by the presence of a Y1699F mutation that causes a moderate hemophilia A, likely due to reduced interaction with vWF and decreased plasma half-life (Higuchi M et al. 1990; van den Biggelaar M et al. 2011). The Reactome event describes defective O-sulfation of FVIII precursor due to mutation at Y1699.", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O60704-1", "O60507-1" ], "evidence": [ { "id": "R-HSA-9668148", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9668148" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-742343", "participant_name": "PAP [Golgi lumen]", "crossref": [ { "id": "C00054", "database": "COMPOUND", "url": "" }, { "id": "58343", "database": "ChEBI", "url": "" }, { "id": "000004228234", "database": "ZINC", "url": "" }, { "id": "C00054", "database": "COMPOUND", "url": "" }, { "id": "000004228234", "database": "ZINC", "url": "" }, { "id": "58343", "database": "ChEBI", "url": "" }, { "id": "C00054", "database": "COMPOUND", "url": "" }, { "id": "000004228234", "database": "ZINC", "url": "" }, { "id": "58343", "database": "ChEBI", "url": "" }, { "id": "000004228234", "database": "ZINC", "url": "" }, { "id": "C00054", "database": "COMPOUND", "url": "" }, { "id": "58343", "database": "ChEBI", "url": "" }, { "id": "C00054", "database": "COMPOUND", "url": "" }, { "id": "58343", "database": "ChEBI", "url": "" }, { "id": "000004228234", "database": "ZINC", "url": "" }, { "id": "C00054", "database": "COMPOUND", "url": "" }, { "id": "58343", "database": "ChEBI", "url": "" }, { "id": "000004228234", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-HSA-8954248", "participant_name": "PODXL2 [Golgi lumen]", "crossref": [ { "id": "Q9NZ53", "database": "UniProt", "url": "" }, { "id": "ENSG00000114631", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000345359", "database": "Ensembl", "url": "" }, { "id": "Q9NZ53", "database": "GeneCards", "url": "" }, { "id": "Q9NZ53", "database": "Pharos - Targets", "url": "" }, { "id": "ENSG00000114631", "database": "Ensembl", "url": "" }, { "id": "NP_056535.1", "database": "RefSeq", "url": "" }, { "id": "ENST00000342480", "database": "Ensembl", "url": "" }, { "id": "ENSG00000114631-PODXL2", "database": "HPA", "url": "" }, { "id": "Q9NZ53", "database": "PRO", "url": "" } ] }, { "participant_id": "R-HSA-8954273", "participant_name": "OSulf-Y97,118-PODXL2 [Golgi lumen]", "crossref": [ { "id": "NP_056535.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000345359", "database": "Ensembl", "url": "" }, { "id": "Q9NZ53", "database": "UniProt", "url": "" }, { "id": "ENSG00000114631-PODXL2", "database": "HPA", "url": "" }, { "id": "Q9NZ53", "database": "Pharos - Targets", "url": "" }, { "id": "Q9NZ53", "database": "PRO", "url": "" }, { "id": "Q9NZ53", "database": "GeneCards", "url": "" }, { "id": "ENST00000342480", "database": "Ensembl", "url": "" }, { "id": "ENSG00000114631", "database": "OpenTargets", "url": "" }, { "id": "ENSG00000114631", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-9668036", "participant_name": "OSulf-6Y-FVIII precursor [Golgi lumen]", "crossref": [ { "id": "ENST00000360256", "database": "Ensembl", "url": "" }, { "id": "NP_063916.1", "database": "RefSeq", "url": "" }, { "id": "3J2Q", "database": "PDB", "url": "" }, { "id": "6MF2", "database": "PDB", "url": "" }, { "id": "ENSG00000185010", "database": "OpenTargets", "url": "" }, { "id": "P00451", "database": "UniProt", "url": "" }, { "id": "ENSP00000327895", "database": "Ensembl", "url": "" }, { "id": "ENSG00000185010-F8", "database": "HPA", "url": "" }, { "id": "7KWO", "database": "PDB", "url": "" }, { "id": "1IQD", "database": "PDB", "url": "" }, { "id": "2R7E", "database": "PDB", "url": "" }, { "id": "1FAC", "database": "PDB", "url": "" }, { "id": "7KBT", "database": "PDB", "url": "" }, { "id": "4KI5", "database": "PDB", "url": "" }, { "id": "FA8_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "7K66", "database": "PDB", "url": "" }, { "id": "HMDBP01727", "database": "HMDB Protein", "url": "" }, { "id": "ENSG00000185010", "database": "Ensembl", "url": "" }, { "id": "P00451", "database": "ZINC target", "url": "" }, { "id": "1D7P", "database": "PDB", "url": "" }, { "id": "P00451", "database": "PRO", "url": "" }, { "id": "5K8D", "database": "PDB", "url": "" }, { "id": "2607", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "16016", "database": "Orphanet", "url": "" }, { "id": "FA8_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "3J2S", "database": "PDB", "url": "" }, { "id": "NP_000123.1", "database": "RefSeq", "url": "" }, { "id": "P00451", "database": "GeneCards", "url": "" }, { "id": "ENST00000330287", "database": "Ensembl", "url": "" }, { "id": "P00451", "database": "Pharos - Targets", "url": "" }, { "id": "4XZU", "database": "PDB", "url": "" }, { "id": "3HNB", "database": "PDB", "url": "" }, { "id": "8G6I", "database": "PDB", "url": "" }, { "id": "3CDZ", "database": "PDB", "url": "" }, { "id": "3HNY", "database": "PDB", "url": "" }, { "id": "ENSP00000353393", "database": "Ensembl", "url": "" }, { "id": "6MF0", "database": "PDB", "url": "" }, { "id": "1CFG", "database": "PDB", "url": "" }, { "id": "3HOB", "database": "PDB", "url": "" }, { "id": "4PT6", "database": "PDB", "url": "" }, { "id": "4BDV", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-9668037", "participant_name": "Factor VIII precursor [Golgi lumen]", "crossref": [ { "id": "P00451", "database": "UniProt", "url": "" }, { "id": "3HNB", "database": "PDB", "url": "" }, { "id": "7K66", "database": "PDB", "url": "" }, { "id": "NP_000123.1", "database": "RefSeq", "url": "" }, { "id": "6MF2", "database": "PDB", "url": "" }, { "id": "3CDZ", "database": "PDB", "url": "" }, { "id": "4KI5", "database": "PDB", "url": "" }, { "id": "16016", "database": "Orphanet", "url": "" }, { "id": "ENSG00000185010-F8", "database": "HPA", "url": "" }, { "id": "4PT6", "database": "PDB", "url": "" }, { "id": "ENSG00000185010", "database": "Ensembl", "url": "" }, { "id": "ENST00000330287", "database": "Ensembl", "url": "" }, { "id": "ENST00000360256", "database": "Ensembl", "url": "" }, { "id": "ENSP00000353393", "database": "Ensembl", "url": "" }, { "id": "1FAC", "database": "PDB", "url": "" }, { "id": "5K8D", "database": "PDB", "url": "" }, { "id": "1IQD", "database": "PDB", "url": "" }, { "id": "1CFG", "database": "PDB", "url": "" }, { "id": "1D7P", "database": "PDB", "url": "" }, { "id": "4XZU", "database": "PDB", "url": "" }, { "id": "ENSG00000185010", "database": "OpenTargets", "url": "" }, { "id": "8G6I", "database": "PDB", "url": "" }, { "id": "FA8_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "3J2S", "database": "PDB", "url": "" }, { "id": "ENSP00000327895", "database": "Ensembl", "url": "" }, { "id": "4BDV", "database": "PDB", "url": "" }, { "id": "HMDBP01727", "database": "HMDB Protein", "url": "" }, { "id": "P00451", "database": "GeneCards", "url": "" }, { "id": "NP_063916.1", "database": "RefSeq", "url": "" }, { "id": "3HNY", "database": "PDB", "url": "" }, { "id": "7KBT", "database": "PDB", "url": "" }, { "id": "2607", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "7KWO", "database": "PDB", "url": "" }, { "id": "3HOB", "database": "PDB", "url": "" }, { "id": "P00451", "database": "ZINC target", "url": "" }, { "id": "P00451", "database": "Pharos - Targets", "url": "" }, { "id": "3J2Q", "database": "PDB", "url": "" }, { "id": "6MF0", "database": "PDB", "url": "" }, { "id": "2R7E", "database": "PDB", "url": "" }, { "id": "FA8_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "P00451", "database": "PRO", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O60507", "gene_name": "TPST1", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O60507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60507" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O60507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60507" } ] } ] }, { "uniprot_ac": "O60704", "gene_name": "TPST2", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O60704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60704" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O60704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60704" } ] } ] }, { "uniprot_ac": "O70281", "gene_name": "Tpst1", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O70281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70281" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O70281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70281" } ] } ] }, { "uniprot_ac": "O88856", "gene_name": "Tpst2", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O88856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88856" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O88856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88856" } ] } ] }, { "uniprot_ac": "Q3KR92", "gene_name": "Tpst1", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "Q3KR92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3KR92" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "Q3KR92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3KR92" } ] } ] }, { "uniprot_ac": "Q5RJS8", "gene_name": "Tpst2", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "Q5RJS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJS8" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "Q5RJS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJS8" } ] } ] }, { "uniprot_ac": "Q9VYB7", "gene_name": "Tpst", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "Q9VYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYB7" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "Q9VYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYB7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 60, 262 ], "o_linked_sites": [ 44, 46, 47, 49, 50, 53, 197, 199, 286, 287 ], "snv_sites": [ 46, 49, 53, 60, 123, 178, 199, 286, 287 ], "glycation_sites": [], "phosphorylation_sites": [ 286 ], "sequon_annotation_sites": [ { "start_pos": 262, "end_pos": 264 }, { "start_pos": 60, "end_pos": 62 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 59 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }