{ "uniprot_canonical_ac": "O15440-1", "uniprot_ac": "O15440", "uniprot_id": "MRP5_HUMAN", "mass": { "chemical_mass": 160660.0, "monoisotopic_mass": 160660.0 }, "refseq": { "ac": "NP_001018881", "name": "ATP-binding cassette sub-family C member 5 isoform 2", "summary": "The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" }, "gene_names": [ { "name": "ABCC5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15440", "id": "O15440" }, { "name": "ABC33; EST277145; MOAT-C; MOATC; MRP5; pABC11; SMRP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881", "id": "NP_001018881" }, { "name": "ABCC5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881", "id": "NP_001018881" }, { "name": "MRP5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15440", "id": "O15440" } ], "protein_names": [ { "name": "ATP-binding cassette sub-family C member 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15440" }, { "name": "7.6.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" }, { "name": "7.6.2.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" }, { "name": "ATP-binding cassette sub-family C member 5 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881", "id": "NP_001018881" }, { "name": "MOAT-C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" }, { "name": "Multi-specific organic anion transporter C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" }, { "name": "Multidrug resistance-associated protein 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" }, { "name": "SMRP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" }, { "name": "canalicular multispecific organic anion transporter C; multidrug resistance-associated protein 5; multi-specific organic anion transporter C; ATP-binding cassette, sub-family C (CFTR/MRP), member 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881", "id": "NP_001018881" }, { "name": "pABC11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15440" } ], "function": [ { "annotation": "ABCC5 facilitates the acquired resistance of sorafenib through the inhibition of SLC7A11-induced ferroptosis in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" }, { "database": "PubMed", "id": "34768109", "url": "https://glygen.org/publication/PubMed/34768109" } ] }, { "annotation": "ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds, and xenobiotics from cells. Mediates ATP-dependent transport of endogenous metabolites such as cAMP and cGMP, folic acid and N-lactoyl-amino acids (in vitro) (PubMed:10893247, PubMed:15899835, PubMed:25964343, PubMed:17229149, PubMed:12695538, PubMed:12637526). Acts also as a general glutamate conjugate and analog transporter that can limit the brain levels of endogenous metabolites, drugs, and toxins (PubMed:26515061). Confers resistance to the antiviral agent PMEA (PubMed:12695538). Able to transport several anticancer drugs including methotrexate, and nucleotide analogs in vitro, however it does with low affinity, thus the exact role of ABCC5 in mediating resistance still needs to be elucidated (PubMed:10840050, PubMed:15899835, PubMed:12435799, PubMed:12695538). Acts as a heme transporter required for the translocation of cytosolic heme to the secretory pathway (PubMed:24836561). May play a role in energy metabolism by regulating the glucagon-like peptide 1 (GLP-1) secretion from enteroendocrine cells (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440#function" }, { "database": "PubMed", "id": "10840050", "url": "https://glygen.org/publication/PubMed/10840050" }, { "database": "PubMed", "id": "24836561", "url": "https://glygen.org/publication/PubMed/24836561" }, { "database": "PubMed", "id": "12435799", "url": "https://glygen.org/publication/PubMed/12435799" }, { "database": "PubMed", "id": "12637526", "url": "https://glygen.org/publication/PubMed/12637526" }, { "database": "PubMed", "id": "26515061", "url": "https://glygen.org/publication/PubMed/26515061" }, { "database": "PubMed", "id": "12695538", "url": "https://glygen.org/publication/PubMed/12695538" }, { "database": "UniProtKB", "id": "Q9R1X5", "url": "https://www.uniprot.org/uniprot/Q9R1X5#function" }, { "database": "PubMed", "id": "17229149", "url": "https://glygen.org/publication/PubMed/17229149" }, { "database": "PubMed", "id": "15899835", "url": "https://glygen.org/publication/PubMed/15899835" }, { "database": "PubMed", "id": "25964343", "url": "https://glygen.org/publication/PubMed/25964343" }, { "database": "PubMed", "id": "10893247", "url": "https://glygen.org/publication/PubMed/10893247" } ] }, { "annotation": "Association of Single-Nucleotide Polymorphisms in ABCC5 Gene with Primary Angle Closure Glaucoma and the Ocular Biometric Parameters in a Northern Chinese Population.", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" }, { "database": "PubMed", "id": "32906129", "url": "https://glygen.org/publication/PubMed/32906129" } ] }, { "annotation": "FOXM1 Promotes Drug Resistance in Cervical Cancer Cells by Regulating ABCC5 Gene Transcription. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" }, { "database": "PubMed", "id": "35141332", "url": "https://glygen.org/publication/PubMed/35141332" } ] }, { "annotation": "Inhibition of ABCC5-mediated cGMP transport by progesterone, testosterone and their analogues.", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" }, { "database": "PubMed", "id": "34271023", "url": "https://glygen.org/publication/PubMed/34271023" } ] }, { "annotation": "Pan-cancer analysis and single-cell analysis revealed the role of ABCC5 transporter in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" }, { "database": "PubMed", "id": "34494510", "url": "https://glygen.org/publication/PubMed/34494510" } ] }, { "annotation": "The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O15440", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15440" } ], "glycoeffect": [], "start_pos": 1041, "end_pos": 1041, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "183949858", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R1041", "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs200996972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200996972" }, { "id": "rs200996972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200996972" }, { "id": "rs200996972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200996972#frequency_tab" }, { "id": "rs200996972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200996972" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1046, "end_pos": 1046, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIM).", "chr_id": "3", "chr_pos": "183949843", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1046", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776353307", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776353307" }, { "id": "rs776353307", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776353307" }, { "id": "rs776353307", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776353307" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1086, "end_pos": 1086, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQA->NQT).", "chr_id": "3", "chr_pos": "183947482", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A1086", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1160528638", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1160528638" }, { "id": "rs1160528638", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1160528638#frequency_tab" }, { "id": "rs1160528638", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1160528638" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1182, "end_pos": 1182, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKA->NKS).", "chr_id": "3", "chr_pos": "183942877", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A1182", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1203765474", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1203765474" }, { "id": "rs1203765474", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1203765474#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1329, "end_pos": 1329, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->YFS).", "chr_id": "3", "chr_pos": "183927392", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1329", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752979438", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752979438" }, { "id": "rs752979438", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752979438" }, { "id": "rs752979438", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752979438" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1331, "end_pos": 1331, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->NFL).", "chr_id": "3", "chr_pos": "183927385", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1331", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1242288800", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1242288800" }, { "id": "rs1242288800", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1242288800#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1378, "end_pos": 1378, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DCT->NCT).", "chr_id": "3", "chr_pos": "183925635", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1378", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1023050937", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1023050937" }, { "id": "rs1023050937", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1023050937" }, { "id": "rs1023050937", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1023050937#frequency_tab" }, { "id": "rs1023050937", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1023050937" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1417, "end_pos": 1417, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "3", "chr_pos": "183921364", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1417", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1370262330", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1370262330" }, { "id": "rs1370262330", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1370262330" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1419, "end_pos": 1419, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->NDG).", "chr_id": "3", "chr_pos": "183921359", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1419", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751011356", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751011356" }, { "id": "rs751011356", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751011356" }, { "id": "rs751011356", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751011356#frequency_tab" }, { "id": "rs751011356", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751011356" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 427, "end_pos": 427, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "3", "chr_pos": "183978520", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D427", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1352909048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1352909048" }, { "id": "rs1352909048", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1352909048#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 483, "end_pos": 483, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKT).", "chr_id": "3", "chr_pos": "183971877", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P483", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1181815172", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1181815172" }, { "id": "rs1181815172", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1181815172" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 485, "end_pos": 485, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "3", "chr_pos": "183971869", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S485", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755140186", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755140186" }, { "id": "rs755140186", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755140186" }, { "id": "rs755140186", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755140186" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 500, "end_pos": 500, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "3", "chr_pos": "183971826", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D500", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15440", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15440" } ], "glycoeffect": [], "start_pos": 535, "end_pos": 535, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "183971720", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R535", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs371762166", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371762166" }, { "id": "rs371762166", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371762166" }, { "id": "rs371762166", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371762166#frequency_tab" }, { "id": "rs371762166", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371762166" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 636, "end_pos": 636, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "3", "chr_pos": "183965429", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N636", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371762166", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371762166" }, { "id": "rs371762166", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371762166" }, { "id": "rs371762166", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371762166#frequency_tab" }, { "id": "rs371762166", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371762166" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 636, "end_pos": 636, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "3", "chr_pos": "183965429", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N636", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775292608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775292608" }, { "id": "rs775292608", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775292608" }, { "id": "rs775292608", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775292608" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 636, "end_pos": 636, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "3", "chr_pos": "183965427", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N636", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747031919", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747031919" }, { "id": "rs747031919", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747031919" }, { "id": "rs747031919", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747031919#frequency_tab" }, { "id": "rs747031919", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747031919" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 636, "end_pos": 636, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "3", "chr_pos": "183965428", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N636", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752102828", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752102828" }, { "id": "rs752102828", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752102828" }, { "id": "rs752102828", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752102828#frequency_tab" }, { "id": "rs752102828", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752102828" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 674, "end_pos": 674, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "3", "chr_pos": "183965196", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D674", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763115886", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763115886" }, { "id": "rs763115886", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763115886" }, { "id": "rs763115886", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763115886#frequency_tab" }, { "id": "rs763115886", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763115886" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 684, "end_pos": 684, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->ILS).", "chr_id": "3", "chr_pos": "183963569", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N684", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763115886", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763115886" }, { "id": "rs763115886", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763115886" }, { "id": "rs763115886", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763115886#frequency_tab" }, { "id": "rs763115886", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763115886" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 684, "end_pos": 684, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "3", "chr_pos": "183963569", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N684", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs563553260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563553260" }, { "id": "rs563553260", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs563553260" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 702, "end_pos": 702, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DRS->NRS).", "chr_id": "3", "chr_pos": "183963516", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "D702", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1404585574", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1404585574" }, { "id": "rs1404585574", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1404585574" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 794, "end_pos": 794, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (INS->NNS).", "chr_id": "3", "chr_pos": "183959834", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I794", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1183818643", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1183818643" }, { "id": "rs1183818643", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1183818643" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 897, "end_pos": 897, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "3", "chr_pos": "183951981", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N897", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1430045044", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1430045044" }, { "id": "rs1430045044", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1430045044#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 897, "end_pos": 897, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "3", "chr_pos": "183951982", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N897", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "72.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "85.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "70.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "89.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "57.59", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "82.89", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "63.63", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "77.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "90.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "86.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15440" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "common_name": "Human" } ], "gene": [ { "name": "ABCC5", "url": "https://www.uniprot.org/uniprot/O15440", "locus": { "chromosome": "3", "start_pos": 183919934, "end_pos": 184017939, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000114770", "url": "https://www.ensembl.org/id/ENSG00000114770" } ] } } ], "crossref": [ { "id": "ENSG00000114770", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000114770", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O15440", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15440", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "7.6.2.3", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=7.6.2.3&UniProtAcc=O15440", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd03244", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03244", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03250", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03250", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18592", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18592", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18599", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18599", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2046258", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2046258", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ABCC5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ABCC5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10057", "url": "https://www.ncbi.nlm.nih.gov/gene/10057", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "56", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=56", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15440", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15440*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003439", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003439", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036640", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036640", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10057", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10057", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "605251", "url": "http://www.omim.org/entry/605251", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15440", "url": "https://www.nextprot.org/entry/NX_O15440", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O15440", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15440", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AVRFVKF", "url": "https://omabrowser.org/oma/group/AVRFVKF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3384185at2759", "url": "http://www.orthodb.org/?query=3384185at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24223", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24223", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24223:SF196", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24223:SF196", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00005", "url": "http://pfam.xfam.org/family/PF00005", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00664", "url": "http://pfam.xfam.org/family/PF00664", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15440", "url": "https://pharos.nih.gov/targets/O15440", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15440", "url": "http://purl.obolibrary.org/obo/PR_O15440", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "66184", "url": "https://www.rhea-db.org/rhea/66184", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66188", "url": "https://www.rhea-db.org/rhea/66188", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66720", "url": "https://www.rhea-db.org/rhea/66720", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66728", "url": "https://www.rhea-db.org/rhea/66728", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66732", "url": "https://www.rhea-db.org/rhea/66732", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66736", "url": "https://www.rhea-db.org/rhea/66736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66740", "url": "https://www.rhea-db.org/rhea/66740", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66744", "url": "https://www.rhea-db.org/rhea/66744", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66752", "url": "https://www.rhea-db.org/rhea/66752", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66756", "url": "https://www.rhea-db.org/rhea/66756", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66760", "url": "https://www.rhea-db.org/rhea/66760", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "66764", "url": "https://www.rhea-db.org/rhea/66764", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A5PKY6", "url": "https://www.uniprot.org/uniprot/A5PKY6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A5PKY6-1", "url": "https://www.uniprot.org/uniprot/A5PKY6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JZL5", "url": "https://www.uniprot.org/uniprot/C9JZL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JZL5-1", "url": "https://www.uniprot.org/uniprot/C9JZL5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PET4", "url": "https://www.uniprot.org/uniprot/E9PET4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PET4-1", "url": "https://www.uniprot.org/uniprot/E9PET4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCY8", "url": "https://www.uniprot.org/uniprot/F8WCY8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCY8-1", "url": "https://www.uniprot.org/uniprot/F8WCY8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WDH3", "url": "https://www.uniprot.org/uniprot/F8WDH3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WDH3-1", "url": "https://www.uniprot.org/uniprot/F8WDH3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C271", "url": "https://www.uniprot.org/uniprot/H7C271", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C271-1", "url": "https://www.uniprot.org/uniprot/H7C271-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15440-1", "url": "https://www.uniprot.org/uniprot/O15440-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15440-2", "url": "https://www.uniprot.org/uniprot/O15440-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15440-3", "url": "https://www.uniprot.org/uniprot/O15440-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15440-4", "url": "https://www.uniprot.org/uniprot/O15440-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15440-5", "url": "https://www.uniprot.org/uniprot/O15440-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGSVPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1437, "header": "sp|O15440-1|MRP5_HUMAN Isoform 1 of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2 CANONICAL=O15440-1" }, "isoforms": [ { "isoform_ac": "A5PKY6-1", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPVSSNHPFRQSPGARPRPALTLLFCCRGCAQLWAR", "length": 231, "header": "tr|A5PKY6-1|A5PKY6_HUMAN Computationally mapped isoform of ABCC5 protein OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=1 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183987668, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000427120.6", "url": "https://www.ensembl.org/id/ENST00000427120.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000404809.2", "url": "https://www.ensembl.org/id/ENSP00000404809.2" } ] } }, { "isoform_ac": "C9JZL5-1", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCR", "length": 147, "header": "tr|C9JZL5-1|MRP5_HUMAN Computationally mapped isoform of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=1 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183988574, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437341.5", "url": "https://www.ensembl.org/id/ENST00000437341.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000399726.1", "url": "https://www.ensembl.org/id/ENSP00000399726.1" } ] } }, { "isoform_ac": "E9PET4-1", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPSQSLTLSPRL", "length": 53, "header": "tr|E9PET4-1|E9PET4_HUMAN Computationally mapped isoform of ATP binding cassette subfamily C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=1 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 184001222, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000446941.2", "url": "https://www.ensembl.org/id/ENST00000446941.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000390911.2", "url": "https://www.ensembl.org/id/ENSP00000390911.2" } ] } }, { "isoform_ac": "F8WCY8-1", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKLPSTV", "length": 473, "header": "tr|F8WCY8-1|F8WCY8_HUMAN Computationally mapped isoform of ATP binding cassette subfamily C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=1 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183972020, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437205.5", "url": "https://www.ensembl.org/id/ENST00000437205.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000403510.1", "url": "https://www.ensembl.org/id/ENSP00000403510.1" } ] } }, { "isoform_ac": "F8WDH3-1", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPRHSHCWPGCC", "length": 53, "header": "tr|F8WDH3-1|F8WDH3_HUMAN Computationally mapped isoform of ATP binding cassette subfamily C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=1 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 184009948, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000438979.6", "url": "https://www.ensembl.org/id/ENST00000438979.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000409913.2", "url": "https://www.ensembl.org/id/ENSP00000409913.2" } ] } }, { "isoform_ac": "H7C271-1", "url": "", "sequence": { "sequence": "XFTIKPKEKIGIVGRTGSEHWGTQPSTKEEQHPQLCYPERSTGNILGSPRWGWPSSVWWSYLEAASRLME", "length": 70, "header": "tr|H7C271-1|H7C271_HUMAN Computationally mapped isoform of ATP binding cassette subfamily C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=4 SV=1 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 183942780, "end_pos": 183937988, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443497.1", "url": "https://www.ensembl.org/id/ENST00000443497.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000404302.1", "url": "https://www.ensembl.org/id/ENSP00000404302.1" } ] } }, { "isoform_ac": "O15440-1", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGSVPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1437, "header": "sp|O15440-1|MRP5_HUMAN Isoform 1 of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183921303, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000334444.11", "url": "https://www.ensembl.org/id/ENST00000334444.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000333926.6", "url": "https://www.ensembl.org/id/ENSP00000333926.6" } ] } }, { "isoform_ac": "O15440-2", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPPSFGDCSISAEVCGNRLHCTAILLSCFT", "length": 225, "header": "sp|O15440-2|MRP5_HUMAN Isoform 2 of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183984811, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000392579.6", "url": "https://www.ensembl.org/id/ENST00000392579.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000376358.2", "url": "https://www.ensembl.org/id/ENSP00000376358.2" } ] } }, { "isoform_ac": "O15440-3", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPLAWCCQDLDLGGVSL", "length": 212, "header": "sp|O15440-3|MRP5_HUMAN Isoform 3 of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183985411, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443376.5", "url": "https://www.ensembl.org/id/ENST00000443376.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000416840.1", "url": "https://www.ensembl.org/id/ENSP00000416840.1" } ] } }, { "isoform_ac": "O15440-4", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE", "length": 208, "header": "sp|O15440-4|MRP5_HUMAN Isoform 4 of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183985346, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000382494.6", "url": "https://www.ensembl.org/id/ENST00000382494.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000371934.2", "url": "https://www.ensembl.org/id/ENSP00000371934.2" } ] } }, { "isoform_ac": "O15440-5", "url": "", "sequence": { "sequence": "MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGSVPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1394, "header": "sp|O15440-5|MRP5_HUMAN Isoform 5 of ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2 CANONICAL=O15440-1" }, "locus": { "chromosome": "3", "start_pos": 184014392, "end_pos": 183921303, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000265586.10", "url": "https://www.ensembl.org/id/ENST00000265586.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000265586.6", "url": "https://www.ensembl.org/id/ENSP00000265586.6" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1044, "start_aa": "Asn", "end_pos": 1044, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1044", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1329, "start_aa": "Asn", "end_pos": 1329, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1329", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1417, "start_aa": "Asn", "end_pos": 1417, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1417", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 485, "start_aa": "Ser", "end_pos": 485, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser485", "evidence": [ { "id": "O15440", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15440" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 494, "start_aa": "Asn", "end_pos": 494, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn494", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 636, "start_aa": "Asn", "end_pos": 636, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn636", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 684, "start_aa": "Asn", "end_pos": 684, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn684", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 890, "start_aa": "Asn", "end_pos": 890, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn890", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 897, "start_aa": "Asn", "end_pos": 897, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn897", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] } ], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" } ], "site_lbl": "Ser14" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" } ], "site_lbl": "Ser19" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr41" }, { "start_pos": 501, "end_pos": 501, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser501" }, { "start_pos": 502, "end_pos": 502, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser502" }, { "start_pos": 504, "end_pos": 504, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser504" }, { "start_pos": 505, "end_pos": 505, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O15440", "url": "http://phospho.elm.eu.org/byAccession/O15440.html" } ], "site_lbl": "Ser505" }, { "start_pos": 509, "end_pos": 509, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O15440", "url": "http://phospho.elm.eu.org/byAccession/O15440.html" } ], "site_lbl": "Ser509" }, { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O15440", "url": "http://phospho.elm.eu.org/byAccession/O15440.html" } ], "site_lbl": "Thr513" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" } ], "site_lbl": "Ser60" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "pABC11 (also known as MOAT-C and MRP5), a member of the ABC family of proteins, has anion transporter activity but does not confer multidrug resistance when overexpressed in human embryonic kidney 293 cells.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "McAleer M A, Breen M A, White N L, Matthews N", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "10438534", "url": "https://glygen.org/publication/PubMed/10438534" } ] }, { "title": "Profound differences in the transport of steroids by two mouse P-glycoproteins.", "journal": "Biochemical pharmacology", "date": "1999", "authors": "Gruol DJ, Vo QD, Zee MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10484077", "url": "https://glygen.org/publication/PubMed/10484077" } ] }, { "title": "Interaction of docetaxel (`Taxotere`) with human P-glycoprotein.", "journal": "Japanese journal of cancer research : Gann", "date": "1999", "authors": "Shirakawa K, Takara K, Tanigawara Y, Aoyama N, Kasuga M, Komada F, Sakaeda T, Okumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10665657", "url": "https://glygen.org/publication/PubMed/10665657" } ] }, { "title": "Detailed structural analysis on both human MRP5 and mouse mrp5 transcripts.", "journal": "Gene", "date": "2000", "authors": "Suzuki T, Sasaki H, Kuh H J, Agui M, Tatsumi Y, Tanabe S, Terada M, Saijo N, Nishio K", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "10721709", "url": "https://glygen.org/publication/PubMed/10721709" } ] }, { "title": "Contribution of CYP2E1 and CYP3A to acetaminophen reactive metabolite formation.", "journal": "Clinical pharmacology and therapeutics", "date": "2000", "authors": "Manyike PT, Kharasch ED, Kalhorn TF, Slattery JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "10741631", "url": "https://glygen.org/publication/PubMed/10741631" } ] }, { "title": "Characterization of ABCB9, an ATP binding cassette protein associated with lysosomes.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang F, Zhang W, Liu L, Fisher CL, Hui D, Childs S, Dorovini-Zis K, Ling V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10748049", "url": "https://glygen.org/publication/PubMed/10748049" } ] }, { "title": "Multidrug-resistance protein 5 is a multispecific organic anion transporter able to transport nucleotide analogs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Wijnholds J, Mol CA, van Deemter L, de Haas M, Scheffer GL, Baas F, Beijnen JH, Scheper RJ, Hatse S, De Clercq E, Balzarini J, Borst P", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "10840050", "url": "https://glygen.org/publication/PubMed/10840050" } ] }, { "title": "The multidrug resistance protein 5 functions as an ATP-dependent export pump for cyclic nucleotides.", "journal": "The Journal of biological chemistry", "date": "2000-09-29", "authors": "Jedlitschky G, Burchell B, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "10893247", "url": "https://glygen.org/publication/PubMed/10893247" } ] }, { "title": "Kinetics of P-glycoprotein-mediated efflux of paclitaxel.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Jang SH, Wientjes MG, Au JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11504826", "url": "https://glygen.org/publication/PubMed/11504826" } ] }, { "title": "Na+:HCO(3-) cotransporters (NBC): cloning and characterization.", "journal": "The Journal of membrane biology", "date": "2001", "authors": "Soleimani M, Burnham CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11562789", "url": "https://glygen.org/publication/PubMed/11562789" } ] }, { "title": "Interindividual variability in acetaminophen glucuronidation by human liver microsomes: identification of relevant acetaminophen UDP-glucuronosyltransferase isoforms.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Court MH, Duan SX, von Moltke LL, Greenblatt DJ, Patten CJ, Miners JO, Mackenzie PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "11714888", "url": "https://glygen.org/publication/PubMed/11714888" } ] }, { "title": "A principal role for the proteasome in endoplasmic reticulum-associated degradation of misfolded intracellular cystic fibrosis transmembrane conductance regulator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Gelman MS, Kannegaard ES, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11812794", "url": "https://glygen.org/publication/PubMed/11812794" } ] }, { "title": "Functional analysis of ABCA8, a new drug transporter.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Tsuruoka S, Ishibashi K, Yamamoto H, Wakaumi M, Suzuki M, Schwartz GJ, Imai M, Fujimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12379217", "url": "https://glygen.org/publication/PubMed/12379217" } ] }, { "title": "The role of the efflux transporter P-glycoprotein in brain penetration of prednisolone.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Karssen AM, Meijer OC, van der Sandt IC, De Boer AG, De Lange EC, De Kloet ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12379510", "url": "https://glygen.org/publication/PubMed/12379510" } ] }, { "title": "The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3- cotransport isoform 3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Park M, Ko SB, Choi JY, Muallem G, Thomas PJ, Pushkin A, Lee MS, Kim JY, Lee MG, Muallem S, Kurtz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12403779", "url": "https://glygen.org/publication/PubMed/12403779" } ] }, { "title": "Thiopurine metabolism and identification of the thiopurine metabolites transported by MRP4 and MRP5 overexpressed in human embryonic kidney cells.", "journal": "Molecular pharmacology", "date": "2002", "authors": "Wielinga PR, Reid G, Challa EE, van der Heijden I, van Deemter L, de Haas M, Mol C, Kuil AJ, Groeneveld E, Schuetz JD, Brouwer C, De Abreu RA, Wijnholds J, Beijnen JH, Borst P", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "12435799", "url": "https://glygen.org/publication/PubMed/12435799" } ] }, { "title": "Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Teufel M, Saudek V, Ledig JP, Bernhardt A, Boularand S, Carreau A, Cairns NJ, Carter C, Cowley DJ, Duverger D, Ganzhorn AJ, Guenet C, Heintzelmann B, Laucher V, Sauvage C, Smirnova T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "12473676", "url": "https://glygen.org/publication/PubMed/12473676" } ] }, { "title": "Distribution of STI-571 to the brain is limited by P-glycoprotein-mediated efflux.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2003", "authors": "Dai H, Marbach P, Lemaire M, Hayes M, Elmquist WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12604685", "url": "https://glygen.org/publication/PubMed/12604685" } ] }, { "title": "Characterization of the MRP4- and MRP5-mediated transport of cyclic nucleotides from intact cells.", "journal": "The Journal of biological chemistry", "date": "2003-05-16", "authors": "Wielinga Peter R, van der Heijden Ingrid, Reid Glen, Beijnen Jos H, Wijnholds Jan, Borst Piet", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "12637526", "url": "https://glygen.org/publication/PubMed/12637526" } ] }, { "title": "Characterization of the transport of nucleoside analog drugs by the human multidrug resistance proteins MRP4 and MRP5.", "journal": "Molecular pharmacology", "date": "2003-05", "authors": "Reid Glen, Wielinga Peter, Zelcer Noam, De Haas Marcel, Van Deemter Liesbeth, Wijnholds Jan, Balzarini Jan, Borst Piet", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "12695538", "url": "https://glygen.org/publication/PubMed/12695538" } ] }, { "title": "CD28-dependent Rac1 activation is the molecular target of azathioprine in primary human CD4+ T lymphocytes.", "journal": "The Journal of clinical investigation", "date": "2003", "authors": "Tiede I, Fritz G, Strand S, Poppe D, Dvorsky R, Strand D, Lehr HA, Wirtz S, Becker C, Atreya R, Mudter J, Hildner K, Bartsch B, Holtmann M, Blumberg R, Walczak H, Iven H, Galle PR, Ahmadian MR, Neurath MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "12697733", "url": "https://glygen.org/publication/PubMed/12697733" } ] }, { "title": "Efficient inhibition of P-glycoprotein-mediated multidrug resistance with a monoclonal antibody.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Mechetner EB, Roninson IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1352877", "url": "https://glygen.org/publication/PubMed/1352877" } ] }, { "title": "Partial purification and reconstitution of the human multidrug-resistance pump: characterization of the drug-stimulatable ATP hydrolysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Ambudkar SV, Lelong IH, Zhang J, Cardarelli CO, Gottesman MM, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1356264", "url": "https://glygen.org/publication/PubMed/1356264" } ] }, { "title": "P-glycoprotein but not topoisomerase II and glutathione-S-transferase-pi accounts for enhanced intracellular drug-resistance in LoVo MDR human cell lines.", "journal": "Tumori", "date": "1992", "authors": "Boiocchi M, Tumiotto L, Giannini F, Viel A, Biscontin G, Sartor F, Toffoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1359686", "url": "https://glygen.org/publication/PubMed/1359686" } ] }, { "title": "Phosphorylation of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Picciotto MR, Cohn JA, Bertuzzi G, Greengard P, Nairn AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1377674", "url": "https://glygen.org/publication/PubMed/1377674" } ] }, { "title": "Structural determinants of P-glycoprotein-mediated transport of glucocorticoids.", "journal": "Pharmaceutical research", "date": "2003", "authors": "Yates CR, Chang C, Kearbey JD, Yasuda K, Schuetz EG, Miller DD, Dalton JT, Swaan PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "14661924", "url": "https://glygen.org/publication/PubMed/14661924" } ] }, { "title": "Pharmacokinetics of erythromycin in rabbit corneas after single-dose infusion: role of P-glycoprotein as a barrier to in vivo ocular drug absorption.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Dey S, Gunda S, Mitra AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15175422", "url": "https://glygen.org/publication/PubMed/15175422" } ] }, { "title": "Identification of budesonide and prednisone as substrates of the intestinal drug efflux pump P-glycoprotein.", "journal": "Inflammatory bowel diseases", "date": "2004", "authors": "Dilger K, Schwab M, Fromm MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15472518", "url": "https://glygen.org/publication/PubMed/15472518" } ] }, { "title": "Expression and immunolocalization of the multidrug resistance proteins, MRP1-MRP6 (ABCC1-ABCC6), in human brain.", "journal": "Neuroscience", "date": "2004", "authors": "Nies A T, Jedlitschky G, K\u00f6nig J, Herold-Mende C, Steiner H H, Schmitt H-P, Keppler D", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "15501592", "url": "https://glygen.org/publication/PubMed/15501592" } ] }, { "title": "Cellular export of drugs and signaling molecules by the ATP-binding cassette transporters MRP4 (ABCC4) and MRP5 (ABCC5).", "journal": "Drug metabolism reviews", "date": "2005", "authors": "Ritter CA, Jedlitschky G, Meyer zu Schwabedissen H, Grube M, Kock K, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "15747503", "url": "https://glygen.org/publication/PubMed/15747503" } ] }, { "title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.", "journal": "Biochemistry", "date": "2005", "authors": "Heo J, Thapar R, Campbell SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "15850391", "url": "https://glygen.org/publication/PubMed/15850391" } ] }, { "title": "Selective and ATP-dependent translocation of peptides by the homodimeric ATP binding cassette transporter TAP-like (ABCB9).", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Wolters JC, Abele R, Tampe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15863492", "url": "https://glygen.org/publication/PubMed/15863492" } ] }, { "title": "ABCB5-mediated doxorubicin transport and chemoresistance in human malignant melanoma.", "journal": "Cancer research", "date": "2005", "authors": "Frank NY, Margaryan A, Huang Y, Schatton T, Waaga-Gasser AM, Gasser M, Sayegh MH, Sadee W, Frank MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15899824", "url": "https://glygen.org/publication/PubMed/15899824" } ] }, { "title": "The human multidrug resistance protein MRP5 transports folates and can mediate cellular resistance against antifolates.", "journal": "Cancer research", "date": "2005-05-15", "authors": "Wielinga Peter, Hooijberg Jan Hendrik, Gunnarsdottir Sjofn, Kathmann Ietje, Reid Glen, Zelcer Noam, van der Born Kasper, de Haas Marcel, van der Heijden Ingrid, Kaspers Gertjan, Wijnholds Jan, Jansen Gerrit, Peters Godefridus, Borst Piet", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "15899835", "url": "https://glygen.org/publication/PubMed/15899835" } ] }, { "title": "Involvement of the concentrative nucleoside transporter 3 and equilibrative nucleoside transporter 2 in the resistance of T-lymphoblastic cell lines to thiopurines.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Fotoohi AK, Lindqvist M, Peterson C, Albertioni F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "16530731", "url": "https://glygen.org/publication/PubMed/16530731" } ] }, { "title": "Kinetics of acetaminophen glucuronidation by UDP-glucuronosyltransferases 1A1, 1A6, 1A9 and 2B15. Potential implications in acetaminophen-induced hepatotoxicity.", "journal": "Chemical research in toxicology", "date": "2006", "authors": "Mutlib AE, Goosen TC, Bauman JN, Williams JA, Kulkarni S, Kostrubsky S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "16696573", "url": "https://glygen.org/publication/PubMed/16696573" } ] }, { "title": "Divergent activities of human glutathione transferases in the bioactivation of azathioprine.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Eklund BI, Moberg M, Bergquist J, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "16717136", "url": "https://glygen.org/publication/PubMed/16717136" } ] }, { "title": "Transmembrane transport of endo- and xenobiotics by mammalian ATP-binding cassette multidrug resistance proteins.", "journal": "Physiological reviews", "date": "2006", "authors": "Deeley RG, Westlake C, Cole SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "16816140", "url": "https://glygen.org/publication/PubMed/16816140" } ] }, { "title": "Sequential quality-control checkpoints triage misfolded cystic fibrosis transmembrane conductance regulator.", "journal": "Cell", "date": "2006", "authors": "Younger JM, Chen L, Ren HY, Rosser MF, Turnbull EL, Fan CY, Patterson C, Cyr DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "16901789", "url": "https://glygen.org/publication/PubMed/16901789" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O15440-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "cGMP transport by vesicles from human and mouse erythrocytes.", "journal": "The FEBS journal", "date": "2007", "authors": "de Wolf CJ, Yamaguchi H, van der Heijden I, Wielinga PR, Hundscheid SL, Ono N, Scheffer GL, de Haas M, Schuetz JD, Wijnholds J, Borst P", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "17229149", "url": "https://glygen.org/publication/PubMed/17229149" } ] }, { "title": "Human xanthine oxidase changes its substrate specificity to aldehyde oxidase type upon mutation of amino acid residues in the active site: roles of active site residues in binding and activation of purine substrate.", "journal": "Journal of biochemistry", "date": "2007", "authors": "Yamaguchi Y, Matsumura T, Ichida K, Okamoto K, Nishino T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "17301077", "url": "https://glygen.org/publication/PubMed/17301077" } ] }, { "title": "Three novel ABCC5 splice variants in human retina and their role as regulators of ABCC5 gene expression.", "journal": "BMC Mol. Biol.", "date": "2007", "authors": "Stojic Jelena, St\u00f6hr Heidi, Weber Bernhard H F", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "17521428", "url": "https://glygen.org/publication/PubMed/17521428" } ] }, { "title": "Bile salt-dependent efflux of cellular phospholipids mediated by ATP binding cassette protein B4.", "journal": "Hepatology (Baltimore, Md.)", "date": "2007", "authors": "Morita SY, Kobayashi A, Takanezawa Y, Kioka N, Handa T, Arai H, Matsuo M, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17523162", "url": "https://glygen.org/publication/PubMed/17523162" } ] }, { "title": "Hyaluronan export by the ABC transporter MRP5 and its modulation by intracellular cGMP.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Schulz T, Schumacher U, Prehm P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850" } ], "reference": [ { "type": "PubMed", "id": "17540771", "url": "https://glygen.org/publication/PubMed/17540771" } ] }, { "title": "Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007", "authors": "Barnes SN, Aleksunes LM, Augustine L, Scheffer GL, Goedken MJ, Jakowski AB, Pruimboom-Brees IM, Cherrington NJ, Manautou JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17627974", "url": "https://glygen.org/publication/PubMed/17627974" } ] }, { "title": "A mutation in the ATP-binding site of the Kir6.2 subunit of the KATP channel alters coupling with the SUR2A subunit.", "journal": "The Journal of physiology", "date": "2007", "authors": "Tammaro P, Ashcroft FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17855752", "url": "https://glygen.org/publication/PubMed/17855752" } ] }, { "title": "The N-terminal region of ABC50 interacts with eukaryotic initiation factor eIF2 and is a target for regulatory phosphorylation by CK2.", "journal": "The Biochemical journal", "date": "2008", "authors": "Paytubi S, Morrice NA, Boudeau J, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17894550", "url": "https://glygen.org/publication/PubMed/17894550" } ] }, { "title": "Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.", "journal": "Biochemistry", "date": "2007", "authors": "Castonguay R, Halim D, Morin M, Furtos A, Lherbet C, Bonneil E, Thibault P, Keillor JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17924658", "url": "https://glygen.org/publication/PubMed/17924658" } ] }, { "title": "Identification of a lysosomal peptide transport system induced during dendritic cell development.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Demirel O, Waibler Z, Kalinke U, Grunebach F, Appel S, Brossart P, Hasilik A, Tampe R, Abele R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17977821", "url": "https://glygen.org/publication/PubMed/17977821" } ] }, { "title": "Up-regulation of MRP4 and down-regulation of influx transporters in human leukemic cells with acquired resistance to 6-mercaptopurine.", "journal": "Leukemia research", "date": "2008", "authors": "Peng XX, Shi Z, Damaraju VL, Huang XC, Kruh GD, Wu HC, Zhou Y, Tiwari A, Fu L, Cass CE, Chen ZS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "17996297", "url": "https://glygen.org/publication/PubMed/17996297" } ] }, { "title": "Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects.", "journal": "Birth defects research. Part A, Clinical and molecular teratology", "date": "2008", "authors": "Adjei AA, Gaedigk A, Simon SD, Weinshilboum RM, Leeder JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18232020", "url": "https://glygen.org/publication/PubMed/18232020" } ] }, { "title": "Inhibition of MDR1 expression by retinol treatment increases sensitivity to etoposide (VP16) in human neoplasic cell line.", "journal": "Toxicology in vitro : an international journal published in association with BIBRA", "date": "2008", "authors": "Klamt F, Passos DT, Castro MA, Gelain DP, Grivicich I, Moreira JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "18282684", "url": "https://glygen.org/publication/PubMed/18282684" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "Peptide specificity and lipid activation of the lysosomal transport complex ABCB9 (TAPL).", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao C, Haase W, Tampe R, Abele R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "18434309", "url": "https://glygen.org/publication/PubMed/18434309" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "iPTMnet", "id": "O15440-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "One step at a time: endoplasmic reticulum-associated degradation.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Vembar SS, Brodsky JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19002207", "url": "https://glygen.org/publication/PubMed/19002207" } ] }, { "title": "Influx and efflux transport as determinants of melphalan cytotoxicity: Resistance to melphalan in MDR1 overexpressing tumor cell lines.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Kuhne A, Tzvetkov MV, Hagos Y, Lage H, Burckhardt G, Brockmoller J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19447222", "url": "https://glygen.org/publication/PubMed/19447222" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "ABC50 promotes translation initiation in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Paytubi S, Wang X, Lam YW, Izquierdo L, Hunter MJ, Jan E, Hundal HS, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19570978", "url": "https://glygen.org/publication/PubMed/19570978" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O15440-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Multidrug resistance phenotype of human BRO melanoma cells transfected with a wild-type human mdr1 complementary DNA.", "journal": "Cancer research", "date": "1990", "authors": "Lincke CR, van der Bliek AM, Schuurhuis GJ, van der Velde-Koerts T, Smit JJ, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1968359", "url": "https://glygen.org/publication/PubMed/1968359" } ] }, { "title": "Reassessment of the interactions of guanylate kinase and 6-thioguanosine 5'-phosphate.", "journal": "Biochemical pharmacology", "date": "1977", "authors": "Miller RL, Adamczyk DL, Spector T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "197968", "url": "https://glygen.org/publication/PubMed/197968" } ] }, { "title": "Isoform-selective inactivation of human arylamine N-acetyltransferases by reactive metabolites of carcinogenic arylamines.", "journal": "Chemical research in toxicology", "date": "2009", "authors": "Liu L, Wagner CR, Hanna PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19842618", "url": "https://glygen.org/publication/PubMed/19842618" } ] }, { "title": "MDR1 polymorphism role in patients treated with cetuximab and irinotecan in irinotecan refractory colorectal cancer.", "journal": "Medical oncology (Northwood, London, England)", "date": "2010", "authors": "Paule B, Castagne V, Picard V, Saffroy R, Adam R, Guettier C, Farinotti R, Bonhomme-Faivre L", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19862647", "url": "https://glygen.org/publication/PubMed/19862647" } ] }, { "title": "A mutation in the second nucleotide binding fold of the cystic fibrosis gene.", "journal": "American journal of human genetics", "date": "1991", "authors": "Osborne L, Knight R, Santis G, Hodson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1998343", "url": "https://glygen.org/publication/PubMed/1998343" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "iPTMnet", "id": "O15440-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Membrane transporters in drug development.", "journal": "Nature reviews. Drug discovery", "date": "2010", "authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "20190787", "url": "https://glygen.org/publication/PubMed/20190787" } ] }, { "title": "Determination of 6-thioguanosine diphosphate and triphosphate and nucleoside diphosphate kinase activity in erythrocytes: novel targets for thiopurine therapy?", "journal": "Therapeutic drug monitoring", "date": "2010", "authors": "Karner S, Shi S, Fischer C, Schaeffeler E, Neurath MF, Herrlinger KR, Hofmann U, Schwab M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "20216118", "url": "https://glygen.org/publication/PubMed/20216118" } ] }, { "title": "P-glycoprotein, but not multidrug resistance protein 4, plays a role in the systemic clearance of irinotecan and SN-38 in mice.", "journal": "Drug metabolism letters", "date": "2010", "authors": "Tagen M, Zhuang Y, Zhang F, Harstead KE, Shen J, Schaiquevich P, Fraga CH, Panetta JC, Waters CM, Stewart CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "20583968", "url": "https://glygen.org/publication/PubMed/20583968" } ] }, { "title": "Differences in assessment of macrolide interaction with human MDR1 (ABCB1, P-gp) using rhodamine-123 efflux, ATPase activity and cellular accumulation assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2010", "authors": "Munic V, Kelneric Z, Mikac L, Erakovic Haber V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "20621639", "url": "https://glygen.org/publication/PubMed/20621639" } ] }, { "title": "Guanylate kinases from human erythrocytes, hog brain, and rat liver.", "journal": "Methods in enzymology", "date": "1978", "authors": "Agarwal KC, Miech RP, Parks RE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "211390", "url": "https://glygen.org/publication/PubMed/211390" } ] }, { "title": "UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2011", "authors": "Navarro SL, Chen Y, Li L, Li SS, Chang JL, Schwarz Y, King IB, Potter JD, Bigler J, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21666065", "url": "https://glygen.org/publication/PubMed/21666065" } ] }, { "title": "Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21712391", "url": "https://glygen.org/publication/PubMed/21712391" } ] }, { "title": "The pattern of gene expression and gene dose profiles of 6-Mercaptopurine- and 6-Thioguanine-resistant human leukemia cells.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Karim H, Hashemi J, Larsson C, Moshfegh A, Fotoohi AK, Albertioni F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "21723252", "url": "https://glygen.org/publication/PubMed/21723252" } ] }, { "title": "CFTR and TMEM16A are separate but functionally related Cl- channels.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2011", "authors": "Ousingsawat J, Kongsuphol P, Schreiber R, Kunzelmann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "22178883", "url": "https://glygen.org/publication/PubMed/22178883" } ] }, { "title": "Aminoacylase 1-catalysed deacetylation of bioactives epoxides mycotoxin-derived mercapturates; 3,4-epoxyprecocenes as models of cytotoxic epoxides.", "journal": "Biochimie", "date": "2012", "authors": "Stocker P, Brunel JM, de Rezende L, do Amaral AT, Morelli X, Roche P, Vidal N, Giardina T, Perrier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22349737", "url": "https://glygen.org/publication/PubMed/22349737" } ] }, { "title": "Impact of probe compound in MRP2 vesicular transport assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2012", "authors": "Kidron H, Wissel G, Manevski N, Hakli M, Ketola RA, Finel M, Yliperttula M, Xhaard H, Urtti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22406294", "url": "https://glygen.org/publication/PubMed/22406294" } ] }, { "title": "Structure-based redesign of GST A2-2 for enhanced catalytic efficiency with azathioprine.", "journal": "Chemistry & biology", "date": "2012", "authors": "Zhang W, Moden O, Tars K, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "22444596", "url": "https://glygen.org/publication/PubMed/22444596" } ] }, { "title": "Characterisation of the roles of ABCB1, ABCC1, ABCC2 and ABCG2 in the transport and pharmacokinetics of actinomycin D in vitro and in vivo.", "journal": "Biochemical pharmacology", "date": "2013", "authors": "Hill CR, Jamieson D, Thomas HD, Brown CD, Boddy AV, Veal GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "23063411", "url": "https://glygen.org/publication/PubMed/23063411" } ] }, { "title": "New insight into the molecular switch mechanism of human Rho family proteins: shifting a paradigm.", "journal": "Biological chemistry", "date": "2013", "authors": "Jaiswal M, Fansa EK, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "23096567", "url": "https://glygen.org/publication/PubMed/23096567" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" }, { "database": "iPTMnet", "id": "O15440", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15440" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "KIAA1199, a deafness gene of unknown function, is a new hyaluronan binding protein involved in hyaluronan depolymerization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Yoshida H, Nagaoka A, Kusaka-Kikushima A, Tobiishi M, Kawabata K, Sayo T, Sakai S, Sugiyama Y, Enomoto H, Okada Y, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850" } ], "reference": [ { "type": "PubMed", "id": "23509262", "url": "https://glygen.org/publication/PubMed/23509262" } ] }, { "title": "Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "West MB, Wickham S, Parks EE, Sherry DM, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "23682772", "url": "https://glygen.org/publication/PubMed/23682772" } ] }, { "title": "Substrate specificity and oligomerization of human GMP synthetase.", "journal": "Journal of molecular biology", "date": "2013", "authors": "Welin M, Lehtio L, Johansson A, Flodin S, Nyman T, Tresaugues L, Hammarstrom M, Graslund S, Nordlund P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "23816837", "url": "https://glygen.org/publication/PubMed/23816837" } ] }, { "title": "RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "El Khouri E, Le Pavec G, Toledano MB, Delaunay-Moisan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "24019521", "url": "https://glygen.org/publication/PubMed/24019521" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Biosynthesis of cystic fibrosis transmembrane conductance regulator.", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Pranke IM, Sermet-Gaudelus I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "24685677", "url": "https://glygen.org/publication/PubMed/24685677" } ] }, { "title": "Identification of the cystic fibrosis gene: cloning and characterization of complementary DNA.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Riordan JR, Rommens JM, Kerem B, Alon N, Rozmahel R, Grzelczak Z, Zielenski J, Lok S, Plavsic N, Chou JL, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2475911", "url": "https://glygen.org/publication/PubMed/2475911" } ] }, { "title": "In vitro oxidative metabolism of 6-mercaptopurine in human liver: insights into the role of the molybdoflavoenzymes aldehyde oxidase, xanthine oxidase, and xanthine dehydrogenase.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2014", "authors": "Choughule KV, Barnaba C, Joswig-Jones CA, Jones JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "24824603", "url": "https://glygen.org/publication/PubMed/24824603" } ] }, { "title": "Control of metazoan heme homeostasis by a conserved multidrug resistance protein.", "journal": "Cell metabolism", "date": "2014-06-03", "authors": "Korolnek Tamara, Zhang Jianbing, Beardsley Simon, Scheffer George L, Hamza Iqbal", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "24836561", "url": "https://glygen.org/publication/PubMed/24836561" } ] }, { "title": "Glutathione transferases in the bioactivation of azathioprine.", "journal": "Advances in cancer research", "date": "2014", "authors": "Moden O, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "24974183", "url": "https://glygen.org/publication/PubMed/24974183" } ] }, { "title": "Molecular mechanisms for biliary phospholipid and drug efflux mediated by ABCB4 and bile salts.", "journal": "BioMed research international", "date": "2014", "authors": "Morita SY, Terada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "25133187", "url": "https://glygen.org/publication/PubMed/25133187" } ] }, { "title": "Transepithelial transport of drugs by the multidrug transporter in cultured Madin-Darby canine kidney cell epithelia.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Horio M, Chin KV, Currier SJ, Goldenberg S, Williams C, Pastan I, Gottesman MM, Handler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2570070", "url": "https://glygen.org/publication/PubMed/2570070" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "N-lactoyl-amino acids are ubiquitous metabolites that originate from CNDP2-mediated reverse proteolysis of lactate and amino acids.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Jansen RS, Addie R, Merkx R, Fish A, Mahakena S, Bleijerveld OB, Altelaar M, IJlst L, Wanders RJ, Borst P, van de Wetering K", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "25964343", "url": "https://glygen.org/publication/PubMed/25964343" } ] }, { "title": "PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses.", "journal": "Pharmacogenetics and genomics", "date": "2015", "authors": "Mazaleuskaya LL, Sangkuhl K, Thorn CF, FitzGerald GA, Altman RB, Klein TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26049587", "url": "https://glygen.org/publication/PubMed/26049587" } ] }, { "title": "Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Yamamoto A, Liu MY, Kurogi K, Sakakibara Y, Saeki Y, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26067475", "url": "https://glygen.org/publication/PubMed/26067475" } ] }, { "title": "Temozolomide competes for P-glycoprotein and contributes to chemoresistance in glioblastoma cells.", "journal": "Cancer letters", "date": "2015", "authors": "Munoz JL, Walker ND, Scotto KW, Rameshwar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "26208431", "url": "https://glygen.org/publication/PubMed/26208431" } ] }, { "title": "Crystal structure, biochemical and cellular activities demonstrate separate functions of MTH1 and MTH2.", "journal": "Nature communications", "date": "2015", "authors": "Carter M, Jemth AS, Hagenkort A, Page BD, Gustafsson R, Griese JJ, Gad H, Valerie NC, Desroses M, Bostrom J, Warpman Berglund U, Helleday T, Stenmark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "26238318", "url": "https://glygen.org/publication/PubMed/26238318" } ] }, { "title": "ATP-binding Cassette Subfamily C Member 5 (ABCC5) Functions as an Efflux Transporter of Glutamate Conjugates and Analogs.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Jansen RS, Mahakena S, de Haas M, Borst P, van de Wetering K", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "26515061", "url": "https://glygen.org/publication/PubMed/26515061" } ] }, { "title": "Polymorphisms in the multidrug-resistance 1 gene related to glucocorticoid response in rheumatoid arthritis treatment.", "journal": "Rheumatology international", "date": "2017", "authors": "Cuppen BV, Pardali K, Kraan MC, Marijnissen AC, Yrlid L, Olsson M, Bijlsma JW, Lafeber FP, Fritsch-Stork RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "28132103", "url": "https://glygen.org/publication/PubMed/28132103" } ] }, { "title": "A retrovirus carrying an MDR1 cDNA confers multidrug resistance and polarized expression of P-glycoprotein in MDCK cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Pastan I, Gottesman MM, Ueda K, Lovelace E, Rutherford AV, Willingham MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2898143", "url": "https://glygen.org/publication/PubMed/2898143" } ] }, { "title": "The roles of human MTH1, MTH2 and MTH3 proteins in maintaining genome stability under oxidative stress.", "journal": "Mutation research", "date": "2018", "authors": "Hashiguchi K, Hayashi M, Sekiguchi M, Umezu K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "29482072", "url": "https://glygen.org/publication/PubMed/29482072" } ] }, { "title": "Azathioprine Biotransformation in Young Patients with Inflammatory Bowel Disease: Contribution of Glutathione-S Transferase M1 and A1 Variants.", "journal": "Genes", "date": "2019", "authors": "Lucafo M, Stocco G, Martelossi S, Favretto D, Franca R, Malusa N, Lora A, Bramuzzo M, Naviglio S, Cecchin E, Toffoli G, Ventura A, Decorti G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "30987408", "url": "https://glygen.org/publication/PubMed/30987408" } ] }, { "title": "Human multidrug resistance protein 4 (MRP4) is a cellular efflux transporter for paracetamol glutathione and cysteine conjugates.", "journal": "Archives of toxicology", "date": "2020", "authors": "Koenderink JB, van den Heuvel JJMW, Bilos A, Vredenburg G, Vermeulen NPE, Russel FGM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "32472168", "url": "https://glygen.org/publication/PubMed/32472168" } ] }, { "title": "Association of Single-Nucleotide Polymorphisms in ABCC5 Gene with Primary Angle Closure Glaucoma and the Ocular Biometric Parameters in a Northern Chinese Population.", "journal": "Ophthalmic research", "date": "2021", "authors": "Wang S, Zhuang W, Zhang W, Xu M, Li W, Piao S, Xue Z, Cai B, Ha S", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" } ], "reference": [ { "type": "PubMed", "id": "32906129", "url": "https://glygen.org/publication/PubMed/32906129" } ] }, { "title": "Is the emperor wearing shorts? The published structures of ABC transporters.", "journal": "FEBS letters", "date": "2020", "authors": "Jones PM, George AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "32981041", "url": "https://glygen.org/publication/PubMed/32981041" } ] }, { "title": "The spontaneous and enzymatic reaction of N-acetyl-p-benzoquinonimine with glutathione: a stopped-flow kinetic study.", "journal": "Archives of biochemistry and biophysics", "date": "1988", "authors": "Coles B, Wilson I, Wardman P, Hinson JA, Nelson SD, Ketterer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "3395122", "url": "https://glygen.org/publication/PubMed/3395122" } ] }, { "title": "Inhibition of ABCC5-mediated cGMP transport by progesterone, testosterone and their analogues.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2021", "authors": "Odland SU, Ravna AW, Smaglyukova N, Dietrichs ES, Sager G", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" } ], "reference": [ { "type": "PubMed", "id": "34271023", "url": "https://glygen.org/publication/PubMed/34271023" } ] }, { "title": "Pan-cancer analysis and single-cell analysis revealed the role of ABCC5 transporter in hepatocellular carcinoma.", "journal": "Channels (Austin, Tex.)", "date": "2021", "authors": "Chen L, Yang Z, Cao Y, Hu Y, Bao W, Wu D, Hu L, Xie J, Yu H", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" } ], "reference": [ { "type": "PubMed", "id": "34494510", "url": "https://glygen.org/publication/PubMed/34494510" } ] }, { "title": "Human multidrug-resistant cell lines: increased mdr1 expression can precede gene amplification.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Shen DW, Fojo A, Chin JE, Roninson IB, Richert N, Pastan I, Gottesman MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "3457471", "url": "https://glygen.org/publication/PubMed/3457471" } ] }, { "title": "Expression of a full-length cDNA for the human `MDR1` gene confers resistance to colchicine, doxorubicin, and vinblastine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Ueda K, Cardarelli C, Gottesman MM, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "3472246", "url": "https://glygen.org/publication/PubMed/3472246" } ] }, { "title": "ABCC5 facilitates the acquired resistance of sorafenib through the inhibition of SLC7A11-induced ferroptosis in hepatocellular carcinoma.", "journal": "Neoplasia (New York, N.Y.)", "date": "2021", "authors": "Huang W, Chen K, Lu Y, Zhang D, Cheng Y, Li L, Huang W, He G, Liao H, Cai L, Tang Y, Zhao L, Pan M", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" } ], "reference": [ { "type": "PubMed", "id": "34768109", "url": "https://glygen.org/publication/PubMed/34768109" } ] }, { "title": "FOXM1 Promotes Drug Resistance in Cervical Cancer Cells by Regulating ABCC5 Gene Transcription.", "journal": "BioMed research international", "date": "2022", "authors": "Hou Y, Dong Z, Zhong W, Yin L, Li X, Kuerban G, Huang H", "evidence": [ { "database": "RefSeq", "id": "NP_001018881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018881" } ], "reference": [ { "type": "PubMed", "id": "35141332", "url": "https://glygen.org/publication/PubMed/35141332" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O15440", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15440" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "Human hypoxanthine phosphoribosyltransferase. I. Purification, properties, and specificity.", "journal": "The Journal of biological chemistry", "date": "1969", "authors": "Krenitsky TA, Papaioannou R, Elion GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "5767308", "url": "https://glygen.org/publication/PubMed/5767308" } ] }, { "title": "Human erythrocyte thiopurine methyltransferase: radiochemical microassay and biochemical properties.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "1978", "authors": "Weinshilboum RM, Raymond FA, Pazmino PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "657528", "url": "https://glygen.org/publication/PubMed/657528" } ] }, { "title": "Acetaminophen and phenol: substrates for both a thermostable and a thermolabile form of human platelet phenol sulfotransferase.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1982", "authors": "Reiter C, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "6950087", "url": "https://glygen.org/publication/PubMed/6950087" } ] }, { "title": "Quantitation of plasma azathioprine and 6-mercaptopurine levels in renal transplant patients.", "journal": "Transplantation", "date": "1980", "authors": "Lin SN, Jessup K, Floyd M, Wang TP, van Buren CT, Caprioli RM, Kahan BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "6989049", "url": "https://glygen.org/publication/PubMed/6989049" } ] }, { "title": "Treatment of paracetamol (acetaminophen) poisoning with N-acetylcysteine.", "journal": "Lancet (London, England)", "date": "1977", "authors": "Prescott LF, Park J, Ballantyne A, Adriaenssens P, Proudfoot AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "70646", "url": "https://glygen.org/publication/PubMed/70646" } ] }, { "title": "Treatment of severe acetaminophen poisoning with intravenous acetylcysteine.", "journal": "Archives of internal medicine", "date": "1981", "authors": "Prescott LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "7469630", "url": "https://glygen.org/publication/PubMed/7469630" } ] }, { "title": "Intracellular turnover of cystic fibrosis transmembrane conductance regulator. Inefficient processing and rapid degradation of wild-type and mutant proteins.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ward CL, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7523390", "url": "https://glygen.org/publication/PubMed/7523390" } ] }, { "title": "Conformational maturation of CFTR but not its mutant counterpart (delta F508) occurs in the endoplasmic reticulum and requires ATP.", "journal": "The EMBO journal", "date": "1994", "authors": "Lukacs GL, Mohamed A, Kartner N, Chang XB, Riordan JR, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7529176", "url": "https://glygen.org/publication/PubMed/7529176" } ] }, { "title": "Degradation of CFTR by the ubiquitin-proteasome pathway.", "journal": "Cell", "date": "1995", "authors": "Ward CL, Omura S, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7553863", "url": "https://glygen.org/publication/PubMed/7553863" } ] }, { "title": "Multiple proteolytic systems, including the proteasome, contribute to CFTR processing.", "journal": "Cell", "date": "1995", "authors": "Jensen TJ, Loo MA, Pind S, Williams DB, Goldberg AL, Riordan JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7553864", "url": "https://glygen.org/publication/PubMed/7553864" } ] }, { "title": "P-glycoprotein mediates profound resistance to bisantrene.", "journal": "Oncology research", "date": "1994", "authors": "Zhang XP, Ritke MK, Yalowich JC, Slovak ML, Ho JP, Collins KI, Annable T, Arceci RJ, Durr FE, Greenberger LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7865904", "url": "https://glygen.org/publication/PubMed/7865904" } ] }, { "title": "Cloning and expression of cDNA for a human enzyme that hydrolyzes 8-oxo-dGTP, a mutagenic substrate for DNA synthesis.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Sakumi K, Furuichi M, Tsuzuki T, Kakuma T, Kawabata S, Maki H, Sekiguchi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "8226881", "url": "https://glygen.org/publication/PubMed/8226881" } ] }, { "title": "Cloning and expression in vitro of human xanthine dehydrogenase/oxidase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Saksela M, Raivio KO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "8670112", "url": "https://glygen.org/publication/PubMed/8670112" } ] }, { "title": "Molecular identification of a putative human hyaluronan synthase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Watanabe K, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850" } ], "reference": [ { "type": "PubMed", "id": "8798477", "url": "https://glygen.org/publication/PubMed/8798477" } ] }, { "title": "Functional cloning of the cDNA for a human hyaluronan synthase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Shyjan AM, Heldin P, Butcher EC, Yoshino T, Briskin MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850" } ], "reference": [ { "type": "PubMed", "id": "8798544", "url": "https://glygen.org/publication/PubMed/8798544" } ] }, { "title": "Immunohistochemical detection of gamma-glutamyl transpeptidase in normal human tissue.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1996", "authors": "Hanigan MH, Frierson HF Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "8813074", "url": "https://glygen.org/publication/PubMed/8813074" } ] }, { "title": "Influence of polymorphic N-acetyltransferase phenotype on the inhibition and induction of acetaminophen bioactivation with long-term isoniazid.", "journal": "Clinical pharmacology and therapeutics", "date": "1997", "authors": "Chien JY, Peter RM, Nolan CM, Wartell C, Slattery JT, Nelson SD, Carithers RL Jr, Thummel KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9024171", "url": "https://glygen.org/publication/PubMed/9024171" } ] }, { "title": "Hydrolysis and transfer reactions catalyzed by gamma-glutamyl transpeptidase; evidence for separate substrate sites and for high affinity of L-cystine.", "journal": "Biochemical and biophysical research communications", "date": "1976", "authors": "Thompson GA, Meister A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9080", "url": "https://glygen.org/publication/PubMed/9080" } ] }, { "title": "Molecular cloning and characterization of a cDNA encoding the third putative mammalian hyaluronan synthase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Spicer AP, Olson JS, McDonald JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850" } ], "reference": [ { "type": "PubMed", "id": "9083017", "url": "https://glygen.org/publication/PubMed/9083017" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Kinetic mechanism of human hypoxanthine-guanine phosphoribosyltransferase: rapid phosphoribosyl transfer chemistry.", "journal": "Biochemistry", "date": "1997", "authors": "Xu Y, Eads J, Sacchettini JC, Grubmeyer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "9132023", "url": "https://glygen.org/publication/PubMed/9132023" } ] }, { "title": "Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines.", "journal": "Cancer Res.", "date": "1997", "authors": "Kool M, de Haas M, Scheffer GL, Scheper RJ, van Eijk MJ, Juijn JA, Baas F, Borst P", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "9270026", "url": "https://glygen.org/publication/PubMed/9270026" } ] }, { "title": "cDNA cloning of a short type of multidrug resistance protein homologue, SMRP, from a human lung cancer cell line.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Suzuki T, Nishio K, Sasaki H, Kurokawa H, Saito-Ohara F, Ikeuchi T, Tanabe S, Terada M, Saijo N", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "9325169", "url": "https://glygen.org/publication/PubMed/9325169" } ] }, { "title": "Effect of 6-mercaptopurine on inosinic acid dehydrogenase in cultured human fibroblasts.", "journal": "Biochemical pharmacology", "date": "1976", "authors": "Leyva A, Holmes EW Jr, kelley WN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787" } ], "reference": [ { "type": "PubMed", "id": "942489", "url": "https://glygen.org/publication/PubMed/942489" } ] }, { "title": "Stoichiometry of coupling of rhodamine 123 transport to ATP hydrolysis by P-glycoprotein.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Shapiro AB, Ling V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9652413", "url": "https://glygen.org/publication/PubMed/9652413" } ] }, { "title": "Retroviral transfer of the human MDR1 gene confers resistance to bisantrene-specific hematotoxicity.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1996", "authors": "Aksentijevich I, Cardarelli CO, Pastan I, Gottesman MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9816258", "url": "https://glygen.org/publication/PubMed/9816258" } ] }, { "title": "Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins.", "journal": "J. Natl. Cancer Inst.", "date": "1998", "authors": "Belinsky M G, Bain L J, Balsara B B, Testa J R, Kruh G D", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "reference": [ { "type": "PubMed", "id": "9827529", "url": "https://glygen.org/publication/PubMed/9827529" } ] }, { "title": "Reconstituted human cardiac KATP channels: functional identity with the native channels from the sarcolemma of human ventricular cells.", "journal": "Circulation research", "date": "1998", "authors": "Babenko AP, Gonzalez G, Aguilar-Bryan L, Bryan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9831708", "url": "https://glygen.org/publication/PubMed/9831708" } ] } ], "pathway": [ { "id": "hsa:10057", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10057", "resource": "KEGG Pathway" }, { "id": "R-HSA-2142850", "name": "Hyaluronan biosynthesis and export", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142850", "resource": "Reactome", "description": "Hyaluronan biosynthesis and export" }, { "id": "R-HSA-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" }, { "id": "R-HSA-9748787", "name": "Azathioprine ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787", "resource": "Reactome", "description": "Azathioprine ADME" }, { "id": "R-HSA-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9QYM0-1", "protein_name": "ATP-binding cassette sub-family C member 5", "gene_name": "Abcc5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSVRDRSTIPGTHGDREDPSSGEQISLECQDALETAARVEGLSLDISVHSHLQILDEEHTKGKYHHGLSALKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLAQVVHKKGELLMEDVWPLSKYESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAVLTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSTQSSPKLTPKVKKDKRAPKGKKEKSRQLQHTEHQAVLAEQKGHLLLDSDERPSPEEEEGKQIHAGSMRLQRTLYNIDLEIEEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKEASGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSVPWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVFEGNRSSVSDSMRDNPFLQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEITFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEEQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMCAAAENKVAVKG", "length": 1436 }, "evidence": [ { "id": "45923263", "url": "http://www.informatics.jax.org/homology/45923263", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9R1X5-1", "protein_name": "ATP-binding cassette sub-family C member 5", "gene_name": "Abcc5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKDIDMGKEYIIPSPGYRSDRDRSAVPGQHRDPEEPRFRRTRSLECQDALETAARVEGLSLDISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPVDNAGLFSYMTFSWLSPLARVVHKKGELLMEDVWPLSKYESSDVNSRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFVVKHLLEYTQATESNLQYSLLLVLGLLLTEVVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFVSRLTAYFRRKCVAATDDRVQKMNEVLTYIKFIKMYAWVKAFSQCVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSVHMTLGFHLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRATRGKKEKSRQLQHTEHQAVLAEQKGHLLLDSDERPSPEEEEGKQIHTGSLRLQRTLYNIDLEIEEGKLVGICGSVGSGKTSLVSAILGQMTLLEGSIAVSGTFAYVAQQAWILNATLRDNILFGKEFDEERYNSVLNSCCLRPDLAILPNSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVGNHIFNSAIRKRLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKEATGSQKSQDKGPKPGSVKKEKAVKSEEGQLVQVEEKGQGSVPWSVYWVYIQAAGGPLAFLVIMVLFMLNVGSTAFSTWWLSYWIKQGSGNSTVYQGNRSFVSDSMKDNPFMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLLILFSLLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKRQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPSAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGIRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG", "length": 1436 }, "evidence": [ { "id": "45923263", "url": "http://www.informatics.jax.org/homology/45923263", "database": "MGI" }, { "id": "O15440", "url": "https://omabrowser.org/oma/group/O15440/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "ABC-type transporter activity", "id": "GO:0140359", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140359", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "xenobiotic transmembrane transporter activity", "id": "GO:0042910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042910", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "ATPase-coupled transmembrane transporter activity", "id": "GO:0042626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042626", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "ABC-type xenobiotic transporter activity", "id": "GO:0008559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008559", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "heme transmembrane transporter activity", "id": "GO:0015232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015232", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "organic anion transmembrane transporter activity", "id": "GO:0008514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008514", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "purine nucleotide transmembrane transporter activity", "id": "GO:0015216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015216", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "ATPase-coupled inorganic anion transmembrane transporter activity", "id": "GO:0043225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043225", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "efflux transmembrane transporter activity", "id": "GO:0015562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015562", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "glutathione transmembrane transporter activity", "id": "GO:0034634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034634", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "macromolecule transmembrane transporter activity", "id": "GO:0022884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022884", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "carbohydrate derivative transmembrane transporter activity", "id": "GO:1901505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901505", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "purine nucleotide transport", "id": "GO:0015865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015865", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "xenobiotic transmembrane transport", "id": "GO:0006855", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006855", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "folate transmembrane transport", "id": "GO:0098838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098838", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "hyaluronan biosynthetic process", "id": "GO:0030213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030213", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "glutathione transmembrane transport", "id": "GO:0034775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034775", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "xenobiotic transport", "id": "GO:0042908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042908", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "export across plasma membrane", "id": "GO:0140115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140115", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "heme transmembrane transport", "id": "GO:0035351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035351", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "cGMP transport", "id": "GO:0070731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070731", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "transport across blood-brain barrier", "id": "GO:0150104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150104", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" }, { "name": "cAMP transport", "id": "GO:0070730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070730", "evidence": [ { "database": "UniProtKB", "id": "O15440", "url": "https://www.uniprot.org/uniprot/O15440" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1044, "end_pos": 1046, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1329, "end_pos": 1331, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1417, "end_pos": 1419, "annotation": "n_glycosylation_sequon" }, { "start_pos": 494, "end_pos": 496, "annotation": "n_glycosylation_sequon" }, { "start_pos": 636, "end_pos": 638, "annotation": "n_glycosylation_sequon" }, { "start_pos": 684, "end_pos": 686, "annotation": "n_glycosylation_sequon" }, { "start_pos": 890, "end_pos": 892, "annotation": "n_glycosylation_sequon" }, { "start_pos": 897, "end_pos": 899, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "66184", "name": "", "equation": "3',5'-cyclic AMP(in) + ATP + H2O = 3',5'-cyclic AMP(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "F1M3J4-1", "O15439-1", "Q96J66-1", "O15440-1", "E9Q236-1", "Q9R1X5-1" ], "evidence": [ { "id": "66184", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66184" } ] }, { "id": "66188", "name": "", "equation": "3',5'-cyclic GMP(in) + ATP + H2O = 3',5'-cyclic GMP(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "F1M3J4-1", "O15439-1", "Q96J66-1", "O15440-1", "E9Q236-1", "Q9R1X5-1", "P10090-1" ], "evidence": [ { "id": "66188", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66188" } ] }, { "id": "66720", "name": "", "equation": "ATP + H2O + N-[(S)-lactoyl]-L-phenylalanine(in) = ADP + H(+) + N-[(S)-lactoyl]-L-phenylalanine(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66720", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66720" } ] }, { "id": "66728", "name": "", "equation": "ATP + H2O + N-acetyl-L-aspartyl-L-glutamate(in) = ADP + H(+) + N-acetyl-L-aspartyl-L-glutamate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66728", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66728" } ] }, { "id": "66732", "name": "", "equation": "ATP + H2O + N-acetyl-L-aspartyl-L-glutamyl-L-glutamate(in) = ADP + H(+) + N-acetyl-L-aspartyl-L-glutamyl-L-glutamate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66732", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66732" } ] }, { "id": "66736", "name": "", "equation": "ATP + beta-citrylglutamate(in) + H2O = ADP + beta-citrylglutamate(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66736" } ] }, { "id": "66740", "name": "", "equation": "ATP + H2O + N-acetyl-L-glutamate(in) = ADP + H(+) + N-acetyl-L-glutamate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66740", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66740" } ] }, { "id": "66744", "name": "", "equation": "ATP + H2O + N-acetyl-L-aspartate(in) = ADP + H(+) + N-acetyl-L-aspartate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66744", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66744" } ] }, { "id": "66752", "name": "", "equation": "(2S)-2-[5-amino-1-(beta-D-ribosyl)imidazole-4-carboxamido]succinate(in) + ATP + H2O = (2S)-2-[5-amino-1-(beta-D-ribosyl)imidazole-4-carboxamido]succinate(out) + ADP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66752", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66752" } ] }, { "id": "66756", "name": "", "equation": "ATP + domoate(in) + H2O = ADP + domoate(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66756", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66756" } ] }, { "id": "66760", "name": "", "equation": "ATP + H2O + kainate(in) = ADP + H(+) + kainate(out) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66760", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66760" } ] }, { "id": "66764", "name": "", "equation": "ATP + folate(in) + H2O = ADP + folate(out) + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QYM0-1", "O15440-1", "Q9R1X5-1" ], "evidence": [ { "id": "66764", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/66764" } ] }, { "id": "R-HSA-1454916", "name": "The ABCC family mediates organic anion transport", "equation": "", "summary": "The multidrug resistance associated protein (MRPs) subfamily of the ABC transporter family can transport a wide and diverse range of organic anions that can be endogenous compounds and xenobiotics and their metabolites. All human MRPs (except MRP9) can mediate these transport reactions (Deeley et al. 2006). Separately, specific reactions have also been annotated to describe the roles of ABCC4 in platelet dense granule assembly, of ABCC1 in LTC4 export (an aspect of leukotriene synthesis), and of ABCC3 in bile salt efflux.", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-1454930" ], "output_participant_list": [ "R-ALL-1454919" ], "enzyme_list": [ "Q96J66-1", "P13569-1", "O15440-1", "P33527-1", "Q5T3U5-1", "O15439-1", "O95255-1", "Q92887-1", "O15438-1" ], "evidence": [ { "id": "R-HSA-1454916", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454916" } ] }, { "id": "R-HSA-2142859", "name": "Growing HA is extruded from the cell by ABCC5", "equation": "", "summary": "As hyaluronan (HA) is synthesised, it is continually extruded from the cell by the ABC transporter C5 (ABCC5), also called multidrug resistance-associated protein 5 (MRP5) (Schulz et al. 2007).", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-2142896" ], "output_participant_list": [], "enzyme_list": [ "O15440-1" ], "evidence": [ { "id": "R-HSA-2142859", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142859" } ] }, { "id": "R-HSA-9750617", "name": "ABCC5 transports TPMP substrates from cytosol to extracellular region", "equation": "", "summary": "ABCC5 is a multidrug resistance protein (MRP5) which can transport a wide range of organic anions but especially nucleotides and nucleotide analogues. When overexpressed, ABCC5 can lower the intracellular concentration of nucleoside/nucleotide analogues such as 6-mercaptopurine (6MP), after its conversion into its respective nucleotides (Wijnholds et al. 2000, Ritter et al. 2005, Peng et al. 2008). This may lead to an impaired ability of 6MP to inhibit cell proliferation.", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15440-1" ], "evidence": [ { "id": "R-HSA-9750617", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9750617" } ] }, { "id": "R-HSA-9753284", "name": "ABCC1,4,5 transport APAP-Cys,APAP-Mer from cytosol to extracellular region", "equation": "", "summary": "The ATP-binding cassette sub-family C member transporters (ABCCs, aka multidrug resistance-associated proteins, MRPs) mediate the export of organic anions and drugs from cells. Induction of ABCC expression after APAP-induced liver failure may represent a compensatory mechanism of damaged hepatocytes to reduce accumulation of potentially toxic compounds. ABCC1, 4 and 5 are thought to efflux the cysteine- and mercapto-conjugates of paracetamol (APAP-Cys and APAP-Mer respectively) from hepatocytes (Barnes et al. 2007).", "cellular_location": "cytosol, extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15440-1", "P33527-1", "O15439-1" ], "evidence": [ { "id": "R-HSA-9753284", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753284" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1454919", "participant_name": "organic anion [extracellular region]", "crossref": [ { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1454930", "participant_name": "organic anion [cytosol]", "crossref": [ { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" }, { "id": "25696", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2142896", "participant_name": "HA polymer [cytosol]", "crossref": [ { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "E9Q236", "gene_name": "Abcc4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "E9Q236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q236" } ] } ] }, { "uniprot_ac": "F1M3J4", "gene_name": "Abcc4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "F1M3J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3J4" } ] } ] }, { "uniprot_ac": "O15438", "gene_name": "ABCC3", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15438", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15438" } ] } ] }, { "uniprot_ac": "O15439", "gene_name": "ABCC4", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15439" } ] } ] }, { "uniprot_ac": "O15440", "gene_name": "ABCC5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "O15440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15440" } ] } ] }, { "uniprot_ac": "O95255", "gene_name": "ABCC6", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "O95255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95255" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "O95255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95255" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "O95255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95255" } ] } ] }, { "uniprot_ac": "P10090", "gene_name": "w", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P10090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10090" } ] }, { "ec_number": "7.6.2.6", "activity": "ATP + guanine(out) + H2O = ADP + guanine(in) + H(+) + phosphate.", "evidence": [ { "id": "P10090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10090" } ] }, { "ec_number": "7.6.2.6", "activity": "", "evidence": [ { "id": "P10090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10090" } ] } ] }, { "uniprot_ac": "P13569", "gene_name": "CFTR", "activity": [ { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "P13569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13569" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "P13569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13569" } ] } ] }, { "uniprot_ac": "P33527", "gene_name": "ABCC1", "activity": [ { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] }, { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "P33527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33527" } ] } ] }, { "uniprot_ac": "Q5T3U5", "gene_name": "ABCC10", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q5T3U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T3U5" } ] } ] }, { "uniprot_ac": "Q92887", "gene_name": "ABCC2", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q92887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92887" } ] } ] }, { "uniprot_ac": "Q96J66", "gene_name": "ABCC11", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.3", "activity": "an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate.", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] }, { "ec_number": "7.6.2.3", "activity": "", "evidence": [ { "id": "Q96J66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96J66" } ] } ] }, { "uniprot_ac": "Q9QYM0", "gene_name": "Abcc5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9QYM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYM0" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9QYM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYM0" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q9QYM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYM0" } ] } ] }, { "uniprot_ac": "Q9R1X5", "gene_name": "Abcc5", "activity": [ { "ec_number": "7.6.2.2", "activity": "ATP + daunorubicin(in) + H2O = ADP + daunorubicin(out) + H(+) + phosphate.", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ] }, { "ec_number": "7.6.2.2", "activity": "", "evidence": [ { "id": "Q9R1X5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1X5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 494, 636, 684, 890, 897, 1044, 1329, 1417 ], "o_linked_sites": [ 485 ], "snv_sites": [ 427, 483, 485, 500, 535, 636, 674, 684, 702, 794, 897, 1041, 1046, 1086, 1182, 1329, 1331, 1378, 1417, 1419 ], "glycation_sites": [], "phosphorylation_sites": [ 14, 19, 41, 60, 501, 502, 504, 505, 509, 513 ], "sequon_annotation_sites": [ { "start_pos": 1044, "end_pos": 1046 }, { "start_pos": 1329, "end_pos": 1331 }, { "start_pos": 1417, "end_pos": 1419 }, { "start_pos": 494, "end_pos": 496 }, { "start_pos": 636, "end_pos": 638 }, { "start_pos": 684, "end_pos": 686 }, { "start_pos": 890, "end_pos": 892 }, { "start_pos": 897, "end_pos": 899 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 20 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 144 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }