{ "uniprot_canonical_ac": "O43837-1", "uniprot_ac": "O43837", "uniprot_id": "IDH3B_HUMAN", "mass": { "chemical_mass": 42184.0, "monoisotopic_mass": 42184.0 }, "refseq": { "ac": "NP_001317692", "name": "isocitrate dehydrogenase [NAD] subunit beta, mitochondrial isoform e precursor", "summary": "Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Sep 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" }, "gene_names": [ { "name": "IDH3B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43837", "id": "O43837" }, { "name": "IDH3B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692", "id": "NP_001317692" }, { "name": "RP46", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692", "id": "NP_001317692" }, { "name": "hCG_39616", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43837", "id": "O43837" } ], "protein_names": [ { "name": "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43837" }, { "name": "Isocitric dehydrogenase subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43837" }, { "name": "NAD(+)-specific ICDH subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43837" }, { "name": "isocitrate dehydrogenase [NAD] subunit beta, mitochondrial isoform e precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692", "id": "NP_001317692" }, { "name": "isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; NAD(+)-specific ICDH subunit beta; isocitrate dehydrogenase (NAD(+)) 3 beta; isocitrate dehydrogenase 3 (NAD+) beta; isocitric dehydrogenase subunit beta; isocitrate dehydrogenase 3 (NAD(+)) beta", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692", "id": "NP_001317692" } ], "function": [ { "annotation": "High IDH3B expression is associated with esophageal squamous cell carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" }, { "database": "PubMed", "id": "31053633", "url": "https://glygen.org/publication/PubMed/31053633" } ] }, { "annotation": "Human NAD-dependent isocitrate dehydrogenase (IDH) is a heterotetrameric mitochondrial enzyme with 2alpha:1beta:1gamma subunit ratio subunits shich share 40-52% identity in amino acid sequence.", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" }, { "database": "PubMed", "id": "20435888", "url": "https://glygen.org/publication/PubMed/20435888" } ] }, { "annotation": "Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Sep 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator) Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" }, { "database": "PubMed", "id": "20877624", "url": "https://glygen.org/publication/PubMed/20877624" } ] }, { "annotation": "Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.", "evidence": [ { "database": "UniProtKB", "id": "A0A087X2E5", "url": "https://www.uniprot.org/uniprot/A0A087X2E5#function" }, { "database": "UniProtKB", "id": "ARBA00037063", "url": "https://www.uniprot.org/uniprot/ARBA00037063#function" }, { "database": "UniProtKB", "id": "A0A087WZN1", "url": "https://www.uniprot.org/uniprot/A0A087WZN1#function" }, { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837#function" }, { "database": "PubMed", "id": "28139779", "url": "https://glygen.org/publication/PubMed/28139779" } ] }, { "annotation": "Polymorphism on chromosome 20p13 near the IDH3B gene is associated with uterine prolapse.", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" }, { "database": "PubMed", "id": "32619879", "url": "https://glygen.org/publication/PubMed/32619879" } ] } ], "disease": [ { "disease_id": "DOID:0110409", "recommended_name": { "id": "DOID:0110409", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110409", "name": "retinitis pigmentosa 46", "description": "A retinitis pigmentosa that has_material_basis_in mutation in the IDH3B gene on chromosome 20p13." }, "synonyms": [ { "id": "DOID:0110409", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110409", "name": "RP46", "description": "" }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "retinitis pigmentosa 46", "description": "Any retinitis pigmentosa in which the cause of the disease is a mutation in the IDH3B gene." }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "IDH3B retinitis pigmentosa", "description": "" }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "RP46", "description": "" }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "retinitis pigmentosa 46", "description": "" }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "retinitis pigmentosa caused by mutation in IDH3B", "description": "" }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "retinitis pigmentosa type 46", "description": "" }, { "id": "MONDO:0012943", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012943", "name": "retinitis pigmentosa, autosomal recessive, Idh3B-related", "description": "" }, { "id": "MIM:612572", "resource": "MIM", "url": "https://www.omim.org/entry/612572", "name": "Retinitis pigmentosa 46", "description": "Retinitis pigmentosa 46" } ], "evidence": [ { "id": "612572", "database": "MIM", "url": "https://www.omim.org/entry/612572" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "95.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "92.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "92.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "94.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "97.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "92.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "97.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43837", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43837" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "common_name": "Human" } ], "gene": [ { "name": "IDH3B", "url": "https://www.uniprot.org/uniprot/O43837", "locus": { "chromosome": "20", "start_pos": 2658395, "end_pos": 2664219, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000101365", "url": "https://www.ensembl.org/id/ENSG00000101365" } ] } } ], "crossref": [ { "id": "ENSG00000101365", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000101365", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.41", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.41&UniProtAcc=O43837", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "IDH3B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IDH3B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3420", "url": "https://www.ncbi.nlm.nih.gov/gene/3420", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5385", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5385", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43837", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43837*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004434", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004434", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019818", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019818", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024084", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024084", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3420", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3420", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604526", "url": "http://www.omim.org/entry/604526", "database": "MIM", "categories": [ "Other" ] }, { "id": "612572", "url": "http://www.omim.org/entry/612572", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43837", "url": "https://www.nextprot.org/entry/NX_O43837", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43837", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43837", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "TCAHKAN", "url": "https://omabrowser.org/oma/group/TCAHKAN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "143577at2759", "url": "http://www.orthodb.org/?query=143577at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11835", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11835", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11835:SF42", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11835:SF42", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6KDE", "url": "https://www.rcsb.org/structure/6KDE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KDF", "url": "https://www.rcsb.org/structure/6KDF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KDY", "url": "https://www.rcsb.org/structure/6KDY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KE3", "url": "https://www.rcsb.org/structure/6KE3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CE3", "url": "https://www.rcsb.org/structure/7CE3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GRB", "url": "https://www.rcsb.org/structure/8GRB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GRD", "url": "https://www.rcsb.org/structure/8GRD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GRU", "url": "https://www.rcsb.org/structure/8GRU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GS5", "url": "https://www.rcsb.org/structure/8GS5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00180", "url": "http://pfam.xfam.org/family/PF00180", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43837", "url": "https://pharos.nih.gov/targets/O43837", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43837", "url": "http://purl.obolibrary.org/obo/PR_O43837", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WZN1", "url": "https://www.uniprot.org/uniprot/A0A087WZN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WZN1-1", "url": "https://www.uniprot.org/uniprot/A0A087WZN1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X2E5", "url": "https://www.uniprot.org/uniprot/A0A087X2E5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X2E5-1", "url": "https://www.uniprot.org/uniprot/A0A087X2E5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SET9", "url": "https://www.uniprot.org/uniprot/A0A0D9SET9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SET9-1", "url": "https://www.uniprot.org/uniprot/A0A0D9SET9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SG66", "url": "https://www.uniprot.org/uniprot/A0A0D9SG66", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SG66-1", "url": "https://www.uniprot.org/uniprot/A0A0D9SG66-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43837-1", "url": "https://www.uniprot.org/uniprot/O43837-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43837-2", "url": "https://www.uniprot.org/uniprot/O43837-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43837-3", "url": "https://www.uniprot.org/uniprot/O43837-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS", "length": 385, "header": "sp|O43837-1|IDH3B_HUMAN Isoform 1 of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2 CANONICAL=O43837-1" }, "isoforms": [ { "isoform_ac": "A0A087WZN1-1", "url": "", "sequence": { "sequence": "MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGSNL", "length": 387, "header": "tr|A0A087WZN1-1|IDH3B_HUMAN Computationally mapped isoform of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1 CANONICAL=O43837-1" }, "locus": { "chromosome": "20", "start_pos": 2664188, "end_pos": 2658512, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000474315.5", "url": "https://www.ensembl.org/id/ENST00000474315.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000482773.1", "url": "https://www.ensembl.org/id/ENSP00000482773.1" } ] } }, { "isoform_ac": "A0A087X2E5-1", "url": "", "sequence": { "sequence": "MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKIPSAVPSFLLHPLPFSWAI", "length": 376, "header": "tr|A0A087X2E5-1|IDH3B_HUMAN Computationally mapped isoform of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1 CANONICAL=O43837-1" }, "locus": { "chromosome": "20", "start_pos": 2664188, "end_pos": 2659256, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000613370.1", "url": "https://www.ensembl.org/id/ENST00000613370.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000484922.1", "url": "https://www.ensembl.org/id/ENSP00000484922.1" } ] } }, { "isoform_ac": "A0A0D9SET9-1", "url": "", "sequence": { "sequence": "XKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGCPAPICPGSGQEYSQSHGHAAVGFQHAAAS", "length": 83, "header": "tr|A0A0D9SET9-1|IDH3B_HUMAN Computationally mapped isoform of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1 CANONICAL=O43837-1" }, "locus": { "chromosome": "20", "start_pos": 2660309, "end_pos": 2659701, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000477689.2", "url": "https://www.ensembl.org/id/ENST00000477689.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000485997.1", "url": "https://www.ensembl.org/id/ENSP00000485997.1" } ] } }, { "isoform_ac": "A0A0D9SG66-1", "url": "", "sequence": { "sequence": "XKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS", "length": 145, "header": "tr|A0A0D9SG66-1|A0A0D9SG66_HUMAN Computationally mapped isoform of Isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit beta OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1 CANONICAL=O43837-1" }, "locus": { "chromosome": "20", "start_pos": 2660308, "end_pos": 2658752, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000466494.6", "url": "https://www.ensembl.org/id/ENST00000466494.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000487187.1", "url": "https://www.ensembl.org/id/ENSP00000487187.1" } ] } }, { "isoform_ac": "O43837-1", "url": "", "sequence": { "sequence": "MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS", "length": 385, "header": "sp|O43837-1|IDH3B_HUMAN Isoform 1 of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2 CANONICAL=O43837-1" }, "locus": { "chromosome": "20", "start_pos": 2664188, "end_pos": 2658754, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000380843.9", "url": "https://www.ensembl.org/id/ENST00000380843.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000370223.4", "url": "https://www.ensembl.org/id/ENSP00000370223.4" } ] } }, { "isoform_ac": "O43837-2", "url": "", "sequence": { "sequence": "MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTSDMGGYATCHDFTEAVIAALPHP", "length": 383, "header": "sp|O43837-2|IDH3B_HUMAN Isoform 2 of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2 CANONICAL=O43837-1" }, "locus": { "chromosome": "20", "start_pos": 2664188, "end_pos": 2658445, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000380851.9", "url": "https://www.ensembl.org/id/ENST00000380851.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000370232.5", "url": "https://www.ensembl.org/id/ENSP00000370232.5" } ] } }, { "isoform_ac": "O43837-3", "url": "", "sequence": { "sequence": "MKMGERWSSLFPFPVSPSCCFLLTQSARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS", "length": 233, "header": "sp|O43837-3|IDH3B_HUMAN Isoform 3 of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2 CANONICAL=O43837-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O43837", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43837" }, { "id": "34229054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34229054" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Aconitase polymorphism in man.", "journal": "Annals of human genetics", "date": "1975", "authors": "Slaughter CA, Hopkinson DA, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "1052766", "url": "https://glygen.org/publication/PubMed/1052766" } ] }, { "title": "Identification and functional characterization of a novel, tissue-specific NAD+-dependent isocitrate dehydrogenase beta subunit isoform.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Kim YO, Koh HJ, Kim SH, Jo SH, Huh JW, Jeong KS, Lee IJ, Song BJ, Huh TL", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "reference": [ { "type": "PubMed", "id": "10601238", "url": "https://glygen.org/publication/PubMed/10601238" } ] }, { "title": "The high-resolution structure of the NADP(H)-binding component (dIII) of proton-translocating transhydrogenase from human heart mitochondria.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "White SA, Peake SJ, McSweeney S, Leonard G, Cotton NP, Jackson JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "10673423", "url": "https://glygen.org/publication/PubMed/10673423" } ] }, { "title": "Interaction between succinyl CoA synthetase and the heme-biosynthetic enzyme ALAS-E is disrupted in sideroblastic anemia.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Furuyama K, Sassa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "10727444", "url": "https://glygen.org/publication/PubMed/10727444" } ] }, { "title": "The remarkable structural and functional organization of the eukaryotic pyruvate dehydrogenase complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Zhou ZH, McCarthy DB, O'Connor CM, Reed LJ, Stoops JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "11752427", "url": "https://glygen.org/publication/PubMed/11752427" } ] }, { "title": "Crystal structure of porcine mitochondrial NADP+-dependent isocitrate dehydrogenase complexed with Mn2+ and isocitrate. Insights into the enzyme mechanism.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ceccarelli C, Grodsky NB, Ariyaratne N, Colman RF, Bahnson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "12207025", "url": "https://glygen.org/publication/PubMed/12207025" } ] }, { "title": "Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Tao X, Yang Z, Tong L", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "12962632", "url": "https://glygen.org/publication/PubMed/12962632" } ] }, { "title": "Guanosine triphosphate, the primary product of phosphorylation coupled to the breakdown of succinyl coenzyme A.", "journal": "Biochimica et biophysica acta", "date": "1954", "authors": "SANADI DR, GIBSON M, AYENGAR P", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "13181903", "url": "https://glygen.org/publication/PubMed/13181903" } ] }, { "title": "STUDIES ON SUCCINATE DEHYDROGENASE. I. SPECTRAL PROPERTIES OF THE PURIFIED ENZYME AND FORMATION OF ENZYME-COMPETITIVE INHIBITOR COMPLEXES.", "journal": "Biochimica et biophysica acta", "date": "1964", "authors": "DERVARTANIAN DV, VEEGER C", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "14249115", "url": "https://glygen.org/publication/PubMed/14249115" } ] }, { "title": "Evaluation by mutagenesis of the importance of 3 arginines in alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Soundar S, Park JH, Huh TL, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "14555658", "url": "https://glygen.org/publication/PubMed/14555658" } ] }, { "title": "Structure and function of malic enzymes, a new class of oxidative decarboxylases.", "journal": "Biochemistry", "date": "2003", "authors": "Chang GG, Tong L", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "14596586", "url": "https://glygen.org/publication/PubMed/14596586" } ] }, { "title": "Di- and triphosphopyridine nucleotide isocitric dehydrogenases in yeast.", "journal": "The Journal of biological chemistry", "date": "1951", "authors": "KORNBERG A, PRICER WE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "14832224", "url": "https://glygen.org/publication/PubMed/14832224" } ] }, { "title": "The inhibitory effects of itaconic acid in vitro and in vivo.", "journal": "The Journal of biological chemistry", "date": "1952", "authors": "BOOTH AN, TAYLOR J, WILSON RH, DEEDS F", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "14946179", "url": "https://glygen.org/publication/PubMed/14946179" } ] }, { "title": "Expression of two succinyl-CoA synthetases with different nucleotide specificities in mammalian tissues.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Lambeth DO, Tews KN, Adkins S, Frohlich D, Milavetz BI", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "15234968", "url": "https://glygen.org/publication/PubMed/15234968" } ] }, { "title": "X-ray structure of fumarylacetoacetate hydrolase family member Homo sapiens FLJ36880.", "journal": "Biological chemistry", "date": "2004", "authors": "Manjasetty BA, Niesen FH, Delbruck H, Gotz F, Sievert V, Bussow K, Behlke J, Heinemann U", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "15551868", "url": "https://glygen.org/publication/PubMed/15551868" } ] }, { "title": "Succinate links TCA cycle dysfunction to oncogenesis by inhibiting HIF-alpha prolyl hydroxylase.", "journal": "Cancer cell", "date": "2005", "authors": "Selak MA, Armour SM, MacKenzie ED, Boulahbel H, Watson DG, Mansfield KD, Pan Y, Simon MC, Thompson CB, Gottlieb E", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "15652751", "url": "https://glygen.org/publication/PubMed/15652751" } ] }, { "title": "Deficiency of the ADP-forming succinyl-CoA synthase activity is associated with encephalomyopathy and mitochondrial DNA depletion.", "journal": "American journal of human genetics", "date": "2005", "authors": "Elpeleg O, Miller C, Hershkovitz E, Bitner-Glindzicz M, Bondi-Rubinstein G, Rahman S, Pagnamenta A, Eshhar S, Saada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "15877282", "url": "https://glygen.org/publication/PubMed/15877282" } ] }, { "title": "Crystal structure of human dihydrolipoamide dehydrogenase: NAD+/NADH binding and the structural basis of disease-causing mutations.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Brautigam CA, Chuang JL, Tomchick DR, Machius M, Chuang DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "15946682", "url": "https://glygen.org/publication/PubMed/15946682" } ] }, { "title": "Accumulation of Krebs cycle intermediates and over-expression of HIF1alpha in tumours which result from germline FH and SDH mutations.", "journal": "Human molecular genetics", "date": "2005", "authors": "Pollard PJ, Briere JJ, Alam NA, Barwell J, Barclay E, Wortham NC, Hunt T, Mitchell M, Olpin S, Moat SJ, Hargreaves IP, Heales SJ, Chung YL, Griffiths JR, Dalgleish A, McGrath JA, Gleeson MJ, Hodgson SV, Poulsom R, Rustin P, Tomlinson IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "15987702", "url": "https://glygen.org/publication/PubMed/15987702" } ] }, { "title": "Succinate dehydrogenase deficiency in human.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2005", "authors": "Briere JJ, Favier J, El Ghouzzi V, Djouadi F, Benit P, Gimenez AP, Rustin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "16143825", "url": "https://glygen.org/publication/PubMed/16143825" } ] }, { "title": "Identification of Mn2+-binding aspartates from alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Soundar S, O'hagan M, Fomulu KS, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "16737955", "url": "https://glygen.org/publication/PubMed/16737955" } ] }, { "title": "An NADH-tetrazolium-coupled sensitive assay for malate dehydrogenase in mitochondria and crude tissue homogenates.", "journal": "Journal of biochemical and biophysical methods", "date": "2006", "authors": "Luo C, Wang X, Long J, Liu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "16740313", "url": "https://glygen.org/publication/PubMed/16740313" } ] }, { "title": "Inhibition of hypoxia-inducible factor (HIF) hydroxylases by citric acid cycle intermediates: possible links between cell metabolism and stabilization of HIF.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Koivunen P, Hirsila M, Remes AM, Hassinen IE, Kivirikko KI, Myllyharju J", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "17182618", "url": "https://glygen.org/publication/PubMed/17182618" } ] }, { "title": "Role of alpha-Asp181, beta-Asp192, and gamma-Asp190 in the distinctive subunits of human NAD-specific isocitrate dehydrogenase.", "journal": "Biochemistry", "date": "2007", "authors": "Bzymek KP, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "17432878", "url": "https://glygen.org/publication/PubMed/17432878" } ] }, { "title": "Deficiency of the alpha subunit of succinate-coenzyme A ligase causes fatal infantile lactic acidosis with mitochondrial DNA depletion.", "journal": "American journal of human genetics", "date": "2007", "authors": "Ostergaard E, Christensen E, Kristensen E, Mogensen B, Duno M, Shoubridge EA, Wibrand F", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "17668387", "url": "https://glygen.org/publication/PubMed/17668387" } ] }, { "title": "Insights from retinitis pigmentosa into the roles of isocitrate dehydrogenases in the Krebs cycle.", "journal": "Nature genetics", "date": "2008", "authors": "Hartong DT, Dange M, McGee TL, Berson EL, Dryja TP, Colman RF", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" }, { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "18806796", "url": "https://glygen.org/publication/PubMed/18806796" } ] }, { "title": "Biosynthesis of tricarboxylic acids by carbon dioxide fixation; enzymatic mechanisms.", "journal": "The Journal of biological chemistry", "date": "1948", "authors": "OCHOA S", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "18914071", "url": "https://glygen.org/publication/PubMed/18914071" } ] }, { "title": "Purification and partial amino acid sequence of human aconitase.", "journal": "Protein sequences & data analysis", "date": "1991", "authors": "Baldwin GS, Seet KL, Callaghan J, Toncich G, Toh BH, Moritz RL, Rubira MR, Simpson R", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "1946331", "url": "https://glygen.org/publication/PubMed/1946331" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Human NAD(+)-dependent mitochondrial malic enzyme. cDNA cloning, primary structure, and expression in Escherichia coli.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Loeber G, Infante AA, Maurer-Fogy I, Krystek E, Dworkin MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "1993674", "url": "https://glygen.org/publication/PubMed/1993674" } ] }, { "title": "Mitochondrial energy-linked nicotinamide nucleotide transhydrogenase. Membrane topography of the bovine enzyme.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Yamaguchi M, Hatefi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "2005110", "url": "https://glygen.org/publication/PubMed/2005110" } ] }, { "title": "Each conserved active site tyr in the three subunits of human isocitrate dehydrogenase has a different function.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Dange M, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" }, { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" } ], "reference": [ { "type": "PubMed", "id": "20435888", "url": "https://glygen.org/publication/PubMed/20435888" } ] }, { "title": "Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.", "journal": "PloS one", "date": "2010", "authors": "Hendrickson SL, Lautenberger JA, Chinn LW, Malasky M, Sezgin E, Kingsley LA, Goedert JJ, Kirk GD, Gomperts ED, Buchbinder SP, Troyer JL, O'Brien SJ", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" } ], "reference": [ { "type": "PubMed", "id": "20877624", "url": "https://glygen.org/publication/PubMed/20877624" } ] }, { "title": "Structure-function relationships in dihydrolipoamide acyltransferases.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Reed LJ, Hackert ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "2188967", "url": "https://glygen.org/publication/PubMed/2188967" } ] }, { "title": "Identification of FAH domain-containing protein 1 (FAHD1) as oxaloacetate decarboxylase.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Pircher H, von Grafenstein S, Diener T, Metzger C, Albertini E, Taferner A, Unterluggauer H, Kramer C, Liedl KR, Jansen-Durr P", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "25575590", "url": "https://glygen.org/publication/PubMed/25575590" } ] }, { "title": "Immunoresponsive Gene 1 and Itaconate Inhibit Succinate Dehydrogenase to Modulate Intracellular Succinate Levels.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Cordes T, Wallace M, Michelucci A, Divakaruni AS, Sapcariu SC, Sousa C, Koseki H, Cabrales P, Murphy AN, Hiller K, Metallo CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "27189937", "url": "https://glygen.org/publication/PubMed/27189937" } ] }, { "title": "Itaconate Links Inhibition of Succinate Dehydrogenase with Macrophage Metabolic Remodeling and Regulation of Inflammation.", "journal": "Cell metabolism", "date": "2016", "authors": "Lampropoulou V, Sergushichev A, Bambouskova M, Nair S, Vincent EE, Loginicheva E, Cervantes-Barragan L, Ma X, Huang SC, Griss T, Weinheimer CJ, Khader S, Randolph GJ, Pearce EJ, Jones RG, Diwan A, Diamond MS, Artyomov MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "27374498", "url": "https://glygen.org/publication/PubMed/27374498" } ] }, { "title": "Molecular mechanism of the allosteric regulation of the alphagamma heterodimer of human NAD-dependent isocitrate dehydrogenase.", "journal": "Sci. Rep.", "date": "2017", "authors": "Ma T, Peng Y, Huang W, Ding J", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "reference": [ { "type": "PubMed", "id": "28098230", "url": "https://glygen.org/publication/PubMed/28098230" } ] }, { "title": "The beta and gamma subunits play distinct functional roles in the alpha2betagamma heterotetramer of human NAD-dependent isocitrate dehydrogenase.", "journal": "Scientific reports", "date": "2017", "authors": "Ma T, Peng Y, Huang W, Liu Y, Ding J", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "reference": [ { "type": "PubMed", "id": "28139779", "url": "https://glygen.org/publication/PubMed/28139779" } ] }, { "title": "Hypoxia/pseudohypoxia-mediated activation of hypoxia-inducible factor-1alpha in cancer.", "journal": "Cancer science", "date": "2019", "authors": "Hayashi Y, Yokota A, Harada H, Huang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "30844107", "url": "https://glygen.org/publication/PubMed/30844107" } ] }, { "title": "APC/C-CDH1-Regulated IDH3beta Coordinates with the Cell Cycle to Promote Cell Proliferation.", "journal": "Cancer research", "date": "2019", "authors": "Wu Q, Zhang W, Xue L, Wang Y, Fu M, Ma L, Song Y, Zhan QM", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" } ], "reference": [ { "type": "PubMed", "id": "31053633", "url": "https://glygen.org/publication/PubMed/31053633" } ] }, { "title": "Polymorphism on chromosome 20p13 near the IDH3B gene is associated with uterine prolapse.", "journal": "European journal of obstetrics, gynecology, and reproductive biology", "date": "2020", "authors": "Bizjak T, Gorenjak M, Potocnik U, But I", "evidence": [ { "database": "RefSeq", "id": "NP_001317692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317692" } ], "reference": [ { "type": "PubMed", "id": "32619879", "url": "https://glygen.org/publication/PubMed/32619879" } ] }, { "title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2021", "authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43837", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43837" } ], "reference": [ { "type": "PubMed", "id": "34229054", "url": "https://glygen.org/publication/PubMed/34229054" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43837", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43837" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Purification, cDNA cloning and heterologous expression of the human mitochondrial NADP(+)-dependent malic enzyme.", "journal": "The Biochemical journal", "date": "1994", "authors": "Loeber G, Maurer-Fogy I, Schwendenwein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "7818469", "url": "https://glygen.org/publication/PubMed/7818469" } ] }, { "title": "Mutation of the fumarase gene in two siblings with progressive encephalopathy and fumarase deficiency.", "journal": "The Journal of clinical investigation", "date": "1994", "authors": "Bourgeron T, Chretien D, Poggi-Bach J, Doonan S, Rabier D, Letouze P, Munnich A, Rotig A, Landrieu P, Rustin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "8200987", "url": "https://glygen.org/publication/PubMed/8200987" } ] }, { "title": "Subunit interactions in the mammalian alpha-ketoglutarate dehydrogenase complex. Evidence for direct association of the alpha-ketoglutarate dehydrogenase and dihydrolipoamide dehydrogenase components.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "McCartney RG, Rice JE, Sanderson SJ, Bunik V, Lindsay H, Lindsay JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "9727038", "url": "https://glygen.org/publication/PubMed/9727038" } ] }, { "title": "Characterization of the ATP- and GTP-specific succinyl-CoA synthetases in pigeon. The enzymes incorporate the same alpha-subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Johnson JD, Muhonen WW, Lambeth DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "9765290", "url": "https://glygen.org/publication/PubMed/9765290" } ] }, { "title": "Genetic evidence for the expression of ATP- and GTP-specific succinyl-CoA synthetases in multicellular eucaryotes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Johnson JD, Mehus JG, Tews K, Milavetz BI, Lambeth DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "9765291", "url": "https://glygen.org/publication/PubMed/9765291" } ] }, { "title": "Interaction between citrate synthase and malate dehydrogenase. Substrate channeling of oxaloacetate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Morgunov I, Srere PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "9792662", "url": "https://glygen.org/publication/PubMed/9792662" } ] }, { "title": "Cloning and molecular analysis of the human citrate synthase gene.", "journal": "Genome", "date": "1998", "authors": "Goldenthal MJ, Marin-Garcia J, Ananthakrishnan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-71403", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403" } ], "reference": [ { "type": "PubMed", "id": "9809442", "url": "https://glygen.org/publication/PubMed/9809442" } ] } ], "pathway": [ { "id": "hsa:3420", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3420", "resource": "KEGG Pathway" }, { "id": "R-HSA-71403", "name": "Citric acid cycle (TCA cycle)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71403", "resource": "Reactome", "description": "Citric acid cycle (TCA cycle)" } ], "orthologs": [ { "uniprot_canonical_ac": "P28834-1", "protein_name": "Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial", "gene_name": "IDH1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGVYEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLSTM", "length": 360 }, "evidence": [ { "id": "O43837", "url": "https://omabrowser.org/oma/group/O43837/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q68FX0-1", "protein_name": "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial", "gene_name": "Idh3B", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAALSNVRWLTRAVLGARNSGAWRGLRTAASAQAASQSQAQDVRVEGAFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFKEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIYTPMEYKGELASYDMQLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLHPHGG", "length": 385 }, "evidence": [ { "id": "45929532", "url": "http://www.informatics.jax.org/homology/45929532", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q91VA7-1", "protein_name": "Isocitrate dehydrogenase [NAD] subunit, mitochondrial", "gene_name": "Idh3b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAALSNVRWLTRAVLAARNSGAWRGLGTSTAHAASQSQAQDVRVEGAFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFKEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIYTPMEYKGELASYDMQLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESAKGVIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSATNMLRHLNLEYHSSMIADAVKKVIKAGKVRTRDMGGYSTTTDFIKSVIGHLHPHGG", "length": 384 }, "evidence": [ { "id": "45929532", "url": "http://www.informatics.jax.org/homology/45929532", "database": "MGI" }, { "id": "O43837", "url": "https://omabrowser.org/oma/group/O43837/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VD58-1", "protein_name": "Isocitric dehydrogenase subunit beta", "gene_name": "Idh3b", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSMLARTVGRTFMQAAAARSLHTTSTLRATDNYGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPVLSAKLEDVVASIQKNKVCIKGVLATPDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGGQSTTQDFTRAIILNMS", "length": 370 }, "evidence": [ { "id": "O43837", "url": "https://omabrowser.org/oma/group/O43837/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "NAD binding", "id": "GO:0051287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051287", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor", "id": "GO:0016616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016616", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "electron transfer activity", "id": "GO:0009055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009055", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "isocitrate dehydrogenase (NAD+) activity", "id": "GO:0004449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004449", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "mitochondrial isocitrate dehydrogenase complex (NAD+)", "id": "GO:0005962", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005962", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "tricarboxylic acid cycle", "id": "GO:0006099", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006099", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" }, { "name": "isocitrate metabolic process", "id": "GO:0006102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006102", "evidence": [ { "database": "UniProtKB", "id": "O43837", "url": "https://www.uniprot.org/uniprot/O43837" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }