{ "uniprot_canonical_ac": "O43924-1", "uniprot_ac": "O43924", "uniprot_id": "PDE6D_HUMAN", "mass": { "chemical_mass": 17420.0, "monoisotopic_mass": 17420.0 }, "refseq": { "ac": "NP_001277947", "name": "retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta isoform 2", "summary": "This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" }, "gene_names": [ { "name": "PDE6D", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43924", "id": "O43924" }, { "name": "JBTS22; PDED", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947", "id": "NP_001277947" }, { "name": "PDE6D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947", "id": "NP_001277947" }, { "name": "PDED", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43924", "id": "O43924" }, { "name": "hCG_32951", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43924", "id": "O43924" } ], "protein_names": [ { "name": "Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43924" }, { "name": "GMP-PDE delta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43924" }, { "name": "Protein p17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43924" }, { "name": "retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947", "id": "NP_001277947" }, { "name": "retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta; protein p17; GMP-PDE delta; phosphodiesterase 6D, cGMP-specific, rod, delta", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947", "id": "NP_001277947" } ], "function": [ { "annotation": "PDE6D Mediates Trafficking of Prenylated Proteins NIM1K and UBL3 to Primary Cilia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" }, { "database": "PubMed", "id": "36672247", "url": "https://glygen.org/publication/PubMed/36672247" } ] }, { "annotation": "Promotes the release of prenylated target proteins from cellular membranes (PubMed:9712853). Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location (PubMed:22002721, PubMed:23698361). Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E (PubMed:24166846). Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI) (By similarity). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924#function" }, { "database": "PubMed", "id": "23698361", "url": "https://glygen.org/publication/PubMed/23698361" }, { "database": "PubMed", "id": "9712853", "url": "https://glygen.org/publication/PubMed/9712853" }, { "database": "UniProtKB", "id": "O55057", "url": "https://www.uniprot.org/uniprot/O55057#function" }, { "database": "PubMed", "id": "22002721", "url": "https://glygen.org/publication/PubMed/22002721" }, { "database": "PubMed", "id": "23559067", "url": "https://glygen.org/publication/PubMed/23559067" }, { "database": "PubMed", "id": "24166846", "url": "https://glygen.org/publication/PubMed/24166846" }, { "database": "PubMed", "id": "10518933", "url": "https://glygen.org/publication/PubMed/10518933" } ] }, { "annotation": "Study identifies PDE6D as a novel Joubert syndrome gene and provides the first evidence of prenyl-binding-dependent trafficking in ciliopathies.", "evidence": [ { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" }, { "database": "PubMed", "id": "24166846", "url": "https://glygen.org/publication/PubMed/24166846" } ] }, { "annotation": "This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" } ] }, { "annotation": "Validation of a small molecule inhibitor of PDE6D-RAS interaction with favorable anti-leukemic effects. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" }, { "database": "PubMed", "id": "35422065", "url": "https://glygen.org/publication/PubMed/35422065" } ] } ], "disease": [ { "disease_id": "DOID:0110991", "recommended_name": { "id": "DOID:0110991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110991", "name": "Joubert syndrome 22", "description": "A Joubert syndrome that has_material_basis_in homozygous mutation in the PDE6D gene on chromosome 2q37." }, "synonyms": [ { "id": "DOID:0110991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110991", "name": "JBTS22", "description": "" }, { "id": "MONDO:0014297", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014297", "name": "Joubert syndrome 22", "description": "Any Joubert syndrome in which the cause of the disease is a mutation in the PDE6D gene." }, { "id": "MONDO:0014297", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014297", "name": "JBTS22", "description": "" }, { "id": "MONDO:0014297", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014297", "name": "Joubert syndrome 22", "description": "" }, { "id": "MONDO:0014297", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014297", "name": "Joubert syndrome caused by mutation in PDE6D", "description": "" }, { "id": "MONDO:0014297", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014297", "name": "Joubert syndrome type 22", "description": "" }, { "id": "MONDO:0014297", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014297", "name": "PDE6D Joubert syndrome", "description": "" }, { "id": "MIM:615665", "resource": "MIM", "url": "https://www.omim.org/entry/615665", "name": "Joubert syndrome 22", "description": "Joubert syndrome 22" } ], "evidence": [ { "id": "615665", "database": "MIM", "url": "https://www.omim.org/entry/615665" } ] } ], "snv": [ { "evidence": [ { "id": "O43924", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43924" } ], "glycoeffect": [], "start_pos": 75, "end_pos": 75, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "231738055", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R75", "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "76.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "76.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "82.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "76.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "88.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "88.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "74.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "82.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "72.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "80.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "84.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43924" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "common_name": "Human" } ], "gene": [ { "name": "PDE6D", "url": "https://www.uniprot.org/uniprot/O43924", "locus": { "chromosome": "2", "start_pos": 231732433, "end_pos": 231786272, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000156973", "url": "https://www.ensembl.org/id/ENSG00000156973" } ] } } ], "crossref": [ { "id": "ENSG00000156973", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156973", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O43924", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43924", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL3860", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3860", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PDE6D", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PDE6D", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5147", "url": "https://www.ncbi.nlm.nih.gov/gene/5147", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8788", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8788", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43924", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43924*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008015", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008015", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017287", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017287", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037036", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037036", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5147", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5147", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602676", "url": "http://www.omim.org/entry/602676", "database": "MIM", "categories": [ "Other" ] }, { "id": "615665", "url": "http://www.omim.org/entry/615665", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43924", "url": "https://www.nextprot.org/entry/NX_O43924", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "STNTWQN", "url": "https://omabrowser.org/oma/group/STNTWQN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1330790at2759", "url": "http://www.orthodb.org/?query=1330790at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12976", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12976", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12976:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12976:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1KSG", "url": "https://www.rcsb.org/structure/1KSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KSH", "url": "https://www.rcsb.org/structure/1KSH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KSJ", "url": "https://www.rcsb.org/structure/1KSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3T5G", "url": "https://www.rcsb.org/structure/3T5G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3T5I", "url": "https://www.rcsb.org/structure/3T5I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JHP", "url": "https://www.rcsb.org/structure/4JHP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JV6", "url": "https://www.rcsb.org/structure/4JV6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JV8", "url": "https://www.rcsb.org/structure/4JV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JVB", "url": "https://www.rcsb.org/structure/4JVB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JVF", "url": "https://www.rcsb.org/structure/4JVF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5E80", "url": "https://www.rcsb.org/structure/5E80", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5E8F", "url": "https://www.rcsb.org/structure/5E8F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5F2U", "url": "https://www.rcsb.org/structure/5F2U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ML2", "url": "https://www.rcsb.org/structure/5ML2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ML3", "url": "https://www.rcsb.org/structure/5ML3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ML4", "url": "https://www.rcsb.org/structure/5ML4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ML6", "url": "https://www.rcsb.org/structure/5ML6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ML8", "url": "https://www.rcsb.org/structure/5ML8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NAL", "url": "https://www.rcsb.org/structure/5NAL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TAR", "url": "https://www.rcsb.org/structure/5TAR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TB5", "url": "https://www.rcsb.org/structure/5TB5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X72", "url": "https://www.rcsb.org/structure/5X72", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X73", "url": "https://www.rcsb.org/structure/5X73", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X74", "url": "https://www.rcsb.org/structure/5X74", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YAV", "url": "https://www.rcsb.org/structure/5YAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YAW", "url": "https://www.rcsb.org/structure/5YAW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PAC", "url": "https://www.rcsb.org/structure/7PAC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PAD", "url": "https://www.rcsb.org/structure/7PAD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PAE", "url": "https://www.rcsb.org/structure/7PAE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q9Q", "url": "https://www.rcsb.org/structure/7Q9Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q9R", "url": "https://www.rcsb.org/structure/7Q9R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q9S", "url": "https://www.rcsb.org/structure/7Q9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q9U", "url": "https://www.rcsb.org/structure/7Q9U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QF9", "url": "https://www.rcsb.org/structure/7QF9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QJK", "url": "https://www.rcsb.org/structure/7QJK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05351", "url": "http://pfam.xfam.org/family/PF05351", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43924", "url": "https://pharos.nih.gov/targets/O43924", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43924", "url": "http://purl.obolibrary.org/obo/PR_O43924", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5624958", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5624958", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8ZZK5", "url": "https://www.uniprot.org/uniprot/B8ZZK5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8ZZK5-1", "url": "https://www.uniprot.org/uniprot/B8ZZK5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9IZ52", "url": "https://www.uniprot.org/uniprot/C9IZ52", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9IZ52-1", "url": "https://www.uniprot.org/uniprot/C9IZ52-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43924-1", "url": "https://www.uniprot.org/uniprot/O43924-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV", "length": 150, "header": "sp|O43924-1|PDE6D_HUMAN Isoform 1 of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1 CANONICAL=O43924-1" }, "isoforms": [ { "isoform_ac": "B8ZZK5-1", "url": "", "sequence": { "sequence": "MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEVGTLS", "length": 93, "header": "tr|B8ZZK5-1|PDE6D_HUMAN Computationally mapped isoform of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1 CANONICAL=O43924-1" }, "locus": { "chromosome": "2", "start_pos": 231781114, "end_pos": 231733020, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409772.5", "url": "https://www.ensembl.org/id/ENST00000409772.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000387108.1", "url": "https://www.ensembl.org/id/ENSP00000387108.1" } ] } }, { "isoform_ac": "C9IZ52-1", "url": "", "sequence": { "sequence": "MNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVL", "length": 104, "header": "tr|C9IZ52-1|C9IZ52_HUMAN Computationally mapped isoform of Phosphodiesterase 6D OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=9 CANONICAL=O43924-1" }, "locus": { "chromosome": "2", "start_pos": 231739181, "end_pos": 231737189, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000428104.2", "url": "https://www.ensembl.org/id/ENST00000428104.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000399098.2", "url": "https://www.ensembl.org/id/ENSP00000399098.2" } ] } }, { "isoform_ac": "O43924-1", "url": "", "sequence": { "sequence": "MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV", "length": 150, "header": "sp|O43924-1|PDE6D_HUMAN Isoform 1 of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1 CANONICAL=O43924-1" }, "locus": { "chromosome": "2", "start_pos": 231781114, "end_pos": 231732955, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000287600.9", "url": "https://www.ensembl.org/id/ENST00000287600.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000287600.4", "url": "https://www.ensembl.org/id/ENSP00000287600.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Cloning and characterization of a mammalian prenyl protein-specific protease.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Otto JC, Kim E, Young SG, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "10085068", "url": "https://glygen.org/publication/PubMed/10085068" } ] }, { "title": "Disruption of the mouse Rce1 gene results in defective Ras processing and mislocalization of Ras within cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kim E, Ambroziak P, Otto JC, Taylor B, Ashby M, Shannon K, Casey PJ, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "10085069", "url": "https://glygen.org/publication/PubMed/10085069" } ] }, { "title": "The delta subunit of rod specific cyclic GMP phosphodiesterase, PDE delta, interacts with the Arf-like protein Arl3 in a GTP specific manner.", "journal": "FEBS letters", "date": "1999", "authors": "Linari M, Hanzal-Bayer M, Becker J", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "10518933", "url": "https://glygen.org/publication/PubMed/10518933" } ] }, { "title": "Selective inhibition of ras-transformed cell growth by a novel fatty acid-based chloromethyl ketone designed to target Ras endoprotease.", "journal": "Annals of the New York Academy of Sciences", "date": "1999", "authors": "Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "10667208", "url": "https://glygen.org/publication/PubMed/10667208" } ] }, { "title": "Human ras-converting enzyme (hRCE1) endoproteolytic activity on K-ras-derived peptides.", "journal": "Analytical biochemistry", "date": "2000", "authors": "Hollander I, Frommer E, Mallon R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11038283", "url": "https://glygen.org/publication/PubMed/11038283" } ] }, { "title": "The farnesyl transferase inhibitor SCH 66336 induces a G(2) --> M or G(1) pause in sensitive human tumor cell lines.", "journal": "Experimental cell research", "date": "2001", "authors": "Ashar HR, James L, Gray K, Carr D, McGuirk M, Maxwell E, Black S, Armstrong L, Doll RJ, Taveras AG, Bishop WR, Kirschmeier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11120601", "url": "https://glygen.org/publication/PubMed/11120601" } ] }, { "title": "Characterization of the antitumor effects of the selective farnesyl protein transferase inhibitor R115777 in vivo and in vitro.", "journal": "Cancer research", "date": "2001", "authors": "End DW, Smets G, Todd AV, Applegate TL, Fuery CJ, Angibaud P, Venet M, Sanz G, Poignet H, Skrzat S, Devine A, Wouters W, Bowden C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11196150", "url": "https://glygen.org/publication/PubMed/11196150" } ] }, { "title": "Calmodulin binds to K-Ras, but not to H- or N-Ras, and modulates its downstream signaling.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Villalonga P, Lopez-Alcala C, Bosch M, Chiloeches A, Rocamora N, Gil J, Marais R, Marshall CJ, Bachs O, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11585916", "url": "https://glygen.org/publication/PubMed/11585916" } ] }, { "title": "Absence of the CAAX endoprotease Rce1: effects on cell growth and transformation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Bergo MO, Ambroziak P, Gregory C, George A, Otto JC, Kim E, Nagase H, Casey PJ, Balmain A, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11739732", "url": "https://glygen.org/publication/PubMed/11739732" } ] }, { "title": "The complex of Arl2-GTP and PDE delta: from structure to function.", "journal": "EMBO J.", "date": "2002", "authors": "Hanzal-Bayer M, Renault L, Roversi P, Wittinghofer A, Hillig RC", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "11980706", "url": "https://glygen.org/publication/PubMed/11980706" } ] }, { "title": "Hematologic effects of inactivating the Ras processing enzyme Rce1.", "journal": "Blood", "date": "2003", "authors": "Aiyagari AL, Taylor BR, Aurora V, Young SG, Shannon KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "12433685", "url": "https://glygen.org/publication/PubMed/12433685" } ] }, { "title": "Ca2+/calmodulin binds and dissociates K-RasB from membrane.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Sidhu RS, Clough RR, Bhullar RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "12727204", "url": "https://glygen.org/publication/PubMed/12727204" } ] }, { "title": "Targeting Ras signaling through inhibition of carboxyl methylation: an unexpected property of methotrexate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Winter-Vann AM, Kamen BA, Bergo MO, Young SG, Melnyk S, James SJ, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "12750467", "url": "https://glygen.org/publication/PubMed/12750467" } ] }, { "title": "Photoreceptor cGMP phosphodiesterase delta subunit (PDEdelta) functions as a prenyl-binding protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zhang H, Liu XH, Zhang K, Chen CK, Frederick JM, Prestwich GD, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "14561760", "url": "https://glygen.org/publication/PubMed/14561760" } ] }, { "title": "Carboxyl methylation of Ras regulates membrane targeting and effector engagement.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chiu VK, Silletti J, Dinsell V, Wiener H, Loukeris K, Ou G, Philips MR, Pillinger MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "14660603", "url": "https://glygen.org/publication/PubMed/14660603" } ] }, { "title": "Inactivation of Icmt inhibits transformation by oncogenic K-Ras and B-Raf.", "journal": "The Journal of clinical investigation", "date": "2004", "authors": "Bergo MO, Gavino BJ, Hong C, Beigneux AP, McMahon M, Casey PJ, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "14966563", "url": "https://glygen.org/publication/PubMed/14966563" } ] }, { "title": "Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Reid TS, Terry KL, Casey PJ, Beese LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "15451670", "url": "https://glygen.org/publication/PubMed/15451670" } ] }, { "title": "Postprenylation CAAX processing is required for proper localization of Ras but not Rho GTPases.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Michaelson D, Ali W, Chiu VK, Bergo M, Silletti J, Wright L, Young SG, Philips M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "15659645", "url": "https://glygen.org/publication/PubMed/15659645" } ] }, { "title": "DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Swarthout JT, Lobo S, Farh L, Croke MR, Greentree WK, Deschenes RJ, Linder ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "16000296", "url": "https://glygen.org/publication/PubMed/16000296" } ] }, { "title": "Reversible intracellular translocation of KRas but not HRas in hippocampal neurons regulated by Ca2+/calmodulin.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Fivaz M, Meyer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "16043511", "url": "https://glygen.org/publication/PubMed/16043511" } ] }, { "title": "PKC regulates a farnesyl-electrostatic switch on K-Ras that promotes its association with Bcl-XL on mitochondria and induces apoptosis.", "journal": "Molecular cell", "date": "2006", "authors": "Bivona TG, Quatela SE, Bodemann BO, Ahearn IM, Soskis MJ, Mor A, Miura J, Wiener HH, Wright L, Saba SG, Yim D, Fein A, Perez de Castro I, Li C, Thompson CB, Cox AD, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "16483930", "url": "https://glygen.org/publication/PubMed/16483930" } ] }, { "title": "Identification of essential interacting elements in K-Ras/calmodulin binding and its role in K-Ras localization.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lopez-Alcala C, Alvarez-Moya B, Villalonga P, Calvo M, Bachs O, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "18182391", "url": "https://glygen.org/publication/PubMed/18182391" } ] }, { "title": "Inactivating Icmt ameliorates K-RAS-induced myeloproliferative disease.", "journal": "Blood", "date": "2008", "authors": "Wahlstrom AM, Cutts BA, Liu M, Lindskog A, Karlsson C, Sjogren AK, Andersson KM, Young SG, Bergo MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "18502828", "url": "https://glygen.org/publication/PubMed/18502828" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "INPP5E mutations cause primary cilium signaling defects, ciliary instability and ciliopathies in human and mouse.", "journal": "Nature genetics", "date": "2009", "authors": "Jacoby M, Cox JJ, Gayral S, Hampshire DJ, Ayub M, Blockmans M, Pernot E, Kisseleva MV, Compere P, Schiffmann SN, Gergely F, Riley JH, Perez-Morga D, Woods CG, Schurmans S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5624958", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5624958" } ], "reference": [ { "type": "PubMed", "id": "19668215", "url": "https://glygen.org/publication/PubMed/19668215" } ] }, { "title": "Mutations in INPP5E, encoding inositol polyphosphate-5-phosphatase E, link phosphatidyl inositol signaling to the ciliopathies.", "journal": "Nature genetics", "date": "2009", "authors": "Bielas SL, Silhavy JL, Brancati F, Kisseleva MV, Al-Gazali L, Sztriha L, Bayoumi RA, Zaki MS, Abdel-Aleem A, Rosti RO, Kayserili H, Swistun D, Scott LC, Bertini E, Boltshauser E, Fazzi E, Travaglini L, Field SJ, Gayral S, Jacoby M, Schurmans S, Dallapiccola B, Majerus PW, Valente EM, Gleeson JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5624958", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5624958" } ], "reference": [ { "type": "PubMed", "id": "19668216", "url": "https://glygen.org/publication/PubMed/19668216" } ] }, { "title": "The palmitoylation machinery is a spatially organizing system for peripheral membrane proteins.", "journal": "Cell", "date": "2010", "authors": "Rocks O, Gerauer M, Vartak N, Koch S, Huang ZP, Pechlivanis M, Kuhlmann J, Brunsveld L, Chandra A, Ellinger B, Waldmann H, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20416930", "url": "https://glygen.org/publication/PubMed/20416930" } ] }, { "title": "Small-molecule inhibition of APT1 affects Ras localization and signaling.", "journal": "Nature chemical biology", "date": "2010", "authors": "Dekker FJ, Rocks O, Vartak N, Menninger S, Hedberg C, Balamurugan R, Wetzel S, Renner S, Gerauer M, Scholermann B, Rusch M, Kramer JW, Rauh D, Coates GW, Brunsveld L, Bastiaens PI, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20418879", "url": "https://glygen.org/publication/PubMed/20418879" } ] }, { "title": "Inhibition of isoprenylcysteine carboxylmethyltransferase induces autophagic-dependent apoptosis and impairs tumor growth.", "journal": "Oncogene", "date": "2010", "authors": "Wang M, Hossain MS, Tan W, Coolman B, Zhou J, Liu S, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20622895", "url": "https://glygen.org/publication/PubMed/20622895" } ] }, { "title": "K-Ras4B phosphorylation at Ser181 is inhibited by calmodulin and modulates K-Ras activity and function.", "journal": "Oncogene", "date": "2010", "authors": "Alvarez-Moya B, Lopez-Alcala C, Drosten M, Bachs O, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20802526", "url": "https://glygen.org/publication/PubMed/20802526" } ] }, { "title": "Endocytic sorting and recycling require membrane phosphatidylserine asymmetry maintained by TAT-1/CHAT-1.", "journal": "PLoS genetics", "date": "2010", "authors": "Chen B, Jiang Y, Zeng S, Yan J, Li X, Zhang Y, Zou W, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21170358", "url": "https://glygen.org/publication/PubMed/21170358" } ] }, { "title": "Discovery and SAR of methylated tetrahydropyranyl derivatives as inhibitors of isoprenylcysteine carboxyl methyltransferase (ICMT).", "journal": "Journal of medicinal chemistry", "date": "2011", "authors": "Judd WR, Slattum PM, Hoang KC, Bhoite L, Valppu L, Alberts G, Brown B, Roth B, Ostanin K, Huang L, Wettstein D, Richards B, Willardsen JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21661760", "url": "https://glygen.org/publication/PubMed/21661760" } ] }, { "title": "Therapeutic strategies for targeting ras proteins.", "journal": "Genes & cancer", "date": "2011", "authors": "Gysin S, Salt M, Young A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21779505", "url": "https://glygen.org/publication/PubMed/21779505" } ] }, { "title": "Development of highly potent inhibitors of the Ras-targeting human acyl protein thioesterases based on substrate similarity design.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2011", "authors": "Hedberg C, Dekker FJ, Rusch M, Renner S, Wetzel S, Vartak N, Gerding-Reimers C, Bon RS, Bastiaens PI, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21905185", "url": "https://glygen.org/publication/PubMed/21905185" } ] }, { "title": "Identification of acyl protein thioesterases 1 and 2 as the cellular targets of the Ras-signaling modulators palmostatin B and M.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2011", "authors": "Rusch M, Zimmermann TJ, Burger M, Dekker FJ, Gormer K, Triola G, Brockmeyer A, Janning P, Bottcher T, Sieber SA, Vetter IR, Hedberg C, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21905186", "url": "https://glygen.org/publication/PubMed/21905186" } ] }, { "title": "Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.", "journal": "Nature chemical biology", "date": "2011", "authors": "Ismail SA, Chen YX, Rusinova A, Chandra A, Bierbaum M, Gremer L, Triola G, Waldmann H, Bastiaens PI, Wittinghofer A", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" }, { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22002721", "url": "https://glygen.org/publication/PubMed/22002721" } ] }, { "title": "Inhibiting the palmitoylation/depalmitoylation cycle selectively reduces the growth of hematopoietic cells expressing oncogenic Nras.", "journal": "Blood", "date": "2012", "authors": "Xu J, Hedberg C, Dekker FJ, Li Q, Haigis KM, Hwang E, Waldmann H, Shannon K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22144181", "url": "https://glygen.org/publication/PubMed/22144181" } ] }, { "title": "The GDI-like solubilizing factor PDEdelta sustains the spatial organization and signalling of Ras family proteins.", "journal": "Nature cell biology", "date": "2011", "authors": "Chandra A, Grecco HE, Pisupati V, Perera D, Cassidy L, Skoulidis F, Ismail SA, Hedberg C, Hanzal-Bayer M, Venkitaraman AR, Wittinghofer A, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22179043", "url": "https://glygen.org/publication/PubMed/22179043" } ] }, { "title": "Mechanism of isoprenylcysteine carboxyl methylation from the crystal structure of the integral membrane methyltransferase ICMT.", "journal": "Molecular cell", "date": "2011", "authors": "Yang J, Kulkarni K, Manolaridis I, Zhang Z, Dodd RB, Mas-Droux C, Barford D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22195972", "url": "https://glygen.org/publication/PubMed/22195972" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "Dissociation of the K-Ras4B/PDEdelta complex upon contact with lipid membranes: membrane delivery instead of extraction.", "journal": "Journal of the American Chemical Society", "date": "2012", "authors": "Weise K, Kapoor S, Werkmuller A, Mobitz S, Zimmermann G, Triola G, Waldmann H, Winter R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22721555", "url": "https://glygen.org/publication/PubMed/22721555" } ] }, { "title": "ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Humbert MC, Weihbrecht K, Searby CC, Li Y, Pope RM, Sheffield VC, Seo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5624958", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5624958" } ], "reference": [ { "type": "PubMed", "id": "23150559", "url": "https://glygen.org/publication/PubMed/23150559" } ] }, { "title": "Functionalized indoleamines as potent, drug-like inhibitors of isoprenylcysteine carboxyl methyltransferase (Icmt).", "journal": "European journal of medicinal chemistry", "date": "2013", "authors": "Ramanujulu PM, Yang T, Yap SQ, Wong FC, Casey PJ, Wang M, Go ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "23514631", "url": "https://glygen.org/publication/PubMed/23514631" } ] }, { "title": "The interplay between RPGR, PDE\u03b4 and Arl2/3 regulate the ciliary targeting of farnesylated cargo.", "journal": "EMBO reports", "date": "2013-05", "authors": "W\u00e4tzlich Denise, Vetter Ingrid, Gotthardt Katja, Miertzschke Mandy, Chen Yong-Xiang, Wittinghofer Alfred, Ismail Shehab", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "23559067", "url": "https://glygen.org/publication/PubMed/23559067" } ] }, { "title": "Small molecule inhibition of the KRAS-PDEdelta interaction impairs oncogenic KRAS signalling.", "journal": "Nature", "date": "2013", "authors": "Zimmermann G, Papke B, Ismail S, Vartak N, Chandra A, Hoffmann M, Hahn SA, Triola G, Wittinghofer A, Bastiaens PI, Waldmann H", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" }, { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "23698361", "url": "https://glygen.org/publication/PubMed/23698361" } ] }, { "title": "Oncogenic K-ras segregates at spatially distinct plasma membrane signaling platforms according to its phosphorylation status.", "journal": "Journal of cell science", "date": "2013", "authors": "Barcelo C, Paco N, Beckett AJ, Alvarez-Moya B, Garrido E, Gelabert M, Tebar F, Jaumot M, Prior I, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "23943869", "url": "https://glygen.org/publication/PubMed/23943869" } ] }, { "title": "Marine natural products: bryostatins in preclinical and clinical studies.", "journal": "Pharmaceutical biology", "date": "2014", "authors": "Kollar P, Rajchard J, Balounova Z, Pazourek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "24033119", "url": "https://glygen.org/publication/PubMed/24033119" } ] }, { "title": "A homozygous PDE6D mutation in Joubert syndrome impairs targeting of farnesylated INPP5E protein to the primary cilium.", "journal": "Human mutation", "date": "2014", "authors": "Thomas S, Wright KJ, Le Corre S, Micalizzi A, Romani M, Abhyankar A, Saada J, Perrault I, Amiel J, Litzler J, Filhol E, Elkhartoufi N, Kwong M, Casanova JL, Boddaert N, Baehr W, Lyonnet S, Munnich A, Burglen L, Chassaing N, Encha-Ravazi F, Vekemans M, Gleeson JG, Valente EM, Jackson PK, Drummond IA, Saunier S, Attie-Bitach T", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" }, { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" } ], "reference": [ { "type": "PubMed", "id": "24166846", "url": "https://glygen.org/publication/PubMed/24166846" } ] }, { "title": "KRas localizes to the plasma membrane by spatial cycles of solubilization, trapping and vesicular transport.", "journal": "Cell", "date": "2014", "authors": "Schmick M, Vartak N, Papke B, Kovacevic M, Truxius DC, Rossmannek L, Bastiaens PIH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "24725411", "url": "https://glygen.org/publication/PubMed/24725411" } ] }, { "title": "An improved isoprenylcysteine carboxylmethyltransferase inhibitor induces cancer cell death and attenuates tumor growth in vivo.", "journal": "Cancer biology & therapy", "date": "2014", "authors": "Lau HY, Ramanujulu PM, Guo D, Yang T, Wirawan M, Casey PJ, Go ML, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "24971579", "url": "https://glygen.org/publication/PubMed/24971579" } ] }, { "title": "Membrane protein transport in photoreceptors: the function of PDEdelta: the Proctor lecture.", "journal": "Investigative ophthalmology & visual science", "date": "2014", "authors": "Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25550383", "url": "https://glygen.org/publication/PubMed/25550383" } ] }, { "title": "Mechanisms of membrane binding of small GTPase K-Ras4B farnesylated hypervariable region.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Jang H, Abraham SJ, Chavan TS, Hitchinson B, Khavrutskii L, Tarasova NI, Nussinov R, Gaponenko V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25713064", "url": "https://glygen.org/publication/PubMed/25713064" } ] }, { "title": "Ras moves to stay in place.", "journal": "Trends in cell biology", "date": "2015", "authors": "Schmick M, Kraemer A, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25759176", "url": "https://glygen.org/publication/PubMed/25759176" } ] }, { "title": "Ras activation revisited: role of GEF and GAP systems.", "journal": "Biological chemistry", "date": "2015", "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25781681", "url": "https://glygen.org/publication/PubMed/25781681" } ] }, { "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26085527", "url": "https://glygen.org/publication/PubMed/26085527" } ] }, { "title": "K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.", "journal": "Cell", "date": "2015", "authors": "Wang MT, Holderfield M, Galeas J, Delrosario R, To MD, Balmain A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26590425", "url": "https://glygen.org/publication/PubMed/26590425" } ] }, { "title": "All ras proteins are polyisoprenylated but only some are palmitoylated.", "journal": "Cell", "date": "1989", "authors": "Hancock JF, Magee AI, Childs JE, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "2661017", "url": "https://glygen.org/publication/PubMed/2661017" } ] }, { "title": "ABHD17 proteins are novel protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization.", "journal": "eLife", "date": "2015", "authors": "Lin DT, Conibear E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26701913", "url": "https://glygen.org/publication/PubMed/26701913" } ] }, { "title": "Inhibition of isoprenylcysteine carboxylmethyltransferase augments BCR-ABL1 tyrosine kinase inhibition-induced apoptosis in chronic myeloid leukemia.", "journal": "Experimental hematology", "date": "2016", "authors": "Sun WT, Xiang W, Ng BL, Asari K, Bunte RM, Casey PJ, Wang M, Chuah C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26706195", "url": "https://glygen.org/publication/PubMed/26706195" } ] }, { "title": "Acyl protein thioesterase 1 and 2 (APT-1, APT-2) inhibitors palmostatin B, ML348 and ML349 have different effects on NRAS mutant melanoma cells.", "journal": "Oncotarget", "date": "2016", "authors": "Vujic I, Sanlorenzo M, Esteve-Puig R, Vujic M, Kwong A, Tsumura A, Murphy R, Moy A, Posch C, Monshi B, Rappersberger K, Ortiz-Urda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26771141", "url": "https://glygen.org/publication/PubMed/26771141" } ] }, { "title": "p21ras is modified by a farnesyl isoprenoid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Casey PJ, Solski PA, Der CJ, Buss JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "2682646", "url": "https://glygen.org/publication/PubMed/2682646" } ] }, { "title": "Identification of pyrazolopyridazinones as PDEdelta inhibitors.", "journal": "Nature communications", "date": "2016", "authors": "Papke B, Murarka S, Vogel HA, Martin-Gago P, Kovacevic M, Truxius DC, Fansa EK, Ismail S, Zimmermann G, Heinelt K, Schultz-Fademrecht C, Al Saabi A, Baumann M, Nussbaumer P, Wittinghofer A, Waldmann H, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27094677", "url": "https://glygen.org/publication/PubMed/27094677" } ] }, { "title": "Drugging Ras GTPase: a comprehensive mechanistic and signaling structural view.", "journal": "Chemical Society reviews", "date": "2016", "authors": "Lu S, Jang H, Gu S, Zhang J, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27396271", "url": "https://glygen.org/publication/PubMed/27396271" } ] }, { "title": "Regulation of K-Ras4B Membrane Binding by Calmodulin.", "journal": "Biophysical journal", "date": "2016", "authors": "Sperlich B, Kapoor S, Waldmann H, Winter R, Weise K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27410739", "url": "https://glygen.org/publication/PubMed/27410739" } ] }, { "title": "AMPK and Endothelial Nitric Oxide Synthase Signaling Regulates K-Ras Plasma Membrane Interactions via Cyclic GMP-Dependent Protein Kinase 2.", "journal": "Molecular and cellular biology", "date": "2016", "authors": "Cho KJ, Casteel DE, Prakash P, Tan L, van der Hoeven D, Salim AA, Kim C, Capon RJ, Lacey E, Cunha SR, Gorfe AA, Hancock JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27697864", "url": "https://glygen.org/publication/PubMed/27697864" } ] }, { "title": "Structural basis of recognition of farnesylated and methylated KRAS4b by PDEdelta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Dharmaiah S, Bindu L, Tran TH, Gillette WK, Frank PH, Ghirlando R, Nissley DV, Esposito D, McCormick F, Stephen AG, Simanshu DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27791178", "url": "https://glygen.org/publication/PubMed/27791178" } ] }, { "title": "Inhibition of Isoprenylcysteine Carboxylmethyltransferase Induces Cell-Cycle Arrest and Apoptosis through p21 and p21-Regulated BNIP3 Induction in Pancreatic Cancer.", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Manu KA, Chai TF, Teh JT, Zhu WL, Casey PJ, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28167504", "url": "https://glygen.org/publication/PubMed/28167504" } ] }, { "title": "Targeting the Ras palmitoylation/depalmitoylation cycle in cancer.", "journal": "Biochemical Society transactions", "date": "2017", "authors": "Lin DTS, Davis NG, Conibear E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28630138", "url": "https://glygen.org/publication/PubMed/28630138" } ] }, { "title": "RAS Proteins and Their Regulators in Human Disease.", "journal": "Cell", "date": "2017", "authors": "Simanshu DK, Nissley DV, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28666118", "url": "https://glygen.org/publication/PubMed/28666118" } ] }, { "title": "Targeting Ras with Macromolecules.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Pei D, Chen K, Liao H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28778966", "url": "https://glygen.org/publication/PubMed/28778966" } ] }, { "title": "Posttranslational Modifications of RAS Proteins.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Ahearn I, Zhou M, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "29311131", "url": "https://glygen.org/publication/PubMed/29311131" } ] }, { "title": "Rce1: mechanism and inhibition.", "journal": "Critical reviews in biochemistry and molecular biology", "date": "2018", "authors": "Hampton SE, Dore TM, Schmidt WK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "29424242", "url": "https://glygen.org/publication/PubMed/29424242" } ] }, { "title": "Growth Factor Receptor Signaling Inhibition Prevents SARS-CoV-2 Replication.", "journal": "Molecular cell", "date": "2020", "authors": "Klann K, Bojkova D, Tascher G, Ciesek S, Munch C, Cinatl J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "32877642", "url": "https://glygen.org/publication/PubMed/32877642" } ] }, { "title": "Validation of a small molecule inhibitor of PDE6D-RAS interaction with favorable anti-leukemic effects.", "journal": "Blood cancer journal", "date": "2022", "authors": "Canovas Nunes S, De Vita S, Anighoro A, Autelitano F, Beaumont E, Klingbeil P, McGuinness M, Duvert B, Harris C, Yang L, Pokharel SP, Chen CW, Ermann M, Williams DA, Xu H", "evidence": [ { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" } ], "reference": [ { "type": "PubMed", "id": "35422065", "url": "https://glygen.org/publication/PubMed/35422065" } ] }, { "title": "PDE6D Mediates Trafficking of Prenylated Proteins NIM1K and UBL3 to Primary Cilia.", "journal": "Cells", "date": "2023-01-13", "authors": "Faber Siebren, Letteboer Stef J F, Junger Katrin, Butcher Rossano, Tammana Trinadh V Satish, van Beersum Sylvia E C, Ueffing Marius, Collin Rob W J, Liu Qin, Boldt Karsten, Roepman Ronald", "evidence": [ { "database": "RefSeq", "id": "NP_001277947", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277947" } ], "reference": [ { "type": "PubMed", "id": "36672247", "url": "https://glygen.org/publication/PubMed/36672247" } ] }, { "title": "Establishment of a human pancreatic tumor xenograft model: potential application for preclinical evaluation of novel therapeutic agents.", "journal": "Pancreas", "date": "1998", "authors": "Mohammad RM, Dugan MC, Mohamed AN, Almatchy VP, Flake TM, Dergham ST, Shields AF, Al-Katib AA, Vaitkevicius VK, Sarkar FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9436858", "url": "https://glygen.org/publication/PubMed/9436858" } ] }, { "title": "cDNA sequence, genomic organization and mapping of PDE6D, the human gene encoding the delta subunit of the cGMP phosphodiesterase of retinal rod cells to chromosome 2q36.", "journal": "Cytogenet. Cell Genet.", "date": "1997", "authors": "Ershova G, Derr\u00e9 J, Ch\u00e9telin S, Nancy V, Berger R, Kaplan J, Munnich A, de Gunzburg J", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "9533031", "url": "https://glygen.org/publication/PubMed/9533031" } ] }, { "title": "Characterization of human and mouse rod cGMP phosphodiesterase delta subunit (PDE6D) and chromosomal localization of the human gene.", "journal": "Genomics", "date": "1998", "authors": "Li N, Florio S K, Pettenati M J, Rao P N, Beavo J A, Baehr W", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "9570951", "url": "https://glygen.org/publication/PubMed/9570951" } ] }, { "title": "The rod cGMP phosphodiesterase delta subunit dissociates the small GTPase Rab13 from membranes.", "journal": "The Journal of biological chemistry", "date": "1998-08-28", "authors": "Marzesco A M, Galli T, Louvard D, Zahraoui A", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "9712853", "url": "https://glygen.org/publication/PubMed/9712853" } ] }, { "title": "Cloning and gene structure of the rod cGMP phosphodiesterase delta subunit gene (PDED) in man and mouse.", "journal": "Eur. J. Hum. Genet.", "date": "1998", "authors": "Lorenz B, Migliaccio C, Lichtner P, Meyer C, Strom TM, D'Urso M, Becker J, Ciccodicola A, Meitinger T", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "9781033", "url": "https://glygen.org/publication/PubMed/9781033" } ] }, { "title": "Antitumor activity of SCH 66336, an orally bioavailable tricyclic inhibitor of farnesyl protein transferase, in human tumor xenograft models and wap-ras transgenic mice.", "journal": "Cancer research", "date": "1998", "authors": "Liu M, Bryant MS, Chen J, Lee S, Yaremko B, Lipari P, Malkowski M, Ferrari E, Nielsen L, Prioli N, Dell J, Sinha D, Syed J, Korfmacher WA, Nomeir AA, Lin CC, Wang L, Taveras AG, Doll RJ, Njoroge FG, Mallams AK, Remiszewski S, Catino JJ, Girijavallabhan VM, Bishop WR, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9810004", "url": "https://glygen.org/publication/PubMed/9810004" } ] }, { "title": "(+)-4-[2-[4-(8-Chloro-3,10-dibromo-6,11-dihydro-5H-benzo[5, 6]cyclohepta[1,2-b]- pyridin-11(R)-yl)-1-piperidinyl]-2-oxo-ethyl]-1-piperidinecarboxamid e (SCH-66336): a very potent farnesyl protein transferase inhibitor as a novel antitumor agent.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Njoroge FG, Taveras AG, Kelly J, Remiszewski S, Mallams AK, Wolin R, Afonso A, Cooper AB, Rane DF, Liu YT, Wong J, Vibulbhan B, Pinto P, Deskus J, Alvarez CS, del Rosario J, Connolly M, Wang J, Desai J, Rossman RR, Bishop WR, Patton R, Wang L, Kirschmeier P, Ganguly AK, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9822558", "url": "https://glygen.org/publication/PubMed/9822558" } ] }, { "title": "Inhibition of K-ras-transformed rodent and human cancer cell growth via induction of apoptosis by irreversible inhibitors of Ras endoprotease.", "journal": "Cancer letters", "date": "1998", "authors": "Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9851253", "url": "https://glygen.org/publication/PubMed/9851253" } ] }, { "title": "The retinitis pigmentosa GTPase regulator, RPGR, interacts with the delta subunit of rod cyclic GMP phosphodiesterase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Linari M, Ueffing M, Manson F, Wright A, Meitinger T, Becker J", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "reference": [ { "type": "PubMed", "id": "9990021", "url": "https://glygen.org/publication/PubMed/9990021" } ] } ], "pathway": [ { "id": "hsa:5147", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5147", "resource": "KEGG Pathway" }, { "id": "R-HSA-5624958", "name": "ARL13B-mediated ciliary trafficking of INPP5E", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5624958", "resource": "Reactome", "description": "ARL13B-mediated ciliary trafficking of INPP5E" }, { "id": "R-HSA-9648002", "name": "RAS processing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002", "resource": "Reactome", "description": "RAS processing" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZRD3-1", "protein_name": "Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta", "gene_name": "Pde6d", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSAKDERARDILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVFFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSKVRLFYV", "length": 150 }, "evidence": [ { "id": "O43924", "url": "https://omabrowser.org/oma/group/O43924/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O55057-1", "protein_name": "Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta", "gene_name": "Pde6d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSAKDERARDILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSKVRLFYV", "length": 150 }, "evidence": [ { "id": "45929229", "url": "http://www.informatics.jax.org/homology/45929229", "database": "MGI" }, { "id": "O43924", "url": "https://omabrowser.org/oma/group/O43924/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VLJ0-1", "protein_name": "Probable cGMP 3',5'-cyclic phosphodiesterase subunit delta", "gene_name": "PrBP", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MGSDDQSAGDRIQKGFQINYMILRDADSGKIIWQENKDFSAPDQEHEARVPVKILDMRAVSREINFSTIESMENFRLDQKVLFKGRIMEEWFFEMGFVGANTTNTWQSTIEAAPESQMMPAKVLNGNVTIQTSFYDNETLITKSVVRLYYI", "length": 151 }, "evidence": [ { "id": "O43924", "url": "https://omabrowser.org/oma/group/O43924/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "cilium", "id": "GO:0005929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005929", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "cytoplasmic vesicle membrane", "id": "GO:0030659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030659", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "response to stimulus", "id": "GO:0050896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050896", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "GTPase inhibitor activity", "id": "GO:0005095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005095", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" }, { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "O43924", "url": "https://www.uniprot.org/uniprot/O43924" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 75 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 100, "end_pos": 102 }, { "start_pos": 64, "end_pos": 66 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 84 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }