{ "uniprot_canonical_ac": "O43251-1", "uniprot_ac": "O43251", "uniprot_id": "RFOX2_HUMAN", "mass": { "chemical_mass": 41374.0, "monoisotopic_mass": 41374.0 }, "refseq": { "ac": "NP_001026865", "name": "RNA binding protein fox-1 homolog 2 isoform 1", "summary": "This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" }, "gene_names": [ { "name": "RBFOX2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43251", "id": "O43251" }, { "name": "FOX2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43251", "id": "O43251" }, { "name": "HRNBP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43251", "id": "O43251" }, { "name": "RBFOX2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865", "id": "NP_001026865" }, { "name": "RBM9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43251", "id": "O43251" }, { "name": "RTA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43251", "id": "O43251" }, { "name": "dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865", "id": "NP_001026865" } ], "protein_names": [ { "name": "RNA binding protein fox-1 homolog 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43251" }, { "name": "Fox-1 homolog B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43251" }, { "name": "Hexaribonucleotide-binding protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43251" }, { "name": "RNA binding protein fox-1 homolog 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865", "id": "NP_001026865" }, { "name": "RNA-binding motif protein 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43251" }, { "name": "RNA-binding protein 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43251" }, { "name": "Repressor of tamoxifen transcriptional activity", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43251" }, { "name": "repressor of tamoxifen transcriptional activity; fox-1 homologue; fox-1 homolog B; RNA-binding motif protein 9; hexaribonucleotide-binding protein 2; RNA binding protein, fox-1 homolog 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865", "id": "NP_001026865" } ], "function": [ { "annotation": "FBXO7 Confers Mesenchymal Properties and Chemoresistance in Glioblastoma by Controlling Rbfox2-Mediated Alternative Splicing.", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" }, { "database": "PubMed", "id": "37822160", "url": "https://glygen.org/publication/PubMed/37822160" } ] }, { "annotation": "Fox-1 and Fox-2 isoforms specifically activate splicing of neuronally regulated exons, which requires UGCAUG enhancer elements", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" }, { "database": "PubMed", "id": "16260614", "url": "https://glygen.org/publication/PubMed/16260614" } ] }, { "annotation": "RBFOX2 confers tumor growth by PI3K/AKT and MAPK signaling in gastric cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" }, { "database": "PubMed", "id": "37264873", "url": "https://glygen.org/publication/PubMed/37264873" } ] }, { "annotation": "RBFOX2 deregulation promotes pancreatic cancer progression and metastasis through alternative splicing. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" }, { "database": "PubMed", "id": "38114498", "url": "https://glygen.org/publication/PubMed/38114498" } ] }, { "annotation": "RBFOX2 modulates a metastatic signature of alternative splicing in pancreatic cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" }, { "database": "PubMed", "id": "36949200", "url": "https://glygen.org/publication/PubMed/36949200" } ] }, { "annotation": "RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251#function" }, { "database": "PubMed", "id": "11875103", "url": "https://glygen.org/publication/PubMed/11875103" } ] }, { "annotation": "RNA-binding protein that regulates alternative splicing events.", "evidence": [ { "database": "UniProtKB", "id": "B0QYV1", "url": "https://www.uniprot.org/uniprot/B0QYV1#function" }, { "database": "UniProtKB", "id": "PIRNR037932", "url": "https://www.uniprot.org/uniprot/PIRNR037932#function" }, { "database": "UniProtKB", "id": "A0A8Q3SI75", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI75#function" }, { "database": "UniProtKB", "id": "A0A8Q3WKT3", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKT3#function" }, { "database": "UniProtKB", "id": "A0A8Q3SI58", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI58#function" }, { "database": "UniProtKB", "id": "B0QYY4", "url": "https://www.uniprot.org/uniprot/B0QYY4#function" } ] }, { "annotation": "This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "92.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "85.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "89.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "92.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43251", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43251" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "common_name": "Human" } ], "gene": [ { "name": "RBFOX2", "url": "https://www.uniprot.org/uniprot/O43251", "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 59734, "end_pos": 259895, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000277564", "url": "https://www.ensembl.org/id/ENSG00000277564" } ] } } ], "crossref": [ { "id": "ENSG00000100320", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100320", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12407", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12407", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "RBFOX2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RBFOX2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "23543", "url": "https://www.ncbi.nlm.nih.gov/gene/23543", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9906", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9906", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43251", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43251*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017325", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017325", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025670", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025670", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034237", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034237", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047131", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047131", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:23543", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23543", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "612149", "url": "http://www.omim.org/entry/612149", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43251", "url": "https://www.nextprot.org/entry/NX_O43251", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43251", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43251", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CAGTLEY", "url": "https://omabrowser.org/oma/group/CAGTLEY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5406502at2759", "url": "http://www.orthodb.org/?query=5406502at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15597", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15597", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15597:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15597:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2CQ3", "url": "https://www.rcsb.org/structure/2CQ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12414", "url": "http://pfam.xfam.org/family/PF12414", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43251", "url": "https://pharos.nih.gov/targets/O43251", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43251", "url": "http://purl.obolibrary.org/obo/PR_O43251", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2JRA5", "url": "https://www.uniprot.org/uniprot/A0A0G2JRA5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JRA5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JRA5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JRD1", "url": "https://www.uniprot.org/uniprot/A0A0G2JRD1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JRD1-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JRD1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JSB3", "url": "https://www.uniprot.org/uniprot/A0A0G2JSB3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JSB3-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JSB3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI19", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI19-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI19-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI20", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI20-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI20-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI31", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI31-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI31-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI58", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI58", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI58-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI58-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI75", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI75-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI75-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKT3", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKT3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKT3-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKT3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYV1", "url": "https://www.uniprot.org/uniprot/B0QYV1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYV1-1", "url": "https://www.uniprot.org/uniprot/B0QYV1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYY4", "url": "https://www.uniprot.org/uniprot/B0QYY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYY4-1", "url": "https://www.uniprot.org/uniprot/B0QYY4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYY6", "url": "https://www.uniprot.org/uniprot/B0QYY6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYY6-1", "url": "https://www.uniprot.org/uniprot/B0QYY6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYY7", "url": "https://www.uniprot.org/uniprot/B0QYY7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYY7-1", "url": "https://www.uniprot.org/uniprot/B0QYY7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-1", "url": "https://www.uniprot.org/uniprot/O43251-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-10", "url": "https://www.uniprot.org/uniprot/O43251-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-2", "url": "https://www.uniprot.org/uniprot/O43251-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-3", "url": "https://www.uniprot.org/uniprot/O43251-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-4", "url": "https://www.uniprot.org/uniprot/O43251-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-5", "url": "https://www.uniprot.org/uniprot/O43251-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-6", "url": "https://www.uniprot.org/uniprot/O43251-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-7", "url": "https://www.uniprot.org/uniprot/O43251-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-8", "url": "https://www.uniprot.org/uniprot/O43251-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43251-9", "url": "https://www.uniprot.org/uniprot/O43251-9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R3K7", "url": "https://www.uniprot.org/uniprot/S4R3K7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R3K7-1", "url": "https://www.uniprot.org/uniprot/S4R3K7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R469", "url": "https://www.uniprot.org/uniprot/S4R469", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R469-1", "url": "https://www.uniprot.org/uniprot/S4R469-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 390, "header": "sp|O43251-1|RFOX2_HUMAN Isoform 1 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JRA5-1", "url": "", "sequence": { "sequence": "NEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 389, "header": "tr|A0A0G2JRA5-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 259895, "end_pos": 65206, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000625456.2", "url": "https://www.ensembl.org/id/ENST00000625456.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000486570.1", "url": "https://www.ensembl.org/id/ENSP00000486570.1" } ] } }, { "isoform_ac": "A0A0G2JRD1-1", "url": "", "sequence": { "sequence": "GFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGIVLQEPIISAKIPQGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 227, "header": "tr|A0A0G2JRD1-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 89347, "end_pos": 65206, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000630250.2", "url": "https://www.ensembl.org/id/ENST00000630250.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000486646.1", "url": "https://www.ensembl.org/id/ENSP00000486646.1" } ] } }, { "isoform_ac": "A0A0G2JSB3-1", "url": "", "sequence": { "sequence": "NEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEG", "length": 186, "header": "tr|A0A0G2JSB3-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 259895, "end_pos": 89267, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000626165.1", "url": "https://www.ensembl.org/id/ENST00000626165.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487500.1", "url": "https://www.ensembl.org/id/ENSP00000487500.1" } ] } }, { "isoform_ac": "A0A8Q3SI19-1", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEHLGPFT", "length": 187, "header": "tr|A0A8Q3SI19-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35767424, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695806.1", "url": "https://www.ensembl.org/id/ENST00000695806.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512186.1", "url": "https://www.ensembl.org/id/ENSP00000512186.1" } ] } }, { "isoform_ac": "A0A8Q3SI20-1", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKEICLLLISPLKVTWDSGS", "length": 169, "header": "tr|A0A8Q3SI20-1|A0A8Q3SI20_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35768337, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695805.1", "url": "https://www.ensembl.org/id/ENST00000695805.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512185.1", "url": "https://www.ensembl.org/id/ENSP00000512185.1" } ] } }, { "isoform_ac": "A0A8Q3SI31-1", "url": "", "sequence": { "sequence": "MVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFG", "length": 134, "header": "tr|A0A8Q3SI31-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35809971, "end_pos": 35765483, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695807.1", "url": "https://www.ensembl.org/id/ENST00000695807.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512187.1", "url": "https://www.ensembl.org/id/ENSP00000512187.1" } ] } }, { "isoform_ac": "A0A8Q3SI58-1", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGRVSLSPRLEYSGAISAHCNLHFPGSSDTRASASRVAGITGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 417, "header": "tr|A0A8Q3SI58-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35744208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695803.1", "url": "https://www.ensembl.org/id/ENST00000695803.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512183.1", "url": "https://www.ensembl.org/id/ENSP00000512183.1" } ] } }, { "isoform_ac": "A0A8Q3SI75-1", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYSAEEMLTSHSKSLSGVSVPFSDITDGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTMPLPLPLAMELALWRVYTEVATADLPPTEVT", "length": 406, "header": "tr|A0A8Q3SI75-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35744198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695804.1", "url": "https://www.ensembl.org/id/ENST00000695804.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512184.1", "url": "https://www.ensembl.org/id/ENSP00000512184.1" } ] } }, { "isoform_ac": "A0A8Q3WKT3-1", "url": "", "sequence": { "sequence": "MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGMQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 447, "header": "tr|A0A8Q3WKT3-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 36028425, "end_pos": 35744208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695854.1", "url": "https://www.ensembl.org/id/ENST00000695854.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512219.1", "url": "https://www.ensembl.org/id/ENSP00000512219.1" } ] } }, { "isoform_ac": "B0QYV1-1", "url": "", "sequence": { "sequence": "MVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 357, "header": "tr|B0QYV1-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 130969, "end_pos": 65206, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000626598.2", "url": "https://www.ensembl.org/id/ENST00000626598.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000485961.1", "url": "https://www.ensembl.org/id/ENSP00000485961.1" } ] } }, { "isoform_ac": "B0QYY4-1", "url": "", "sequence": { "sequence": "MVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYIESANCFRSNRVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTMPLPLPLAMELALWRVYTEVATADLPPTEVT", "length": 370, "header": "tr|B0QYY4-1|B0QYY4_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 130969, "end_pos": 65196, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000627872.2", "url": "https://www.ensembl.org/id/ENST00000627872.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000487328.1", "url": "https://www.ensembl.org/id/ENSP00000487328.1" } ] } }, { "isoform_ac": "B0QYY6-1", "url": "", "sequence": { "sequence": "MVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGFGKILDVEIIFNERGS", "length": 128, "header": "tr|B0QYY6-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35809971, "end_pos": 35778028, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000397305.3", "url": "https://www.ensembl.org/id/ENST00000397305.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000380472.3", "url": "https://www.ensembl.org/id/ENSP00000380472.3" } ] } }, { "isoform_ac": "B0QYY7-1", "url": "", "sequence": { "sequence": "MSSDSMDQPRNPCENEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEG", "length": 200, "header": "tr|B0QYY7-1|B0QYY7_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35961604, "end_pos": 35768269, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000408983.2", "url": "https://www.ensembl.org/id/ENST00000408983.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000386177.2", "url": "https://www.ensembl.org/id/ENSP00000386177.2" } ] } }, { "isoform_ac": "O43251-1", "url": "", "sequence": { "sequence": "MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 390, "header": "sp|O43251-1|RFOX2_HUMAN Isoform 1 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": {} }, { "isoform_ac": "O43251-10", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 380, "header": "sp|O43251-10|RFOX2_HUMAN Isoform 10 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35744208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000449924.6", "url": "https://www.ensembl.org/id/ENST00000449924.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000391670.2", "url": "https://www.ensembl.org/id/ENSP00000391670.2" } ] } }, { "isoform_ac": "O43251-2", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 381, "header": "sp|O43251-2|RFOX2_HUMAN Isoform 2 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": {} }, { "isoform_ac": "O43251-3", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 358, "header": "sp|O43251-3|RFOX2_HUMAN Isoform 3 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": { "chromosome": "HSCHR22_1_CTG4", "start_pos": 161216, "end_pos": 65206, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000631365.2", "url": "https://www.ensembl.org/id/ENST00000631365.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000485711.1", "url": "https://www.ensembl.org/id/ENSP00000485711.1" } ] } }, { "isoform_ac": "O43251-4", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTMPLPLPLAMELALWRVYTEVATADLPPTEVT", "length": 370, "header": "sp|O43251-4|RFOX2_HUMAN Isoform 4 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35744198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000414461.6", "url": "https://www.ensembl.org/id/ENST00000414461.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000407855.2", "url": "https://www.ensembl.org/id/ENSP00000407855.2" } ] } }, { "isoform_ac": "O43251-5", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 376, "header": "sp|O43251-5|RFOX2_HUMAN Isoform 5 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35744208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000416721.6", "url": "https://www.ensembl.org/id/ENST00000416721.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000405651.2", "url": "https://www.ensembl.org/id/ENSP00000405651.2" } ] } }, { "isoform_ac": "O43251-6", "url": "", "sequence": { "sequence": "MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGMQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 450, "header": "sp|O43251-6|RFOX2_HUMAN Isoform 6 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": {} }, { "isoform_ac": "O43251-7", "url": "", "sequence": { "sequence": "MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYIESANCFRSNRVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTMPLPLPLAMELALWRVYTEVATADLPPTEVT", "length": 400, "header": "sp|O43251-7|RFOX2_HUMAN Isoform 7 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": {} }, { "isoform_ac": "O43251-8", "url": "", "sequence": { "sequence": "MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGMQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 451, "header": "sp|O43251-8|RFOX2_HUMAN Isoform 8 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 36028425, "end_pos": 35744208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000438146.7", "url": "https://www.ensembl.org/id/ENST00000438146.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000413035.2", "url": "https://www.ensembl.org/id/ENSP00000413035.2" } ] } }, { "isoform_ac": "O43251-9", "url": "", "sequence": { "sequence": "MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTMPLPLPLAMELALWRVYTEVATADLPPTEVT", "length": 367, "header": "sp|O43251-9|RFOX2_HUMAN Isoform 9 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35840218, "end_pos": 35744198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000405409.6", "url": "https://www.ensembl.org/id/ENST00000405409.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000384944.2", "url": "https://www.ensembl.org/id/ENSP00000384944.2" } ] } }, { "isoform_ac": "S4R3K7-1", "url": "", "sequence": { "sequence": "XSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGIVLQEPIISAKIPQGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 230, "header": "tr|S4R3K7-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35778032, "end_pos": 35744207, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000495377.6", "url": "https://www.ensembl.org/id/ENST00000495377.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000474464.1", "url": "https://www.ensembl.org/id/ENSP00000474464.1" } ] } }, { "isoform_ac": "S4R469-1", "url": "", "sequence": { "sequence": "MVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGF", "length": 234, "header": "tr|S4R469-1|RFOX2_HUMAN Computationally mapped isoform of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1 CANONICAL=O43251-1" }, "locus": { "chromosome": "22", "start_pos": 35809971, "end_pos": 35760010, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000473487.6", "url": "https://www.ensembl.org/id/ENST00000473487.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000475142.1", "url": "https://www.ensembl.org/id/ENSP00000475142.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O43251", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43251" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" } ] } ], "phosphorylation": [ { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "His", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" }, { "database": "iPTMnet", "id": "O43251", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43251" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "His67" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43251", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43251" }, { "database": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ], "site_lbl": "Thr7" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The RNA-binding protein TIA-1 is a novel mammalian splicing regulator acting through intron sequences adjacent to a 5' splice site.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Del Gatto-Konczak F, Bourgeois CF, Le Guiner C, Kister L, Gesnel MC, Stevenin J, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "10938105", "url": "https://glygen.org/publication/PubMed/10938105" } ] }, { "title": "An intronic splicing silencer causes skipping of the IIIb exon of fibroblast growth factor receptor 2 through involvement of polypyrimidine tract binding protein.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Carstens RP, Wagner EJ, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "10982855", "url": "https://glygen.org/publication/PubMed/10982855" } ] }, { "title": "A negative coregulator for the human ER.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Norris JD, Fan D, Sherk A, McDonnell DP", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "reference": [ { "type": "PubMed", "id": "11875103", "url": "https://glygen.org/publication/PubMed/11875103" } ] }, { "title": "A Non-sequence-specific double-stranded RNA structural element regulates splicing of two mutually exclusive exons of fibroblast growth factor receptor 2 (FGFR2).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Muh SJ, Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "12393912", "url": "https://glygen.org/publication/PubMed/12393912" } ] }, { "title": "A novel intronic cis element, ISE/ISS-3, regulates rat fibroblast growth factor receptor 2 splicing through activation of an upstream exon and repression of a downstream exon containing a noncanonical branch point sequence.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "15601847", "url": "https://glygen.org/publication/PubMed/15601847" } ] }, { "title": "Homologues of the Caenorhabditis elegans Fox-1 protein are neuronal splicing regulators in mammals.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Underwood JG, Boutz PL, Dougherty JD, Stoilov P, Black DL", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" } ], "reference": [ { "type": "PubMed", "id": "16260614", "url": "https://glygen.org/publication/PubMed/16260614" } ] }, { "title": "Characterization of sequences and mechanisms through which ISE/ISS-3 regulates FGFR2 splicing.", "journal": "Nucleic acids research", "date": "2006", "authors": "Hovhannisyan RH, Warzecha CC, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16410617", "url": "https://glygen.org/publication/PubMed/16410617" } ] }, { "title": "Fox-2 mediates epithelial cell-specific fibroblast growth factor receptor 2 exon choice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Baraniak AP, Chen JR, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16449636", "url": "https://glygen.org/publication/PubMed/16449636" } ] }, { "title": "Identification of RNA-binding proteins that regulate FGFR2 splicing through the use of sensitive and specific dual color fluorescence minigene assays.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Newman EA, Muh SJ, Hovhannisyan RH, Warzecha CC, Jones RB, McKeehan WL, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16603716", "url": "https://glygen.org/publication/PubMed/16603716" } ] }, { "title": "Heterogeneous ribonucleoprotein m is a splicing regulatory protein that can enhance or silence splicing of alternatively spliced exons.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "17959601", "url": "https://glygen.org/publication/PubMed/17959601" } ] }, { "title": "hnRNP H and hnRNP F complex with Fox2 to silence fibroblast growth factor receptor 2 exon IIIc.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Mauger DM, Lin C, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "18573884", "url": "https://glygen.org/publication/PubMed/18573884" } ] }, { "title": "Characterization of cDNAs encoding the polypyrimidine tract-binding protein.", "journal": "Genes & development", "date": "1991", "authors": "Gil A, Sharp PA, Jamison SF, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "1906035", "url": "https://glygen.org/publication/PubMed/1906035" } ] }, { "title": "ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.", "journal": "Molecular cell", "date": "2009", "authors": "Warzecha CC, Sato TK, Nabet B, Hogenesch JB, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "19285943", "url": "https://glygen.org/publication/PubMed/19285943" } ] }, { "title": "Large-scale discovery of ERK2 substrates identifies ERK-mediated transcriptional regulation by ETV3.", "journal": "Science signaling", "date": "2011", "authors": "Carlson SM, Chouinard CR, Labadorf A, Lam CJ, Schmelzle K, Fraenkel E, White FM", "evidence": [ { "database": "iPTMnet", "id": "O43251", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43251" } ], "reference": [ { "type": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O43251", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43251" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43251", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43251" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43251", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43251" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "RBFOX2 modulates a metastatic signature of alternative splicing in pancreatic cancer.", "journal": "Nature", "date": "2023-03-22", "authors": "Jbara Amina, Lin Kuan-Ting, Stossel Chani, Siegfried Zahava, Shqerat Haya, Amar-Schwartz Adi, Elyada Ela, Mogilevsky Maxim, Raitses-Gurevich Maria, Johnson Jared L, Yaron Tomer M, Ovadia Ofek, Jang Gun Ho, Danan-Gotthold Miri, Cantley Lewis C, Levanon Erez Y, Gallinger Steven, Krainer Adrian R, Golan Talia, Karni Rotem", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" } ], "reference": [ { "type": "PubMed", "id": "36949200", "url": "https://glygen.org/publication/PubMed/36949200" } ] }, { "title": "RBFOX2 confers tumor growth by PI3K/AKT and MAPK signaling in gastric cancer.", "journal": "European journal of cancer prevention : the official journal of the European Cancer Prevention Organisation (ECP)", "date": "2023-09-01", "authors": "Xie Shuangyan, Li Zeyun, Zhong Yu, Fang Qiuyun, Ma Amin, Wang Yan, Zeng Lina, Lin Tengjiao, Xie Du", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" } ], "reference": [ { "type": "PubMed", "id": "37264873", "url": "https://glygen.org/publication/PubMed/37264873" } ] }, { "title": "FBXO7 Confers Mesenchymal Properties and Chemoresistance in Glioblastoma by Controlling Rbfox2-Mediated Alternative Splicing.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2023-11", "authors": "Li Shangbiao, Chen Yanwen, Xie Yuxin, Zhan Hongchao, Zeng Yu, Zeng Kunlin, Wang Li, Zhan Ziling, Li Cuiying, Zhao Liqian, Chen Xiaoxia, Tan Yujing, Wang Zhongyong, Bu Junguo, Song Ye, Deng Fan, Zhou Aidong", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" } ], "reference": [ { "type": "PubMed", "id": "37822160", "url": "https://glygen.org/publication/PubMed/37822160" } ] }, { "title": "RBFOX2 deregulation promotes pancreatic cancer progression and metastasis through alternative splicing.", "journal": "Nature communications", "date": "2023-12-19", "authors": "Maurin Michelle, Ranjouri Mohammadreza, Megino-Luque Cristina, Newberg Justin Y, Du Dongliang, Martin Katelyn, Miner Robert E, Prater Mollie S, Wee Dave Keng Boon, Centeno Barbara, Pruett-Miller Shondra M, Stewart Paul, Fleming Jason B, Yu Xiaoqing, Bravo-Cordero Jose Javier, Guccione Ernesto, Black Michael A, Mann Karen M", "evidence": [ { "database": "RefSeq", "id": "NP_001026865", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026865" } ], "reference": [ { "type": "PubMed", "id": "38114498", "url": "https://glygen.org/publication/PubMed/38114498" } ] }, { "title": "Multiple interdependent sequence elements control splicing of a fibroblast growth factor receptor 2 alternative exon.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Del Gatto F, Plet A, Gesnel MC, Fort C, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "9271388", "url": "https://glygen.org/publication/PubMed/9271388" } ] }, { "title": "hnRNP A1 recruited to an exon in vivo can function as an exon splicing silencer.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Del Gatto-Konczak F, Olive M, Gesnel MC, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "9858549", "url": "https://glygen.org/publication/PubMed/9858549" } ] } ], "pathway": [ { "id": "hsa:23543", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23543", "resource": "KEGG Pathway" }, { "id": "R-HSA-6803529", "name": "FGFR2 alternative splicing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529", "resource": "Reactome", "description": "FGFR2 alternative splicing" } ], "orthologs": [ { "uniprot_canonical_ac": "A1A5R1-1", "protein_name": "RNA binding protein fox-1 homolog 2", "gene_name": "Rbfox2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAEGGQAQQQPPQLGPGAAARGMKRESEVELPVPGAGADGPEPGLSKRPRTEEAADEGMQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTSEHNLTLYGSSQPHGEQSSNSPSNQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNEAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 432 }, "evidence": [ { "id": "45924996", "url": "http://www.informatics.jax.org/homology/45924996", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8BP71-1", "protein_name": "RNA binding protein fox-1 homolog 2", "gene_name": "Rbfox2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAEGGQAQQQPPQLGPGAAARGMKRESEVELPVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTSEHNLTLYGSTQPHGEQSSNSPSNQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNEAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY", "length": 449 }, "evidence": [ { "id": "45924996", "url": "http://www.informatics.jax.org/homology/45924996", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "regulation of alternative mRNA splicing, via spliceosome", "id": "GO:0000381", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000381", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "intracellular estrogen receptor signaling pathway", "id": "GO:0030520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030520", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "RNA metabolic process", "id": "GO:0016070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016070", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "regulation of definitive erythrocyte differentiation", "id": "GO:0010724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010724", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "neuromuscular process controlling balance", "id": "GO:0050885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050885", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "dendrite morphogenesis", "id": "GO:0048813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048813", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" }, { "name": "radial glia guided migration of Purkinje cell", "id": "GO:0021942", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021942", "evidence": [ { "database": "UniProtKB", "id": "O43251", "url": "https://www.uniprot.org/uniprot/O43251" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 194, "end_pos": 196, "annotation": "n_glycosylation_sequon" }, { "start_pos": 68, "end_pos": 70, "annotation": "n_glycosylation_sequon" }, { "start_pos": 90, "end_pos": 92, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 7, 67 ], "sequon_annotation_sites": [ { "start_pos": 194, "end_pos": 196 }, { "start_pos": 68, "end_pos": 70 }, { "start_pos": 90, "end_pos": 92 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }