{ "uniprot_canonical_ac": "O43474-3", "uniprot_ac": "O43474", "uniprot_id": "KLF4_HUMAN", "mass": { "chemical_mass": 54671.0, "monoisotopic_mass": 54671.0 }, "refseq": { "ac": "NP_001300981", "name": "Krueppel-like factor 4 isoform 1", "summary": "This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, "gene_names": [ { "name": "KLF4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43474", "id": "O43474" }, { "name": "EZF; GKLF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981", "id": "NP_001300981" }, { "name": "EZF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43474", "id": "O43474" }, { "name": "GKLF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43474", "id": "O43474" }, { "name": "KLF4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981", "id": "NP_001300981" } ], "protein_names": [ { "name": "Krueppel-like factor 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43474" }, { "name": "Epithelial zinc finger protein EZF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43474" }, { "name": "Gut-enriched krueppel-like factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43474" }, { "name": "Krueppel-like factor 4 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981", "id": "NP_001300981" }, { "name": "endothelial Kruppel-like zinc finger protein; krueppel-like factor 4; Kruppel like factor 4; gut-enriched krueppel-like factor; epithelial zinc finger protein EZF; Kruppel-like factor 4 (gut); gut Kruppel-like factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981", "id": "NP_001300981" } ], "function": [ { "annotation": "A longer isoform of gut-enriched Kruppel-like factor 4 (GKLF) we term GKLFa interacts with the CD11d promoter", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "15561714", "url": "https://glygen.org/publication/PubMed/15561714" } ] }, { "annotation": "Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "38050242", "url": "https://glygen.org/publication/PubMed/38050242" } ] }, { "annotation": "KLF4 suppresses the proliferation of perihilar cholangiocarcinoma by negatively regulating GDF15 and phosphorylating AKT.", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "37937607", "url": "https://glygen.org/publication/PubMed/37937607" } ] }, { "annotation": "LETMD1, a target of KLF4, hinders endothelial inflammation and pyroptosis: A protective mechanism in the pathogenesis of atherosclerosis.", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "37769890", "url": "https://glygen.org/publication/PubMed/37769890" } ] }, { "annotation": "MicroRNA-29a-3p Accelerates Inflammatory Damage in Neonatal Pneumonia Via Targeting Kruppel-like Factor 4. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "38085146", "url": "https://glygen.org/publication/PubMed/38085146" } ] }, { "annotation": "This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ] }, { "annotation": "This is the first paper that describes the identification and characterization of KLF4 (also called GKLF) and that KLF4 is inhibitor of cell growth.", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "8702718", "url": "https://glygen.org/publication/PubMed/8702718" } ] }, { "annotation": "This paper describes that the nuclear localization signals within KLF4 define a closely related subfamily of Kruppel-like factors including KLF1, KLF2 and KLF4.", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "9218496", "url": "https://glygen.org/publication/PubMed/9218496" } ] }, { "annotation": "This study examines the expression of KLF4 during embryonic and postnatal development and in intestinal tumorigenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" }, { "database": "PubMed", "id": "9428642", "url": "https://glygen.org/publication/PubMed/9428642" } ] }, { "annotation": "Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription.", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474#function" }, { "database": "PubMed", "id": "17308127", "url": "https://glygen.org/publication/PubMed/17308127" }, { "database": "PubMed", "id": "20071344", "url": "https://glygen.org/publication/PubMed/20071344" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "79.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "91.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "91.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "78.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43474", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43474" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "common_name": "Human" } ], "gene": [ { "name": "KLF4", "url": "https://www.uniprot.org/uniprot/O43474", "locus": { "chromosome": "9", "start_pos": 107484852, "end_pos": 107490482, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000136826", "url": "https://www.ensembl.org/id/ENSG00000136826" } ] } } ], "crossref": [ { "id": "ENSG00000136826", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000136826", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "KLF4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KLF4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9314", "url": "https://www.ncbi.nlm.nih.gov/gene/9314", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6348", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6348", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43474", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43474*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9314", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9314", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602253", "url": "http://www.omim.org/entry/602253", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43474", "url": "https://www.nextprot.org/entry/NX_O43474", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43474", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43474", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "SLMHQEP", "url": "https://omabrowser.org/oma/group/SLMHQEP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5484790at2759", "url": "http://www.orthodb.org/?query=5484790at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23235", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23235", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23235:SF117", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23235:SF117", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6VTX", "url": "https://www.rcsb.org/structure/6VTX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00096", "url": "http://pfam.xfam.org/family/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43474", "url": "https://pharos.nih.gov/targets/O43474", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43474", "url": "http://purl.obolibrary.org/obo/PR_O43474", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43474-1", "url": "https://www.uniprot.org/uniprot/O43474-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43474-3", "url": "https://www.uniprot.org/uniprot/O43474-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43474-4", "url": "https://www.uniprot.org/uniprot/O43474-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43474-5", "url": "https://www.uniprot.org/uniprot/O43474-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43474-6", "url": "https://www.uniprot.org/uniprot/O43474-6", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF", "length": 513, "header": "sp|O43474-3|KLF4_HUMAN Isoform 3 of Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3 CANONICAL=O43474-3" }, "isoforms": [ { "isoform_ac": "O43474-1", "url": "", "sequence": { "sequence": "MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF", "length": 479, "header": "sp|O43474-1|KLF4_HUMAN Isoform 1 of Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3 CANONICAL=O43474-3" }, "locus": { "chromosome": "9", "start_pos": 107489172, "end_pos": 107485754, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374672.5", "url": "https://www.ensembl.org/id/ENST00000374672.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000363804.4", "url": "https://www.ensembl.org/id/ENSP00000363804.4" } ] } }, { "isoform_ac": "O43474-3", "url": "", "sequence": { "sequence": "MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF", "length": 513, "header": "sp|O43474-3|KLF4_HUMAN Isoform 3 of Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3 CANONICAL=O43474-3" }, "locus": {} }, { "isoform_ac": "O43474-4", "url": "", "sequence": { "sequence": "MKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF", "length": 429, "header": "sp|O43474-4|KLF4_HUMAN Isoform 4 of Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3 CANONICAL=O43474-3" }, "locus": {} }, { "isoform_ac": "O43474-5", "url": "", "sequence": { "sequence": "MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNSSCHPVPACQRSPSQRGEDDRGPGKGPPPTLVITRAAAKPTQRVPISRHTCEPTQVRNLTTVTGTAVDGNSPAQMN", "length": 118, "header": "sp|O43474-5|KLF4_HUMAN Isoform 5 of Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3 CANONICAL=O43474-3" }, "locus": {} }, { "isoform_ac": "O43474-6", "url": "", "sequence": { "sequence": "MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNVRNLTTVTGTAVDGNSPAQMN", "length": 63, "header": "sp|O43474-6|KLF4_HUMAN Isoform 6 of Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3 CANONICAL=O43474-3" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 251, "start_aa": "Ser", "end_pos": 251, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser251", "evidence": [ { "id": "O43474", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43474" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" } ] } ], "phosphorylation": [ { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" }, { "database": "PubMed", "id": "29526737", "url": "https://glygen.org/publication/PubMed/29526737" } ], "site_lbl": "Ser132" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" }, { "database": "PubMed", "id": "31281496", "url": "https://glygen.org/publication/PubMed/31281496" } ], "site_lbl": "Ser234" }, { "start_pos": 240, "end_pos": 240, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O43474", "url": "http://phospho.elm.eu.org/byAccession/O43474.html" }, { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser240" }, { "start_pos": 254, "end_pos": 254, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" } ], "site_lbl": "Ser254" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" }, { "database": "PubMed", "id": "25116380", "url": "https://glygen.org/publication/PubMed/25116380" } ], "site_lbl": "Thr429" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "p300 interacts with the N- and C-terminal part of PPARgamma2 in a ligand-independent and -dependent manner, respectively.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gelman L, Zhou G, Fajas L, Raspe E, Fruchart JC, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10075656", "url": "https://glygen.org/publication/PubMed/10075656" } ] }, { "title": "Oncogene expression cloning by retroviral transduction of adenovirus E1A-immortalized rat kidney RK3E cells: transformation of a host with epithelial features by c-MYC and the zinc finger protein GKLF.", "journal": "Cell Growth Differ.", "date": "1999", "authors": "Foster K W, Ren S, Louro I D, Lobo-Ruppert S M, McKie-Bell P, Grizzle W, Hayes M R, Broker T R, Chow L T, Ruppert J M", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "10392904", "url": "https://glygen.org/publication/PubMed/10392904" } ] }, { "title": "PPARgamma activation induces the expression of the adipocyte fatty acid binding protein gene in human monocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Pelton PD, Zhou L, Demarest KT, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10425206", "url": "https://glygen.org/publication/PubMed/10425206" } ] }, { "title": "Ghrelin is a growth-hormone-releasing acylated peptide from stomach.", "journal": "Nature", "date": "1999", "authors": "Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "10604470", "url": "https://glygen.org/publication/PubMed/10604470" } ] }, { "title": "Ghrelin, a novel growth hormone-releasing acylated peptide, is synthesized in a distinct endocrine cell type in the gastrointestinal tracts of rats and humans.", "journal": "Endocrinology", "date": "2000", "authors": "Date Y, Kojima M, Hosoda H, Sawaguchi A, Mondal MS, Suganuma T, Matsukura S, Kangawa K, Nakazato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "11089560", "url": "https://glygen.org/publication/PubMed/11089560" } ] }, { "title": "Activation of human peroxisome proliferator-activated receptor (PPAR) subtypes by pioglitazone.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Sakamoto J, Kimura H, Moriyama S, Odaka H, Momose Y, Sugiyama Y, Sawada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11095972", "url": "https://glygen.org/publication/PubMed/11095972" } ] }, { "title": "Stomach is a major source of circulating ghrelin, and feeding state determines plasma ghrelin-like immunoreactivity levels in humans.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Ariyasu H, Takaya K, Tagami T, Ogawa Y, Hosoda K, Akamizu T, Suda M, Koh T, Natsui K, Toyooka S, Shirakami G, Usui T, Shimatsu A, Doi K, Hosoda H, Kojima M, Kangawa K, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "11600536", "url": "https://glygen.org/publication/PubMed/11600536" } ] }, { "title": "Ghrelin is present in pancreatic alpha-cells of humans and rats and stimulates insulin secretion.", "journal": "Diabetes", "date": "2002", "authors": "Date Y, Nakazato M, Hashiguchi S, Dezaki K, Mondal MS, Hosoda H, Kojima M, Kangawa K, Arima T, Matsuo H, Yada T, Matsukura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "11756331", "url": "https://glygen.org/publication/PubMed/11756331" } ] }, { "title": "Regional differences in the response of human pre-adipocytes to PPARgamma and RXRalpha agonists.", "journal": "Diabetes", "date": "2002", "authors": "Sewter CP, Blows F, Vidal-Puig A, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11872672", "url": "https://glygen.org/publication/PubMed/11872672" } ] }, { "title": "Control of cell cycle exit and entry by protein kinase B-regulated forkhead transcription factors.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kops GJ, Medema RH, Glassford J, Essers MA, Dijkers PF, Coffer PJ, Lam EW, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "11884591", "url": "https://glygen.org/publication/PubMed/11884591" } ] }, { "title": "DNA repair pathway stimulated by the forkhead transcription factor FOXO3a through the Gadd45 protein.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Tran H, Brunet A, Grenier JM, Datta SR, Fornace AJ Jr, DiStefano PS, Chiang LW, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "11964479", "url": "https://glygen.org/publication/PubMed/11964479" } ] }, { "title": "The tissue distribution of the mRNA of ghrelin and subtypes of its receptor, GHS-R, in humans.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Gnanapavan S, Kola B, Bustin SA, Morris DG, McGee P, Fairclough P, Bhattacharya S, Carpenter R, Grossman AB, Korbonits M", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12050285", "url": "https://glygen.org/publication/PubMed/12050285" } ] }, { "title": "Leptin gene expression in human preadipocytes is switched on by maturation-induced demethylation of distinct CpGs in its proximal promoter.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Melzner I, Scott V, Dorsch K, Fischer P, Wabitsch M, Bruderlein S, Hasel C, Moller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12213831", "url": "https://glygen.org/publication/PubMed/12213831" } ] }, { "title": "Ghrelin immunoreactivity in human plasma is suppressed by somatostatin.", "journal": "Clinical endocrinology", "date": "2002", "authors": "Norrelund H, Hansen TK, Orskov H, Hosoda H, Kojima M, Kangawa K, Weeke J, Moller N, Christiansen JS, Jorgensen JO", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12354137", "url": "https://glygen.org/publication/PubMed/12354137" } ] }, { "title": "Structural divergence of human ghrelin. Identification of multiple ghrelin-derived molecules produced by post-translational processing.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hosoda H, Kojima M, Mizushima T, Shimizu S, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12414809", "url": "https://glygen.org/publication/PubMed/12414809" } ] }, { "title": "Euglycemic hyperinsulinemia, but not lipid infusion, decreases circulating ghrelin levels in humans.", "journal": "Journal of endocrinological investigation", "date": "2002", "authors": "Mohlig M, Spranger J, Otto B, Ristow M, Tschop M, Pfeiffer AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "12553549", "url": "https://glygen.org/publication/PubMed/12553549" } ] }, { "title": "Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells.", "journal": "Cell", "date": "2003", "authors": "Chambers I, Colby D, Robertson M, Nichols J, Lee S, Tweedie S, Smith A", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "12787505", "url": "https://glygen.org/publication/PubMed/12787505" } ] }, { "title": "Induction of adiponectin, a fat-derived antidiabetic and antiatherogenic factor, by nuclear receptors.", "journal": "Diabetes", "date": "2003", "authors": "Iwaki M, Matsuda M, Maeda N, Funahashi T, Matsuzawa Y, Makishima M, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12829629", "url": "https://glygen.org/publication/PubMed/12829629" } ] }, { "title": "Differential effect of protein and fat on plasma ghrelin levels in man.", "journal": "Regulatory peptides", "date": "2003", "authors": "Erdmann J, Lippl F, Schusdziarra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "14599721", "url": "https://glygen.org/publication/PubMed/14599721" } ] }, { "title": "The transcriptome profile of human embryonic stem cells as defined by SAGE.", "journal": "Stem cells (Dayton, Ohio)", "date": "2004", "authors": "Richards M, Tan SP, Tan JH, Chan WK, Bongso A", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "14688391", "url": "https://glygen.org/publication/PubMed/14688391" } ] }, { "title": "Integration of Smad and forkhead pathways in the control of neuroepithelial and glioblastoma cell proliferation.", "journal": "Cell", "date": "2004", "authors": "Seoane J, Le HV, Shen L, Anderson SA, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "15084259", "url": "https://glygen.org/publication/PubMed/15084259" } ] }, { "title": "Identification, cloning and expression analysis of the pluripotency promoting Nanog genes in mouse and human.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2004", "authors": "Hart AH, Hartley L, Ibrahim M, Robb L", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15108323", "url": "https://glygen.org/publication/PubMed/15108323" } ] }, { "title": "Acetylcholine regulates ghrelin secretion in humans.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Broglio F, Gottero C, Van Koetsveld P, Prodam F, Destefanis S, Benso A, Gauna C, Hofland L, Arvat E, van der Lely AJ, Ghigo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15126574", "url": "https://glygen.org/publication/PubMed/15126574" } ] }, { "title": "Genomic structure and characterization of the 5'-flanking region of the human ghrelin gene.", "journal": "Endocrinology", "date": "2004", "authors": "Kanamoto N, Akamizu T, Tagami T, Hataya Y, Moriyama K, Takaya K, Hosoda H, Kojima M, Kangawa K, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15142980", "url": "https://glygen.org/publication/PubMed/15142980" } ] }, { "title": "Ghrelin degradation by serum and tissue homogenates: identification of the cleavage sites.", "journal": "Endocrinology", "date": "2004", "authors": "De Vriese C, Gregoire F, Lema-Kisoka R, Waelbroeck M, Robberecht P, Delporte C", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15256494", "url": "https://glygen.org/publication/PubMed/15256494" } ] }, { "title": "Human adipocyte fatty acid-binding protein (aP2) gene promoter-driven reporter assay discriminates nonlipogenic peroxisome proliferator-activated receptor gamma ligands.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Rival Y, Stennevin A, Puech L, Rouquette A, Cathala C, Lestienne F, Dupont-Passelaigue E, Patoiseau JF, Wurch T, Junquero D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15273253", "url": "https://glygen.org/publication/PubMed/15273253" } ] }, { "title": "Maintenance of pluripotency in human embryonic stem cells is STAT3 independent.", "journal": "Stem cells (Dayton, Ohio)", "date": "2004", "authors": "Humphrey RK, Beattie GM, Lopez AD, Bucay N, King CC, Firpo MT, Rose-John S, Hayek A", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15277698", "url": "https://glygen.org/publication/PubMed/15277698" } ] }, { "title": "Specific knockdown of Oct4 and beta2-microglobulin expression by RNA interference in human embryonic stem cells and embryonic carcinoma cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2004", "authors": "Matin MM, Walsh JR, Gokhale PJ, Draper JS, Bahrami AR, Morton I, Moore HD, Andrews PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15342930", "url": "https://glygen.org/publication/PubMed/15342930" } ] }, { "title": "Direct control of caveolin-1 expression by FOXO transcription factors.", "journal": "The Biochemical journal", "date": "2005", "authors": "van den Heuvel AP, Schulze A, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "15458387", "url": "https://glygen.org/publication/PubMed/15458387" } ] }, { "title": "Comparative transcriptional profiling of two human embryonic stem cell lines.", "journal": "Biotechnology and bioengineering", "date": "2004", "authors": "Rao RR, Calhoun JD, Qin X, Rekaya R, Clark JK, Stice SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15493035", "url": "https://glygen.org/publication/PubMed/15493035" } ] }, { "title": "Oct4 expression in adult human stem cells: evidence in support of the stem cell theory of carcinogenesis.", "journal": "Carcinogenesis", "date": "2005", "authors": "Tai MH, Chang CC, Kiupel M, Webster JD, Olson LK, Trosko JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15513931", "url": "https://glygen.org/publication/PubMed/15513931" } ] }, { "title": "The leukocyte integrin gene CD11d is repressed by gut-enriched Kruppel-like factor 4 in myeloid cells.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Noti JD, Johnson AK, Dillon JD", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "15561714", "url": "https://glygen.org/publication/PubMed/15561714" } ] }, { "title": "Pluripotential competence of cells associated with Nanog activity.", "journal": "Mechanisms of development", "date": "2005", "authors": "Hatano SY, Tada M, Kimura H, Yamaguchi S, Kono T, Nakano T, Suemori H, Nakatsuji N, Tada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15582778", "url": "https://glygen.org/publication/PubMed/15582778" } ] }, { "title": "Characterization and regulation of the rat and human ghrelin promoters.", "journal": "Endocrinology", "date": "2005", "authors": "Wei W, Wang G, Qi X, Englander EW, Greeley GH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "15604212", "url": "https://glygen.org/publication/PubMed/15604212" } ] }, { "title": "Stably transfected human embryonic stem cell clones express OCT4-specific green fluorescent protein and maintain self-renewal and pluripotency.", "journal": "Stem cells (Dayton, Ohio)", "date": "2005", "authors": "Gerrard L, Zhao D, Clark AJ, Cui W", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15625129", "url": "https://glygen.org/publication/PubMed/15625129" } ] }, { "title": "Oct-4 mRNA and protein expression during human preimplantation development.", "journal": "Molecular human reproduction", "date": "2005", "authors": "Cauffman G, Van de Velde H, Liebaers I, Van Steirteghem A", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15695770", "url": "https://glygen.org/publication/PubMed/15695770" } ] }, { "title": "Octamer and Sox elements are required for transcriptional cis regulation of Nanog gene expression.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Kuroda T, Tada M, Kubota H, Kimura H, Hatano SY, Suemori H, Nakatsuji N, Tada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15743839", "url": "https://glygen.org/publication/PubMed/15743839" } ] }, { "title": "Identification of the promoter region required for human adiponectin gene transcription: Association with CCAAT/enhancer binding protein-beta and tumor necrosis factor-alpha.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kita A, Yamasaki H, Kuwahara H, Moriuchi A, Fukushima K, Kobayashi M, Fukushima T, Takahashi R, Abiru N, Uotani S, Kawasaki E, Eguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15850785", "url": "https://glygen.org/publication/PubMed/15850785" } ] }, { "title": "Transcriptional regulation of nanog by OCT4 and SOX2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Rodda DJ, Chew JL, Lim LH, Loh YH, Wang B, Ng HH, Robson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15860457", "url": "https://glygen.org/publication/PubMed/15860457" } ] }, { "title": "C/EBPalpha regulates human adiponectin gene transcription through an intronic enhancer.", "journal": "Diabetes", "date": "2005", "authors": "Qiao L, Maclean PS, Schaack J, Orlicky DJ, Darimont C, Pagliassotti M, Friedman JE, Shao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15919796", "url": "https://glygen.org/publication/PubMed/15919796" } ] }, { "title": "Downregulation of NANOG induces differentiation of human embryonic stem cells to extraembryonic lineages.", "journal": "Stem cells (Dayton, Ohio)", "date": "2005", "authors": "Hyslop L, Stojkovic M, Armstrong L, Walter T, Stojkovic P, Przyborski S, Herbert M, Murdoch A, Strachan T, Lako M", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15983365", "url": "https://glygen.org/publication/PubMed/15983365" } ] }, { "title": "Reciprocal transcriptional regulation of Pou5f1 and Sox2 via the Oct4/Sox2 complex in embryonic stem cells.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Chew JL, Loh YH, Zhang W, Chen X, Tam WL, Yeap LS, Li P, Ang YS, Lim B, Robson P, Ng HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "15988017", "url": "https://glygen.org/publication/PubMed/15988017" } ] }, { "title": "Core transcriptional regulatory circuitry in human embryonic stem cells.", "journal": "Cell", "date": "2005", "authors": "Boyer LA, Lee TI, Cole MF, Johnstone SE, Levine SS, Zucker JP, Guenther MG, Kumar RM, Murray HL, Jenner RG, Gifford DK, Melton DA, Jaenisch R, Young RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "16153702", "url": "https://glygen.org/publication/PubMed/16153702" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Characterization and gene expression profiling of five new human embryonic stem cell lines derived in Taiwan.", "journal": "Stem cells and development", "date": "2006", "authors": "Li SS, Liu YH, Tseng CN, Chung TL, Lee TY, Singh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "16978057", "url": "https://glygen.org/publication/PubMed/16978057" } ] }, { "title": "Transcriptional control of adipocyte formation.", "journal": "Cell metabolism", "date": "2006", "authors": "Farmer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17011499", "url": "https://glygen.org/publication/PubMed/17011499" } ] }, { "title": "Analysis of Oct4-dependent transcriptional networks regulating self-renewal and pluripotency in human embryonic stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2007", "authors": "Babaie Y, Herwig R, Greber B, Brink TC, Wruck W, Groth D, Lehrach H, Burdon T, Adjaye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17068183", "url": "https://glygen.org/publication/PubMed/17068183" } ] }, { "title": "A meta-analysis of human embryonic stem cells transcriptome integrated into a web-based expression atlas.", "journal": "Stem cells (Dayton, Ohio)", "date": "2007", "authors": "Assou S, Le Carrour T, Tondeur S, Strom S, Gabelle A, Marty S, Nadal L, Pantesco V, Reme T, Hugnot JP, Gasca S, Hovatta O, Hamamah S, Klein B, De Vos J", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17204602", "url": "https://glygen.org/publication/PubMed/17204602" } ] }, { "title": "Zic3 is required for maintenance of pluripotency in embryonic stem cells.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Lim LS, Loh YH, Zhang W, Li Y, Chen X, Wang Y, Bakre M, Ng HH, Stanton LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17267691", "url": "https://glygen.org/publication/PubMed/17267691" } ] }, { "title": "Ghrelin interacts with human plasma lipoproteins.", "journal": "Endocrinology", "date": "2007", "authors": "De Vriese C, Hacquebard M, Gregoire F, Carpentier Y, Delporte C", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "17289852", "url": "https://glygen.org/publication/PubMed/17289852" } ] }, { "title": "Human mucin 1 oncoprotein represses transcription of the p53 tumor suppressor gene.", "journal": "Cancer research", "date": "2007-02-15", "authors": "Wei Xiaolong, Xu Hai, Kufe Donald", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "17308127", "url": "https://glygen.org/publication/PubMed/17308127" } ] }, { "title": "Nine-amino-acid transactivation domain: establishment and prediction utilities.", "journal": "Genomics", "date": "2007", "authors": "Piskacek Simona, Gregor Martin, Nemethova Maria, Grabner Martin, Kovarik Pavel, Piskacek Martin", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "17467953", "url": "https://glygen.org/publication/PubMed/17467953" } ] }, { "title": "Silencing of core transcription factors in human EC cells highlights the importance of autocrine FGF signaling for self-renewal.", "journal": "BMC developmental biology", "date": "2007", "authors": "Greber B, Lehrach H, Adjaye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17506876", "url": "https://glygen.org/publication/PubMed/17506876" } ] }, { "title": "Identification of an OCT4 and SRY regulatory module using integrated computational and experimental genomics approaches.", "journal": "Genome research", "date": "2007", "authors": "Jin VX, O'Geen H, Iyengar S, Green R, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17567999", "url": "https://glygen.org/publication/PubMed/17567999" } ] }, { "title": "Characterization of human embryonic stem cell lines by the International Stem Cell Initiative.", "journal": "Nature biotechnology", "date": "2007", "authors": "Adewumi O, Aflatoonian B, Ahrlund-Richter L, Amit M, Andrews PW, Beighton G, Bello PA, Benvenisty N, Berry LS, Bevan S, Blum B, Brooking J, Chen KG, Choo AB, Churchill GA, Corbel M, Damjanov I, Draper JS, Dvorak P, Emanuelsson K, Fleck RA, Ford A, Gertow K, Gertsenstein M, Gokhale PJ, Hamilton RS, Hampl A, Healy LE, Hovatta O, Hyllner J, Imreh MP, Itskovitz-Eldor J, Jackson J, Johnson JL, Jones M, Kee K, King BL, Knowles BB, Lako M, Lebrin F, Mallon BS, Manning D, Mayshar Y, McKay RD, Michalska AE, Mikkola M, Mileikovsky M, Minger SL, Moore HD, Mummery CL, Nagy A, Nakatsuji N, O'Brien CM, Oh SK, Olsson C, Otonkoski T, Park KY, Passier R, Patel H, Patel M, Pedersen R, Pera MF, Piekarczyk MS, Pera RA, Reubinoff BE, Robins AJ, Rossant J, Rugg-Gunn P, Schulz TC, Semb H, Sherrer ES, Siemen H, Stacey GN, Stojkovic M, Suemori H, Szatkiewicz J, Turetsky T, Tuuri T, van den Brink S, Vintersten K, Vuoristo S, Ward D, Weaver TA, Young LA, Zhang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17572666", "url": "https://glygen.org/publication/PubMed/17572666" } ] }, { "title": "Ghrelin and motilin are cosecreted from a prominent endocrine cell population in the small intestine.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2007", "authors": "Wierup N, Bjorkqvist M, Westrom B, Pierzynowski S, Sundler F, Sjolund K", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "17595255", "url": "https://glygen.org/publication/PubMed/17595255" } ] }, { "title": "Zfp206 is a transcription factor that controls pluripotency of embryonic stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2007", "authors": "Wang ZX, Kueh JL, Teh CH, Rossbach M, Lim L, Li P, Wong KY, Lufkin T, Robson P, Stanton LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "17628018", "url": "https://glygen.org/publication/PubMed/17628018" } ] }, { "title": "Effect of heterodimer partner RXRalpha on PPARgamma activation function-2 helix in solution.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Lu J, Chen M, Stanley SE, Li E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17980149", "url": "https://glygen.org/publication/PubMed/17980149" } ] }, { "title": "Induced pluripotent stem cell lines derived from human somatic cells.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Yu J, Vodyanik MA, Smuga-Otto K, Antosiewicz-Bourget J, Frane JL, Tian S, Nie J, Jonsdottir GA, Ruotti V, Stewart R, Slukvin II, Thomson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "18029452", "url": "https://glygen.org/publication/PubMed/18029452" } ] }, { "title": "Induction of pluripotent stem cells from adult human fibroblasts by defined factors.", "journal": "Cell", "date": "2007", "authors": "Takahashi K, Tanabe K, Ohnuki M, Narita M, Ichisaka T, Tomoda K, Yamanaka S", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" }, { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "18035408", "url": "https://glygen.org/publication/PubMed/18035408" } ] }, { "title": "High-throughput biochemical analysis of in vivo location data reveals novel distinct classes of POU5F1(Oct4)/DNA complexes.", "journal": "Genome research", "date": "2008", "authors": "Tantin D, Gemberling M, Callister C, Fairbrother WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "18212089", "url": "https://glygen.org/publication/PubMed/18212089" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "Ghrelin, des-acyl ghrelin and obestatin: three pieces of the same puzzle.", "journal": "Peptides", "date": "2008", "authors": "Soares JB, Leite-Moreira AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "18396350", "url": "https://glygen.org/publication/PubMed/18396350" } ] }, { "title": "Ghrelin octanoylation mediated by an orphan lipid transferase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Gutierrez JA, Solenberg PJ, Perkins DR, Willency JA, Knierman MD, Jin Z, Witcher DR, Luo S, Onyia JE, Hale JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "18443287", "url": "https://glygen.org/publication/PubMed/18443287" } ] }, { "title": "Wild-type APC regulates caveolin-1 expression in human colon adenocarcinoma cell lines via FOXO1a and C-myc.", "journal": "Molecular carcinogenesis", "date": "2008", "authors": "Roy UK, Henkhaus RS, Ignatenko NA, Mora J, Fultz KE, Gerner EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "18444242", "url": "https://glygen.org/publication/PubMed/18444242" } ] }, { "title": "Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells.", "journal": "Proteomics", "date": "2008", "authors": "Tan Fengwei, Lu Lifang, Cai Yun, Wang Jinglan, Xie Yunfei, Wang Lin, Gong Yanhua, Xu Bing-E, Wu Jun, Luo Ying, Qiang Boqin, Yuan Jiangang, Sun Xiaoqing, Peng Xiaozhong", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "18655026", "url": "https://glygen.org/publication/PubMed/18655026" } ] }, { "title": "Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos.", "journal": "Human reproduction (Oxford, England)", "date": "2009", "authors": "Cauffman G, De Rycke M, Sermon K, Liebaers I, Van de Velde H", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "18824471", "url": "https://glygen.org/publication/PubMed/18824471" } ] }, { "title": "Identification of a novel distal enhancer in human adiponectin gene.", "journal": "The Journal of endocrinology", "date": "2009", "authors": "Segawa K, Matsuda M, Fukuhara A, Morita K, Okuno Y, Komuro R, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "18931025", "url": "https://glygen.org/publication/PubMed/18931025" } ] }, { "title": "Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.", "journal": "Nature", "date": "2008", "authors": "Chandra V, Huang P, Hamuro Y, Raghuram S, Wang Y, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19043829", "url": "https://glygen.org/publication/PubMed/19043829" } ] }, { "title": "A-FABP, a candidate progression marker of human transitional cell carcinoma of the bladder, is differentially regulated by PPAR in urothelial cancer cells.", "journal": "International journal of cancer", "date": "2009", "authors": "Boiteux G, Lascombe I, Roche E, Plissonnier ML, Clairotte A, Bittard H, Fauconnet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19115207", "url": "https://glygen.org/publication/PubMed/19115207" } ] }, { "title": "Signal transducer and activator of transcription 3 is a transcriptional factor regulating the gene expression of SALL4.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Bard JD, Gelebart P, Amin HM, Young LC, Ma Y, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19151334", "url": "https://glygen.org/publication/PubMed/19151334" } ] }, { "title": "Structural basis for the activation of PPARgamma by oxidized fatty acids.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Itoh T, Fairall L, Amin K, Inaba Y, Szanto A, Balint BL, Nagy L, Yamamoto K, Schwabe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19172745", "url": "https://glygen.org/publication/PubMed/19172745" } ] }, { "title": "Ghrelin fluctuation, what determines its production?", "journal": "Acta biochimica et biophysica Sinica", "date": "2009", "authors": "Yin X, Li Y, Xu G, An W, Zhang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "19280057", "url": "https://glygen.org/publication/PubMed/19280057" } ] }, { "title": "KLF4 positively regulates human ghrelin expression.", "journal": "The Biochemical journal", "date": "2009", "authors": "Lee HJ, Kang YM, Moon CS, Joe MK, Lim JH, Suh YH, Song J, Jung MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "19327128", "url": "https://glygen.org/publication/PubMed/19327128" } ] }, { "title": "Isolation and characterization of stem cells from the human parathyroid gland.", "journal": "Cell proliferation", "date": "2009", "authors": "Shih YR, Kuo TK, Yang AH, Lee OK, Lee CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19489980", "url": "https://glygen.org/publication/PubMed/19489980" } ] }, { "title": "KLF4 and PBX1 directly regulate NANOG expression in human embryonic stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2009", "authors": "Chan KK, Zhang J, Chia NY, Chan YS, Sim HS, Tan KS, Oh SK, Ng HH, Choo AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19522013", "url": "https://glygen.org/publication/PubMed/19522013" } ] }, { "title": "In silico identification of a core regulatory network of OCT4 in human embryonic stem cells using an integrated approach.", "journal": "BMC genomics", "date": "2009", "authors": "Chavez L, Bais AS, Vingron M, Lehrach H, Adjaye J, Herwig R", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19604364", "url": "https://glygen.org/publication/PubMed/19604364" } ] }, { "title": "Production of n-octanoyl-modified ghrelin in cultured cells requires prohormone processing protease and ghrelin O-acyltransferase, as well as n-octanoic acid.", "journal": "Journal of biochemistry", "date": "2009", "authors": "Takahashi T, Ida T, Sato T, Nakashima Y, Nakamura Y, Tsuji A, Kojima M", "evidence": [ { "database": "Reactome", "id": "R-HSA-422085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085" } ], "reference": [ { "type": "PubMed", "id": "19628676", "url": "https://glygen.org/publication/PubMed/19628676" } ] }, { "title": "Signaling pathways controlling pluripotency and early cell fate decisions of human induced pluripotent stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2009", "authors": "Vallier L, Touboul T, Brown S, Cho C, Bilican B, Alexander M, Cedervall J, Chandran S, Ahrlund-Richter L, Weber A, Pedersen RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19688839", "url": "https://glygen.org/publication/PubMed/19688839" } ] }, { "title": "Hypoxia inducible factors regulate pluripotency and proliferation in human embryonic stem cells cultured at reduced oxygen tensions.", "journal": "Reproduction (Cambridge, England)", "date": "2010", "authors": "Forristal CE, Wright KL, Hanley NA, Oreffo RO, Houghton FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19755485", "url": "https://glygen.org/publication/PubMed/19755485" } ] }, { "title": "Human DNA methylomes at base resolution show widespread epigenomic differences.", "journal": "Nature", "date": "2009", "authors": "Lister R, Pelizzola M, Dowen RH, Hawkins RD, Hon G, Tonti-Filippini J, Nery JR, Lee L, Ye Z, Ngo QM, Edsall L, Antosiewicz-Bourget J, Stewart R, Ruotti V, Millar AH, Thomson JA, Ren B, Ecker JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19829295", "url": "https://glygen.org/publication/PubMed/19829295" } ] }, { "title": "Lin28-mediated post-transcriptional regulation of Oct4 expression in human embryonic stem cells.", "journal": "Nucleic acids research", "date": "2010", "authors": "Qiu C, Ma Y, Wang J, Peng S, Huang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "19966271", "url": "https://glygen.org/publication/PubMed/19966271" } ] }, { "title": "Reprogramming towards pluripotency requires AID-dependent DNA demethylation.", "journal": "Nature", "date": "2010", "authors": "Bhutani N, Brady JJ, Damian M, Sacco A, Corbel SY, Blau HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "20027182", "url": "https://glygen.org/publication/PubMed/20027182" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" }, { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Kruppel-like factor 4 (Klf4) prevents embryonic stem (ES) cell differentiation by regulating Nanog gene expression.", "journal": "The Journal of biological chemistry", "date": "2010-03-19", "authors": "Zhang Peilin, Andrianakos Rose, Yang Yang, Liu Chunming, Lu Wange", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "20071344", "url": "https://glygen.org/publication/PubMed/20071344" } ] }, { "title": "Human fetal mesenchymal stem cells differentiate into brown and white adipocytes: a role for ERRalpha in human UCP1 expression.", "journal": "Cell research", "date": "2010", "authors": "Morganstein DL, Wu P, Mane MR, Fisk NM, White R, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "20101261", "url": "https://glygen.org/publication/PubMed/20101261" } ] }, { "title": "A data integration approach to mapping OCT4 gene regulatory networks operative in embryonic stem cells and embryonal carcinoma cells.", "journal": "PloS one", "date": "2010", "authors": "Jung M, Peterson H, Chavez L, Kahlem P, Lehrach H, Vilo J, Adjaye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "20505756", "url": "https://glygen.org/publication/PubMed/20505756" } ] }, { "title": "A novel SALL4/OCT4 transcriptional feedback network for pluripotency of embryonic stem cells.", "journal": "PloS one", "date": "2010", "authors": "Yang J, Gao C, Chai L, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "20505821", "url": "https://glygen.org/publication/PubMed/20505821" } ] }, { "title": "Differential roles of Sall4 isoforms in embryonic stem cell pluripotency.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Rao S, Zhen S, Roumiantsev S, McDonald LT, Yuan GC, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "20837710", "url": "https://glygen.org/publication/PubMed/20837710" } ] }, { "title": "A genome-wide RNAi screen reveals determinants of human embryonic stem cell identity.", "journal": "Nature", "date": "2010", "authors": "Chia NY, Chan YS, Feng B, Lu X, Orlov YL, Moreau D, Kumar P, Yang L, Jiang J, Lau MS, Huss M, Soh BS, Kraus P, Li P, Lufkin T, Lim B, Clarke ND, Bard F, Ng HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "20953172", "url": "https://glygen.org/publication/PubMed/20953172" } ] }, { "title": "Activin/Nodal signaling controls divergent transcriptional networks in human embryonic stem cells and in endoderm progenitors.", "journal": "Stem cells (Dayton, Ohio)", "date": "2011", "authors": "Brown S, Teo A, Pauklin S, Hannan N, Cho CH, Lim B, Vardy L, Dunn NR, Trotter M, Pedersen R, Vallier L", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "21630377", "url": "https://glygen.org/publication/PubMed/21630377" } ] }, { "title": "Direct reprogramming of somatic cells is promoted by maternal transcription factor Glis1.", "journal": "Nature", "date": "2011", "authors": "Maekawa M, Yamaguchi K, Nakamura T, Shibukawa R, Kodanaka I, Ichisaka T, Kawamura Y, Mochizuki H, Goshima N, Yamanaka S", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "21654807", "url": "https://glygen.org/publication/PubMed/21654807" } ] }, { "title": "Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.", "journal": "Mol. Cell. Biol.", "date": "2011", "authors": "Bjerke GA, Hyman-Walsh C, Wotton D", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "21746878", "url": "https://glygen.org/publication/PubMed/21746878" } ] }, { "title": "An alternative splicing switch regulates embryonic stem cell pluripotency and reprogramming.", "journal": "Cell", "date": "2011", "authors": "Gabut M, Samavarchi-Tehrani P, Wang X, Slobodeniuc V, O'Hanlon D, Sung HK, Alvarez M, Talukder S, Pan Q, Mazzoni EO, Nedelec S, Wichterle H, Woltjen K, Hughes TR, Zandstra PW, Nagy A, Wrana JL, Blencowe BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "21924763", "url": "https://glygen.org/publication/PubMed/21924763" } ] }, { "title": "Determinants of mRNA recognition and translation regulation by Lin28.", "journal": "Nucleic acids research", "date": "2012", "authors": "Lei XX, Xu J, Ma W, Qiao C, Newman MA, Hammond SM, Huang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "22210884", "url": "https://glygen.org/publication/PubMed/22210884" } ] }, { "title": "Combinatorial binding in human and mouse embryonic stem cells identifies conserved enhancers active in early embryonic development.", "journal": "PLoS computational biology", "date": "2011", "authors": "Goke J, Jung M, Behrens S, Chavez L, O'Keeffe S, Timmermann B, Lehrach H, Adjaye J, Vingron M", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "22215994", "url": "https://glygen.org/publication/PubMed/22215994" } ] }, { "title": "Control of ground-state pluripotency by allelic regulation of Nanog.", "journal": "Nature", "date": "2012", "authors": "Miyanari Y, Torres-Padilla ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "22327294", "url": "https://glygen.org/publication/PubMed/22327294" } ] }, { "title": "Zfp281 mediates Nanog autorepression through recruitment of the NuRD complex and inhibits somatic cell reprogramming.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Fidalgo M, Faiola F, Pereira CF, Ding J, Saunders A, Gingold J, Schaniel C, Lemischka IR, Silva JC, Wang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "22988117", "url": "https://glygen.org/publication/PubMed/22988117" } ] }, { "title": "Shaking the family tree: Identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors.", "journal": "FASEB J.", "date": "2013", "authors": "Camacho-Vanegas Olga, Till Jacob, Miranda-Lorenzo Irene, Ozturk Berrin, Camacho Sandra Catalina, Martignetti John A", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "23134681", "url": "https://glygen.org/publication/PubMed/23134681" } ] }, { "title": "OCT4/SOX2-independent Nanog autorepression modulates heterogeneous Nanog gene expression in mouse ES cells.", "journal": "The EMBO journal", "date": "2012", "authors": "Navarro P, Festuccia N, Colby D, Gagliardi A, Mullin NP, Zhang W, Karwacki-Neisius V, Osorno R, Kelly D, Robertson M, Chambers I", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "23178592", "url": "https://glygen.org/publication/PubMed/23178592" } ] }, { "title": "A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPARgamma and C/EBPalpha.", "journal": "Journal of bioenergetics and biomembranes", "date": "2013", "authors": "Ni Y, Ji C, Wang B, Qiu J, Wang J, Guo X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "23239344", "url": "https://glygen.org/publication/PubMed/23239344" } ] }, { "title": "FoxO3a (Forkhead Box O3a) deficiency protects Idiopathic Pulmonary Fibrosis (IPF) fibroblasts from type I polymerized collagen matrix-induced apoptosis via caveolin-1 (cav-1) and Fas.", "journal": "PloS one", "date": "2013", "authors": "Nho RS, Peterson M, Hergert P, Henke CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "23580232", "url": "https://glygen.org/publication/PubMed/23580232" } ] }, { "title": "Biallelic expression of nanog protein in mouse embryonic stem cells.", "journal": "Cell stem cell", "date": "2013", "authors": "Filipczyk A, Gkatzis K, Fu J, Hoppe PS, Lickert H, Anastassiadis K, Schroeder T", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "23827706", "url": "https://glygen.org/publication/PubMed/23827706" } ] }, { "title": "Single-cell analysis reveals that expression of nanog is biallelic and equally variable as that of other pluripotency factors in mouse ESCs.", "journal": "Cell stem cell", "date": "2013", "authors": "Faddah DA, Wang H, Cheng AW, Katz Y, Buganim Y, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "23827708", "url": "https://glygen.org/publication/PubMed/23827708" } ] }, { "title": "Forkhead box O1 (FOXO1) protein, but not p53, contributes to robust induction of p21 expression in fasted mice.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Tinkum KL, White LS, Marpegan L, Herzog E, Piwnica-Worms D, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "23918930", "url": "https://glygen.org/publication/PubMed/23918930" } ] }, { "title": "The estrogen receptor alpha is the key regulator of the bifunctional role of FoxO3a transcription factor in breast cancer motility and invasiveness.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2013", "authors": "Sisci D, Maris P, Cesario MG, Anselmo W, Coroniti R, Trombino GE, Romeo F, Ferraro A, Lanzino M, Aquila S, Maggiolini M, Mauro L, Morelli C, Ando S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "24047697", "url": "https://glygen.org/publication/PubMed/24047697" } ] }, { "title": "Acetylation-dependent regulation of essential iPS-inducing factors: a regulatory crossroad for pluripotency and tumorigenesis.", "journal": "Cancer medicine", "date": "2014", "authors": "Dai X, Liu P, Lau AW, Liu Y, Inuzuka H", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" } ], "reference": [ { "type": "PubMed", "id": "25116380", "url": "https://glygen.org/publication/PubMed/25116380" } ] }, { "title": "Knockdown of transcription factor forkhead box O3 (FOXO3) suppresses erythroid differentiation in human cells and zebrafish.", "journal": "Biochemical and biophysical research communications", "date": "2015", "authors": "Wang H, Li Y, Wang S, Zhang Q, Zheng J, Yang Y, Qi H, Qu H, Zhang Z, Liu F, Fang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9617828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828" } ], "reference": [ { "type": "PubMed", "id": "25843800", "url": "https://glygen.org/publication/PubMed/25843800" } ] }, { "title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2018", "authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43474", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43474" } ], "reference": [ { "type": "PubMed", "id": "29237092", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "title": "KLF4 Nuclear Export Requires ERK Activation and Initiates Exit from Naive Pluripotency.", "journal": "Stem cell reports", "date": "2018", "authors": "Dhaliwal NK, Miri K, Davidson S, Tamim El Jarkass H, Mitchell JA", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" } ], "reference": [ { "type": "PubMed", "id": "29526737", "url": "https://glygen.org/publication/PubMed/29526737" } ] }, { "title": "Klf4 glutamylation is required for cell reprogramming and early embryonic development in mice.", "journal": "Nat. Commun.", "date": "2018", "authors": "Ye B, Liu B, Hao L, Zhu X, Yang L, Wang S, Xia P, Du Y, Meng S, Huang G, Qin X, Wang Y, Yan X, Li C, Hao J, Zhu P, He L, Tian Y, Fan Z", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "29593216", "url": "https://glygen.org/publication/PubMed/29593216" } ] }, { "title": "Polo-Like Kinase 1 phosphorylates and stabilizes KLF4 to promote tumorigenesis in nasopharyngeal carcinoma.", "journal": "Theranostics", "date": "2019", "authors": "Mai J, Zhong ZY, Guo GF, Chen XX, Xiang YQ, Li X, Zhang HL, Chen YH, Xu XL, Wu RY, Yu Y, Li ZL, Peng XD, Huang Y, Zhou LH, Feng GK, Guo X, Deng R, Zhu XF", "evidence": [ { "database": "iPTMnet", "id": "O43474", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43474" } ], "reference": [ { "type": "PubMed", "id": "31281496", "url": "https://glygen.org/publication/PubMed/31281496" } ] }, { "title": "The evolution of the 9aaTAD domain in Sp2 proteins: inactivation with valines and intron reservoirs.", "journal": "Cell. Mol. Life Sci.", "date": "2020", "authors": "Piskacek Martin, Havelka Marek, Jendruchova Kristina, Knight Andrea, Keegan Liam P", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "31375868", "url": "https://glygen.org/publication/PubMed/31375868" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43474", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43474" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "LETMD1, a target of KLF4, hinders endothelial inflammation and pyroptosis: A protective mechanism in the pathogenesis of atherosclerosis.", "journal": "Cellular signalling", "date": "2023-09-26", "authors": "Xing Zeyu, Du Mingyang, Zhen Yanhua, Chen Jie, Li Dongdong, Liu Ruyin, Zheng Jiahe", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "37769890", "url": "https://glygen.org/publication/PubMed/37769890" } ] }, { "title": "KLF4 suppresses the proliferation of perihilar cholangiocarcinoma by negatively regulating GDF15 and phosphorylating AKT.", "journal": "Oncology reports", "date": "2023-12", "authors": "Zhang Xiaoming, Wang Weijia, Lu Chunlei, Zhang Haifeng", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "37937607", "url": "https://glygen.org/publication/PubMed/37937607" } ] }, { "title": "Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer.", "journal": "Medicine", "date": "2023-12-01", "authors": "Hong Liwei, Hong Sijie, Zhang Xueqin", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "38050242", "url": "https://glygen.org/publication/PubMed/38050242" } ] }, { "title": "MicroRNA-29a-3p Accelerates Inflammatory Damage in Neonatal Pneumonia Via Targeting Kr\u00fcppel-like Factor 4.", "journal": "Iranian journal of allergy, asthma, and immunology", "date": "2023-10-29", "authors": "Xu Xiao Juan, Liu Wei, Liland ShiNa", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "38085146", "url": "https://glygen.org/publication/PubMed/38085146" } ] }, { "title": "Insulin-responsive human adipocytes express two glucose transporter isoforms and target them to different vesicles.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Pilch PF, Wilkinson W, Garvey WT, Ciaraldi TP, Hueckstaedt TP, Olefsky JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8325954", "url": "https://glygen.org/publication/PubMed/8325954" } ] }, { "title": "The adipocyte specific transcription factor C/EBPalpha modulates human ob gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Miller SG, De Vos P, Guerre-Millo M, Wong K, Hermann T, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8643605", "url": "https://glygen.org/publication/PubMed/8643605" } ] }, { "title": "Identification and characterization of a gene encoding a gut-enriched Kruppel-like factor expressed during growth arrest.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Shields JM, Christy RJ, Yang VW", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "8702718", "url": "https://glygen.org/publication/PubMed/8702718" } ] }, { "title": "A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Lambe KG, Tugwood JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8706692", "url": "https://glygen.org/publication/PubMed/8706692" } ] }, { "title": "Thiazolidinediones repress ob gene expression in rodents via activation of peroxisome proliferator-activated receptor gamma.", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "De Vos P, Lefebvre AM, Miller SG, Guerre-Millo M, Wong K, Saladin R, Hamann LG, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8770873", "url": "https://glygen.org/publication/PubMed/8770873" } ] }, { "title": "Peroxisome proliferator-activated receptors: a nuclear receptor signaling pathway in lipid physiology.", "journal": "Annual review of cell and developmental biology", "date": "1996", "authors": "Lemberger T, Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8970730", "url": "https://glygen.org/publication/PubMed/8970730" } ] }, { "title": "Endothelial PAS domain protein 1 (EPAS1), a transcription factor selectively expressed in endothelial cells.", "journal": "Genes & development", "date": "1997", "authors": "Tian H, McKnight SL, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-452723", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723" } ], "reference": [ { "type": "PubMed", "id": "9000051", "url": "https://glygen.org/publication/PubMed/9000051" } ] }, { "title": "Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mukherjee R, Jow L, Croston GE, Paterniti JR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9065481", "url": "https://glygen.org/publication/PubMed/9065481" } ] }, { "title": "Two potent nuclear localization signals in the gut-enriched Kruppel-like factor define a subfamily of closely related Kruppel proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Shields JM, Yang VW", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "9218496", "url": "https://glygen.org/publication/PubMed/9218496" } ] }, { "title": "Human EZF, a Kruppel-like zinc finger protein, is expressed in vascular endothelial cells and contains transcriptional activation and repression domains.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Yet S F, McA'Nulty M M, Folta S C, Yen H W, Yoshizumi M, Hsieh C M, Layne M D, Chin M T, Wang H, Perrella M A, Jain M K, Lee M E", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "reference": [ { "type": "PubMed", "id": "9422764", "url": "https://glygen.org/publication/PubMed/9422764" } ] }, { "title": "Expression of the gut-enriched Kruppel-like factor gene during development and intestinal tumorigenesis.", "journal": "FEBS letters", "date": "1997", "authors": "Ton-That H, Kaestner KH, Shields JM, Mahatanankoon CS, Yang VW", "evidence": [ { "database": "RefSeq", "id": "NP_001300981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300981" } ], "reference": [ { "type": "PubMed", "id": "9428642", "url": "https://glygen.org/publication/PubMed/9428642" } ] }, { "title": "Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1998", "authors": "Young PW, Buckle DR, Cantello BC, Chapman H, Clapham JC, Coyle PJ, Haigh D, Hindley RM, Holder JC, Kallender H, Latter AJ, Lawrie KW, Mossakowska D, Murphy GJ, Roxbee Cox L, Smith SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9454824", "url": "https://glygen.org/publication/PubMed/9454824" } ] }, { "title": "N-(2-Benzoylphenyl)-L-tyrosine PPARgamma agonists. 1. Discovery of a novel series of potent antihyperglycemic and antihyperlipidemic agents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Henke BR, Blanchard SG, Brackeen MF, Brown KK, Cobb JE, Collins JL, Harrington WW Jr, Hashim MA, Hull-Ryde EA, Kaldor I, Kliewer SA, Lake DH, Leesnitzer LM, Lehmann JM, Lenhard JM, Orband-Miller LA, Miller JF, Mook RA Jr, Noble SA, Oliver W Jr, Parks DJ, Plunket KD, Szewczyk JR, Willson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9836620", "url": "https://glygen.org/publication/PubMed/9836620" } ] } ], "pathway": [ { "id": "hsa:9314", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9314", "resource": "KEGG Pathway" }, { "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "description": "Transcriptional regulation of white adipocyte differentiation" }, { "id": "R-HSA-422085", "name": "Synthesis, secretion, and deacylation of Ghrelin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-422085", "resource": "Reactome", "description": "Synthesis, secretion, and deacylation of Ghrelin" }, { "id": "R-HSA-452723", "name": "Transcriptional regulation of pluripotent stem cells", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-452723", "resource": "Reactome", "description": "Transcriptional regulation of pluripotent stem cells" }, { "id": "R-HSA-9617828", "name": "FOXO-mediated transcription of cell cycle genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9617828", "resource": "Reactome", "description": "FOXO-mediated transcription of cell cycle genes" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZW83-1", "protein_name": "Kruppel like factor 4", "gene_name": "Klf4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGEDWWETSEQWPGCPLTPGLCAPRPARRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSHMKRLPPLPGRPYDLAATVATDLESGGAGAACSSNNPALPRRETEEFNDLLDLDFILSNSLSHQESVAATVTTSASASSSSSPASSGPASAPSTCSFSYPIRAGGDPGVAAGNTGGGLLYSRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSTPGSEYTSPSVISVSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSNGHRPNTHDFPLGRQLPTRTTPTLSPEELLNSRDCHPGLPLPPGFHPHPGPSYPPFLPDQMQSQVPSLHYQELMPPGSCLPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF", "length": 509 }, "evidence": [ { "id": "45923955", "url": "http://www.informatics.jax.org/homology/45923955", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q60793-1", "protein_name": "Krueppel-like factor 4", "gene_name": "Klf4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSHMKRLPPLPGRPYDLAATVATDLESGGAGAACSSNNPALLARRETEEFNDLLDLDFILSNSLTHQESVAATVTTSASASSSSSPASSGPASAPSTCSFSYPIRAGGDPGVAASNTGGGLLYSRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLTTPGSEYSSPSVISVSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSNGHRPNTHDFPLGRQLPTRTTPTLSPEELLNSRDCHPGLPLPPGFHPHPGPNYPPFLPDQMQSQVPSLHYQELMPPGSCLPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF", "length": 483 }, "evidence": [ { "id": "45923955", "url": "http://www.informatics.jax.org/homology/45923955", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 49, "go_terms": [ { "name": "positive regulation of sprouting angiogenesis", "id": "GO:1903672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903672", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "epidermal cell differentiation", "id": "GO:0009913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009913", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "glandular epithelial cell differentiation", "id": "GO:0002067", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002067", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "regulation of axon regeneration", "id": "GO:0048679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048679", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to cycloheximide", "id": "GO:0071409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071409", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of leukocyte adhesion to arterial endothelial cell", "id": "GO:1904998", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904998", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of chemokine (C-X-C motif) ligand 2 production", "id": "GO:2000342", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000342", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of cell migration involved in sprouting angiogenesis", "id": "GO:0090051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090051", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of nitric oxide biosynthetic process", "id": "GO:0045429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045429", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of protein metabolic process", "id": "GO:0051247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051247", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "establishment of skin barrier", "id": "GO:0061436", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061436", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to retinoic acid", "id": "GO:0071300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071300", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043154", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of NF-kappaB transcription factor activity", "id": "GO:0032088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032088", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of telomerase activity", "id": "GO:0051973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051973", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to growth factor stimulus", "id": "GO:0071363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071363", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to hydrogen peroxide", "id": "GO:0070301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070301", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "stem cell population maintenance", "id": "GO:0019827", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019827", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "regulation of cell differentiation", "id": "GO:0045595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045595", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of hemoglobin biosynthetic process", "id": "GO:0046985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046985", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of smooth muscle cell proliferation", "id": "GO:0048662", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048662", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "canonical Wnt signaling pathway", "id": "GO:0060070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060070", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to peptide", "id": "GO:1901653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901653", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of heterotypic cell-cell adhesion", "id": "GO:0034115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034115", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of response to cytokine stimulus", "id": "GO:0060761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060761", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000134", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cellular response to laminar fluid shear stress", "id": "GO:0071499", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071499", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "negative regulation of interleukin-8 production", "id": "GO:0032717", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032717", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "somatic stem cell population maintenance", "id": "GO:0035019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035019", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "mesodermal cell fate determination", "id": "GO:0007500", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007500", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "post-embryonic camera-type eye development", "id": "GO:0031077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031077", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "positive regulation of miRNA transcription", "id": "GO:1902895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902895", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "defense response to tumor cell", "id": "GO:0002357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002357", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "epidermis morphogenesis", "id": "GO:0048730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048730", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "post-embryonic hemopoiesis", "id": "GO:0035166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035166", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "regulation of blastocyst development", "id": "GO:0120222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120222", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity", "id": "GO:0001010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001010", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "beta-catenin binding", "id": "GO:0008013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008013", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "chromatin DNA binding", "id": "GO:0031490", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031490", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "promoter-specific chromatin binding", "id": "GO:1990841", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990841", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "microtubule cytoskeleton", "id": "GO:0015630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015630", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "O43474", "url": "https://www.uniprot.org/uniprot/O43474" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 251 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 132, 234, 240, 254, 429 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 131 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }