{ "uniprot_canonical_ac": "O43396-1", "uniprot_ac": "O43396", "uniprot_id": "TXNL1_HUMAN", "mass": { "chemical_mass": 32251.0, "monoisotopic_mass": 32251.0 }, "refseq": { "ac": "NP_004777", "name": "thioredoxin-like protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" }, "gene_names": [ { "name": "TXNL1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43396", "id": "O43396" }, { "name": "HEL-S-114; TRP32; Txl; TXL-1; TXNL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777", "id": "NP_004777" }, { "name": "TRP32", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43396", "id": "O43396" }, { "name": "TXL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43396", "id": "O43396" }, { "name": "TXNL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777", "id": "NP_004777" }, { "name": "TXNL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43396", "id": "O43396" } ], "protein_names": [ { "name": "Thioredoxin-like protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43396" }, { "name": "32 kDa thioredoxin-related protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43396" }, { "name": "thioredoxin-like protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777", "id": "NP_004777" }, { "name": "thioredoxin-related 32 kDa protein; thioredoxin-related protein 1; 32 kDa thioredoxin-related protein; epididymis secretory protein Li 114", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777", "id": "NP_004777" } ], "function": [ { "annotation": "Active thioredoxin with a redox potential of about -250 mV.", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396#function" }, { "database": "PubMed", "id": "19349277", "url": "https://glygen.org/publication/PubMed/19349277" } ] }, { "annotation": "Distinct protein expression patterns, affecting TXNL1 and HDAC2, distinguish aneuploid with poor prognosis from diploid colorectal cancers.", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" }, { "database": "PubMed", "id": "21290163", "url": "https://glygen.org/publication/PubMed/21290163" } ] }, { "annotation": "Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" }, { "database": "PubMed", "id": "23362275", "url": "https://glygen.org/publication/PubMed/23362275" } ] }, { "annotation": "Solution structure of the C-terminal DUF1000 domain of the human thioredoxin-like 1 protein.", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" }, { "database": "PubMed", "id": "20455272", "url": "https://glygen.org/publication/PubMed/20455272" } ] }, { "annotation": "TXNL1-XRCC1 is a novel regulatory pathway that has an independent role in cisplatin resistance, indicating a putative drug target for reversing cisplatin resistance in gastric cancer. GeneRIF: TXNL1 is a novel regulatory molecule that inhibits cisplatin resistance in gastric cancer cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" }, { "database": "PubMed", "id": "24525731", "url": "https://glygen.org/publication/PubMed/24525731" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "95.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "96.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "96.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "96.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43396" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "common_name": "Human" } ], "gene": [ { "name": "TXNL1", "url": "https://www.uniprot.org/uniprot/O43396", "locus": { "chromosome": "18", "start_pos": 56597209, "end_pos": 56651600, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000091164", "url": "https://www.ensembl.org/id/ENSG00000091164" } ] } } ], "crossref": [ { "id": "ENSG00000091164", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091164", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02947", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02947", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4295663", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295663", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TXNL1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TXNL1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9352", "url": "https://www.ncbi.nlm.nih.gov/gene/9352", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12436", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12436", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43396", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43396*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017937", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017937", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9352", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9352", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603049", "url": "http://www.omim.org/entry/603049", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43396", "url": "https://www.nextprot.org/entry/NX_O43396", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43396", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PIFEMFP", "url": "https://omabrowser.org/oma/group/PIFEMFP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "45858at2759", "url": "http://www.orthodb.org/?query=45858at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46115", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46115", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46115:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46115:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1GH2", "url": "https://www.rcsb.org/structure/1GH2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WWY", "url": "https://www.rcsb.org/structure/1WWY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00085", "url": "http://pfam.xfam.org/family/PF00085", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06201", "url": "http://pfam.xfam.org/family/PF06201", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43396", "url": "https://pharos.nih.gov/targets/O43396", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43396", "url": "http://purl.obolibrary.org/obo/PR_O43396", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9013418", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013418", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013424", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9696273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696273", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "K7EKG2", "url": "https://www.uniprot.org/uniprot/K7EKG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKG2-1", "url": "https://www.uniprot.org/uniprot/K7EKG2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EME7", "url": "https://www.uniprot.org/uniprot/K7EME7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EME7-1", "url": "https://www.uniprot.org/uniprot/K7EME7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EML9", "url": "https://www.uniprot.org/uniprot/K7EML9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EML9-1", "url": "https://www.uniprot.org/uniprot/K7EML9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPB7", "url": "https://www.uniprot.org/uniprot/K7EPB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPB7-1", "url": "https://www.uniprot.org/uniprot/K7EPB7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ER96", "url": "https://www.uniprot.org/uniprot/K7ER96", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ER96-1", "url": "https://www.uniprot.org/uniprot/K7ER96-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43396-1", "url": "https://www.uniprot.org/uniprot/O43396-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH", "length": 289, "header": "sp|O43396-1|TXNL1_HUMAN Isoform 1 of Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3 CANONICAL=O43396-1" }, "isoforms": [ { "isoform_ac": "K7EKG2-1", "url": "", "sequence": { "sequence": "MVGVKPVGSDPDFQPELSGAGSRLAVV", "length": 27, "header": "tr|K7EKG2-1|TXNL1_HUMAN Computationally mapped isoform of Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=1 CANONICAL=O43396-1" }, "locus": { "chromosome": "18", "start_pos": 56638440, "end_pos": 56638360, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000589329.5", "url": "https://www.ensembl.org/id/ENST00000589329.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000465606.1", "url": "https://www.ensembl.org/id/ENSP00000465606.1" } ] } }, { "isoform_ac": "K7EME7-1", "url": "", "sequence": { "sequence": "XDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRHLSALTLPMFSPLLVQDFYSFYHLDQPCYLENTHWQVESYQPVKQ", "length": 103, "header": "tr|K7EME7-1|TXNL1_HUMAN Computationally mapped isoform of Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=1 CANONICAL=O43396-1" }, "locus": { "chromosome": "18", "start_pos": 56614491, "end_pos": 56603055, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000589931.1", "url": "https://www.ensembl.org/id/ENST00000589931.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000466473.1", "url": "https://www.ensembl.org/id/ENSP00000466473.1" } ] } }, { "isoform_ac": "K7EML9-1", "url": "", "sequence": { "sequence": "MLRKFTLLTPSHCFPLRCKRCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLR", "length": 138, "header": "tr|K7EML9-1|K7EML9_HUMAN Computationally mapped isoform of Thioredoxin like 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=1 CANONICAL=O43396-1" }, "locus": { "chromosome": "18", "start_pos": 56651075, "end_pos": 56618043, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587613.1", "url": "https://www.ensembl.org/id/ENST00000587613.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000466558.1", "url": "https://www.ensembl.org/id/ENSP00000466558.1" } ] } }, { "isoform_ac": "K7EPB7-1", "url": "", "sequence": { "sequence": "MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQYLFL", "length": 69, "header": "tr|K7EPB7-1|TXNL1_HUMAN Computationally mapped isoform of Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=1 CANONICAL=O43396-1" }, "locus": { "chromosome": "18", "start_pos": 56638440, "end_pos": 56626255, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587807.5", "url": "https://www.ensembl.org/id/ENST00000587807.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467317.1", "url": "https://www.ensembl.org/id/ENSP00000467317.1" } ] } }, { "isoform_ac": "K7ER96-1", "url": "", "sequence": { "sequence": "XPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVSLLK", "length": 281, "header": "tr|K7ER96-1|TXNL1_HUMAN Computationally mapped isoform of Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=1 CANONICAL=O43396-1" }, "locus": { "chromosome": "18", "start_pos": 56638427, "end_pos": 56610977, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000586262.5", "url": "https://www.ensembl.org/id/ENST00000586262.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000468165.1", "url": "https://www.ensembl.org/id/ENSP00000468165.1" } ] } }, { "isoform_ac": "O43396-1", "url": "", "sequence": { "sequence": "MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH", "length": 289, "header": "sp|O43396-1|TXNL1_HUMAN Isoform 1 of Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3 CANONICAL=O43396-1" }, "locus": { "chromosome": "18", "start_pos": 56638440, "end_pos": 56603030, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000217515.11", "url": "https://www.ensembl.org/id/ENST00000217515.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000217515.5", "url": "https://www.ensembl.org/id/ENSP00000217515.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O43396", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43396" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" } ] } ], "phosphorylation": [ { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser113" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Thr117" }, { "start_pos": 18, "end_pos": 18, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser18" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser46" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser48" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family.", "journal": "FEBS letters", "date": "2000", "authors": "Vayssiere B, Zalcman G, Mahe Y, Mirey G, Ligensa T, Weidner KM, Chardin P, Camonis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "10664463", "url": "https://glygen.org/publication/PubMed/10664463" } ] }, { "title": "Genomic structure and chromosomal localization of human thioredoxin-like protein gene (txl).", "journal": "DNA Seq.", "date": "2000", "authors": "Miranda-Vizuete A, Spyrou G", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "reference": [ { "type": "PubMed", "id": "10826702", "url": "https://glygen.org/publication/PubMed/10826702" } ] }, { "title": "Wrch-1, a novel member of the Rho gene family that is regulated by Wnt-1.", "journal": "Genes & development", "date": "2001", "authors": "Tao W, Pennica D, Xu L, Kalejta RF, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "11459829", "url": "https://glygen.org/publication/PubMed/11459829" } ] }, { "title": "Antagonistic effects of Rnd1 and RhoD GTPases regulate receptor activity in Semaphorin 3A-induced cytoskeletal collapse.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Zanata SM, Hovatta I, Rohm B, Puschel AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696273" } ], "reference": [ { "type": "PubMed", "id": "11784792", "url": "https://glygen.org/publication/PubMed/11784792" } ] }, { "title": "Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Katoh H, Harada A, Mori K, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "11940653", "url": "https://glygen.org/publication/PubMed/11940653" } ] }, { "title": "Crystal structure of the catalytic domain of a human thioredoxin-like protein.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Jin J, Chen X, Zhou Y, Bartlam M, Guo Q, Liu Y, Sun Y, Gao Y, Ye S, Li G, Rao Z, Qiang B, Yuan J", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "reference": [ { "type": "PubMed", "id": "11985582", "url": "https://glygen.org/publication/PubMed/11985582" } ] }, { "title": "Rapostlin is a novel effector of Rnd2 GTPase inducing neurite branching.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fujita H, Katoh H, Ishikawa Y, Mori K, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "12244061", "url": "https://glygen.org/publication/PubMed/12244061" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Rnd proteins function as RhoA antagonists by activating p190 RhoGAP.", "journal": "Current biology : CB", "date": "2003", "authors": "Wennerberg K, Forget MA, Ellerbroek SM, Arthur WT, Burridge K, Settleman J, Der CJ, Hansen SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "12842009", "url": "https://glygen.org/publication/PubMed/12842009" } ] }, { "title": "Rho GTPases have diverse effects on the organization of the actin filament system.", "journal": "The Biochemical journal", "date": "2004", "authors": "Aspenstrom P, Fransson A, Saras J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013424" } ], "reference": [ { "type": "PubMed", "id": "14521508", "url": "https://glygen.org/publication/PubMed/14521508" } ] }, { "title": "Identification of splicing variants of Rapostlin, a novel RND2 effector that interacts with neural Wiskott-Aldrich syndrome protein and induces neurite branching.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kakimoto T, Katoh H, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "14732713", "url": "https://glygen.org/publication/PubMed/14732713" } ] }, { "title": "RhoBTB2 is a substrate of the mammalian Cul3 ubiquitin ligase complex.", "journal": "Genes & development", "date": "2004", "authors": "Wilkins A, Ping Q, Carpenter CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013418", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013418" } ], "reference": [ { "type": "PubMed", "id": "15107402", "url": "https://glygen.org/publication/PubMed/15107402" } ] }, { "title": "Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects.", "journal": "Experimental cell research", "date": "2004", "authors": "Saras J, Wollberg P, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "15350535", "url": "https://glygen.org/publication/PubMed/15350535" } ] }, { "title": "Atypical mechanism of regulation of the Wrch-1 Rho family small GTPase.", "journal": "Current biology : CB", "date": "2004", "authors": "Shutes A, Berzat AC, Cox AD, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "15556869", "url": "https://glygen.org/publication/PubMed/15556869" } ] }, { "title": "Direct interaction of Rnd1 with FRS2 beta regulates Rnd1-induced down-regulation of RhoA activity and is involved in fibroblast growth factor-induced neurite outgrowth in PC12 cells.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Harada A, Katoh H, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "15738000", "url": "https://glygen.org/publication/PubMed/15738000" } ] }, { "title": "Pragmin, a novel effector of Rnd2 GTPase, stimulates RhoA activity.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tanaka H, Katoh H, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "16481321", "url": "https://glygen.org/publication/PubMed/16481321" } ] }, { "title": "Autophosphorylation-dependent degradation of Pak1, triggered by the Rho-family GTPase, Chp.", "journal": "The Biochemical journal", "date": "2007", "authors": "Weisz Hubsman M, Volinsky N, Manser E, Yablonski D, Aronheim A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013424" } ], "reference": [ { "type": "PubMed", "id": "17355222", "url": "https://glygen.org/publication/PubMed/17355222" } ] }, { "title": "The atypical Rho family GTPase Wrch-1 regulates focal adhesion formation and cell migration.", "journal": "Journal of cell science", "date": "2007", "authors": "Chuang YY, Valster A, Coniglio SJ, Backer JM, Symons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "17504809", "url": "https://glygen.org/publication/PubMed/17504809" } ] }, { "title": "Characterization of RhoBTB-dependent Cul3 ubiquitin ligase complexes--evidence for an autoregulatory mechanism.", "journal": "Experimental cell research", "date": "2008", "authors": "Berthold J, Schenkova K, Ramos S, Miura Y, Furukawa M, Aspenstrom P, Rivero F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "18835386", "url": "https://glygen.org/publication/PubMed/18835386" } ] }, { "title": "Rnd1 regulates axon extension by enhancing the microtubule destabilizing activity of SCG10.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Li YH, Ghavampur S, Bondallaz P, Will L, Grenningloh G, Puschel AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "18996843", "url": "https://glygen.org/publication/PubMed/18996843" } ] }, { "title": "The transforming Rho family GTPase Wrch-1 disrupts epithelial cell tight junctions and epithelial morphogenesis.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Brady DC, Alan JK, Madigan JP, Fanning AS, Cox AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "19064640", "url": "https://glygen.org/publication/PubMed/19064640" } ] }, { "title": "Rho-kinase contributes to sustained RhoA activation through phosphorylation of p190A RhoGAP.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Mori K, Amano M, Takefuji M, Kato K, Morita Y, Nishioka T, Matsuura Y, Murohara T, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696273" } ], "reference": [ { "type": "PubMed", "id": "19103606", "url": "https://glygen.org/publication/PubMed/19103606" } ] }, { "title": "Different requirement for Rnd GTPases of R-Ras GAP activity of Plexin-C1 and Plexin-D1.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Uesugi K, Oinuma I, Katoh H, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "19136556", "url": "https://glygen.org/publication/PubMed/19136556" } ] }, { "title": "Thioredoxin Txnl1/TRP32 is a redox-active cofactor of the 26 S proteasome.", "journal": "The Journal of biological chemistry", "date": "2009-05-29", "authors": "Andersen Katrine M, Madsen Louise, Prag S\u00f8ren, Johnsen Anders H, Semple Colin A, Hendil Klavs B, Hartmann-Petersen Rasmus", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "reference": [ { "type": "PubMed", "id": "19349277", "url": "https://glygen.org/publication/PubMed/19349277" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Solution structure of the C-terminal DUF1000 domain of the human thioredoxin-like 1 protein.", "journal": "Proteins", "date": "2010", "authors": "Goroncy AK, Koshiba S, Tochio N, Tomizawa T, Inoue M, Tanaka A, Sugano S, Kigawa T, Yokoyama S", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" }, { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" } ], "reference": [ { "type": "PubMed", "id": "20455272", "url": "https://glygen.org/publication/PubMed/20455272" } ] }, { "title": "Regulation of the Rho family small GTPase Wrch-1/RhoU by C-terminal tyrosine phosphorylation requires Src.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Alan JK, Berzat AC, Dewar BJ, Graves LM, Cox AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "20547754", "url": "https://glygen.org/publication/PubMed/20547754" } ] }, { "title": "The RhoA GEF Syx is a target of Rnd3 and regulated via a Raf1-like ubiquitin-related domain.", "journal": "PloS one", "date": "2010", "authors": "Goh LL, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "20811643", "url": "https://glygen.org/publication/PubMed/20811643" } ] }, { "title": "HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jornvall H, Auer G, Habermann JK", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" } ], "reference": [ { "type": "PubMed", "id": "21290163", "url": "https://glygen.org/publication/PubMed/21290163" } ] }, { "title": "GRB2 couples RhoU to epidermal growth factor receptor signaling and cell migration.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Zhang JS, Koenig A, Young C, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "21508312", "url": "https://glygen.org/publication/PubMed/21508312" } ] }, { "title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Naji L, Pacholsky D, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "21565175", "url": "https://glygen.org/publication/PubMed/21565175" } ] }, { "title": "Pak6 protein kinase is a novel effector of an atypical Rho family GTPase Chp/RhoV.", "journal": "Biochemistry. Biokhimiia", "date": "2012", "authors": "Shepelev MV, Korobko IV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013424" } ], "reference": [ { "type": "PubMed", "id": "22339630", "url": "https://glygen.org/publication/PubMed/22339630" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" }, { "database": "iPTMnet", "id": "O43396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43396" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43396" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Ishii T, Funato Y, Miki H", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" } ], "reference": [ { "type": "PubMed", "id": "23362275", "url": "https://glygen.org/publication/PubMed/23362275" } ] }, { "title": "TXNL1-XRCC1 pathway regulates cisplatin-induced cell death and contributes to resistance in human gastric cancer.", "journal": "Cell death & disease", "date": "2014", "authors": "Xu W, Wang S, Chen Q, Zhang Y, Ni P, Wu X, Zhang J, Qiang F, Li A, Roe OD, Xu S, Wang M, Zhang R, Zhou J", "evidence": [ { "database": "RefSeq", "id": "NP_004777", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004777" } ], "reference": [ { "type": "PubMed", "id": "24525731", "url": "https://glygen.org/publication/PubMed/24525731" } ] }, { "title": "Hsp90-dependent assembly of the DBC2/RhoBTB2-Cullin3 E3-ligase complex.", "journal": "PloS one", "date": "2014", "authors": "Manjarrez JR, Sun L, Prince T, Matts RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "24608665", "url": "https://glygen.org/publication/PubMed/24608665" } ] }, { "title": "STI1 antagonizes cytoskeleton collapse mediated by small GTPase Rnd1 and regulates neurite growth.", "journal": "Experimental cell research", "date": "2014", "authors": "de Souza LE, Moura Costa MD, Bilek ES, Lopes MH, Martins VR, Puschel AW, Mercadante AF, Nakao LS, Zanata SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "24690281", "url": "https://glygen.org/publication/PubMed/24690281" } ] }, { "title": "Bacurd2 is a novel interacting partner to Rnd2 which controls radial migration within the developing mammalian cerebral cortex.", "journal": "Neural development", "date": "2015", "authors": "Gladwyn-Ng IE, Li SS, Qu Z, Davis JM, Ngo L, Haas M, Singer J, Heng JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696270", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270" } ], "reference": [ { "type": "PubMed", "id": "25888806", "url": "https://glygen.org/publication/PubMed/25888806" } ] }, { "title": "PAK4 promotes kinase-independent stabilization of RhoU to modulate cell adhesion.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Dart AE, Box GM, Court W, Gale ME, Brown JP, Pinder SE, Eccles SA, Wells CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "26598620", "url": "https://glygen.org/publication/PubMed/26598620" } ] }, { "title": "Bacurd1/Kctd13 and Bacurd2/Tnfaip1 are interacting partners to Rnd proteins which influence the long-term positioning and dendritic maturation of cerebral cortical neurons.", "journal": "Neural development", "date": "2016", "authors": "Gladwyn-Ng I, Huang L, Ngo L, Li SS, Qu Z, Vanyai HK, Cullen HD, Davis JM, Heng JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "26969432", "url": "https://glygen.org/publication/PubMed/26969432" } ] }, { "title": "Atypical Rho GTPases of the RhoBTB Subfamily: Roles in Vesicle Trafficking and Tumorigenesis.", "journal": "Cells", "date": "2016", "authors": "Ji W, Rivero F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "27314390", "url": "https://glygen.org/publication/PubMed/27314390" } ] }, { "title": "DBC2/RhoBTB2 functions as a tumor suppressor protein via Musashi-2 ubiquitination in breast cancer.", "journal": "Oncogene", "date": "2017", "authors": "Choi YM, Kim KB, Lee JH, Chun YK, An IS, An S, Bae S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013418", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013418" } ], "reference": [ { "type": "PubMed", "id": "27941885", "url": "https://glygen.org/publication/PubMed/27941885" } ] }, { "title": "RhoBTB1 protects against hypertension and arterial stiffness by restraining phosphodiesterase 5 activity.", "journal": "The Journal of clinical investigation", "date": "2019", "authors": "Mukohda M, Fang S, Wu J, Agbor LN, Nair AR, Ibeawuchi SC, Hu C, Liu X, Lu KT, Guo DF, Davis DR, Keen HL, Quelle FW, Sigmund CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "30896450", "url": "https://glygen.org/publication/PubMed/30896450" } ] }, { "title": "RhoBTB1 interacts with ROCKs and inhibits invasion.", "journal": "The Biochemical journal", "date": "2019", "authors": "Haga RB, Garg R, Collu F, Borda D'Agua B, Menendez ST, Colomba A, Fraternali F, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "31431478", "url": "https://glygen.org/publication/PubMed/31431478" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "The atypical Rho GTPase RhoU interacts with intersectin-2 to regulate endosomal recycling pathways.", "journal": "Journal of cell science", "date": "2020", "authors": "Gubar O, Croise P, Kropyvko S, Gryaznova T, Toth P, Blangy A, Vitale N, Rynditch A, Gasman S, Ory S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "32737221", "url": "https://glygen.org/publication/PubMed/32737221" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43396" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Identification of a novel human Rho protein with unusual properties: GTPase deficiency and in vivo farnesylation.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Foster R, Hu KQ, Lu Y, Nolan KM, Thissen J, Settleman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696264", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264" } ], "reference": [ { "type": "PubMed", "id": "8649376", "url": "https://glygen.org/publication/PubMed/8649376" } ] }, { "title": "Molecular cloning and expression of a cDNA encoding a human thioredoxin-like protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Miranda-Vizuete A, Gustafsson J A, Spyrou G", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "reference": [ { "type": "PubMed", "id": "9473519", "url": "https://glygen.org/publication/PubMed/9473519" } ] }, { "title": "A new member of the Rho family, Rnd1, promotes disassembly of actin filament structures and loss of cell adhesion.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Nobes CD, Lauritzen I, Mattei MG, Paris S, Hall A, Chardin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9696273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696273" } ], "reference": [ { "type": "PubMed", "id": "9531558", "url": "https://glygen.org/publication/PubMed/9531558" } ] }, { "title": "Purification, molecular cloning, and characterization of TRP32, a novel thioredoxin-related mammalian protein of 32 kDa.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Lee K K, Murakawa M, Takahashi S, Tsubuki S, Kawashima S, Sakamaki K, Yonehara S", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "reference": [ { "type": "PubMed", "id": "9668102", "url": "https://glygen.org/publication/PubMed/9668102" } ] }, { "title": "Chp, a homologue of the GTPase Cdc42Hs, activates the JNK pathway and is implicated in reorganizing the actin cytoskeleton.", "journal": "Current biology : CB", "date": "1998", "authors": "Aronheim A, Broder YC, Cohen A, Fritsch A, Belisle B, Abo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013424" } ], "reference": [ { "type": "PubMed", "id": "9778532", "url": "https://glygen.org/publication/PubMed/9778532" } ] } ], "pathway": [ { "id": "hsa:9352", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9352", "resource": "KEGG Pathway" }, { "id": "R-HSA-9013418", "name": "RHOBTB2 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013418", "resource": "Reactome", "description": "RHOBTB2 GTPase cycle" }, { "id": "R-HSA-9013420", "name": "RHOU GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420", "resource": "Reactome", "description": "RHOU GTPase cycle" }, { "id": "R-HSA-9013422", "name": "RHOBTB1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422", "resource": "Reactome", "description": "RHOBTB1 GTPase cycle" }, { "id": "R-HSA-9013424", "name": "RHOV GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013424", "resource": "Reactome", "description": "RHOV GTPase cycle" }, { "id": "R-HSA-9696264", "name": "RND3 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264", "resource": "Reactome", "description": "RND3 GTPase cycle" }, { "id": "R-HSA-9696270", "name": "RND2 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696270", "resource": "Reactome", "description": "RND2 GTPase cycle" }, { "id": "R-HSA-9696273", "name": "RND1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696273", "resource": "Reactome", "description": "RND1 GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8CDN6-1", "protein_name": "Thioredoxin-like protein 1", "gene_name": "Txnl1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDADIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMSFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTLFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH", "length": 289 }, "evidence": [ { "id": "45925139", "url": "http://www.informatics.jax.org/homology/45925139", "database": "MGI" }, { "id": "O43396", "url": "https://omabrowser.org/oma/group/O43396/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q920J4-1", "protein_name": "Thioredoxin-like protein 1", "gene_name": "Txnl1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDLSFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTLFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH", "length": 289 }, "evidence": [ { "id": "45925139", "url": "http://www.informatics.jax.org/homology/45925139", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9VRP3-1", "protein_name": "1.8.1.9", "gene_name": "Txl", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSVRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDYGQGLMELNTFISKQECECLNEADDHNLKHALASAGGYLQSDCDEQLILSITFNQAVKIHSLKFKAPSHLGPKDVKLFINQPRTIDFDMAESMNSVQDLSLAQKELESGVPVNLRYVKFQNVQNIQIFVKNNQSGGDVTQIDYIGFIGSPIMTTKMNDFKRVAGKKGESH", "length": 287 }, "evidence": [ { "id": "O43396", "url": "https://omabrowser.org/oma/group/O43396/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "pmid": "" }, { "name": "proteasome complex", "id": "GO:0000502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000502", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "disulfide oxidoreductase activity", "id": "GO:0015036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015036", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "pmid": "" }, { "name": "protein-disulfide reductase activity", "id": "GO:0015035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015035", "evidence": [ { "database": "UniProtKB", "id": "O43396", "url": "https://www.uniprot.org/uniprot/O43396" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 72, "end_pos": 74, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 18, 46, 48, 113, 117 ], "sequon_annotation_sites": [ { "start_pos": 139, "end_pos": 141 }, { "start_pos": 72, "end_pos": 74 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }