{ "uniprot_canonical_ac": "O15315-3", "uniprot_ac": "O15315", "uniprot_id": "RA51B_HUMAN", "mass": { "chemical_mass": 42196.0, "monoisotopic_mass": 42196.0 }, "refseq": { "ac": "NP_001308746", "name": "DNA repair protein RAD51 homolog 2 isoform 10", "summary": "The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" }, "gene_names": [ { "name": "RAD51B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15315", "id": "O15315" }, { "name": "R51H2; RAD51L1; REC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746", "id": "NP_001308746" }, { "name": "RAD51B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746", "id": "NP_001308746" }, { "name": "RAD51L1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15315", "id": "O15315" }, { "name": "REC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15315", "id": "O15315" } ], "protein_names": [ { "name": "DNA repair protein RAD51 homolog 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15315" }, { "name": "DNA repair protein RAD51 homolog 2 isoform 10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746", "id": "NP_001308746" }, { "name": "R51H2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15315" }, { "name": "RAD51 homolog B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15315" }, { "name": "RAD51-like protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15315" }, { "name": "Rad51B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15315" }, { "name": "RecA-like protein; recombination repair protein; DNA repair protein RAD51 homolog 2; RAD51 homolog B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746", "id": "NP_001308746" } ], "function": [ { "annotation": "A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1). GeneRIF: Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" }, { "database": "PubMed", "id": "19330030", "url": "https://glygen.org/publication/PubMed/19330030" } ] }, { "annotation": "BCR/ABL fragments were used for identifying the sites of BCR/ABL interaction with RAD51B", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" }, { "database": "PubMed", "id": "19657362", "url": "https://glygen.org/publication/PubMed/19657362" } ] }, { "annotation": "Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD51 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315#function" }, { "database": "PubMed", "id": "11842113", "url": "https://glygen.org/publication/PubMed/11842113" }, { "database": "PubMed", "id": "11751636", "url": "https://glygen.org/publication/PubMed/11751636" }, { "database": "PubMed", "id": "23108668", "url": "https://glygen.org/publication/PubMed/23108668" }, { "database": "PubMed", "id": "11751635", "url": "https://glygen.org/publication/PubMed/11751635" }, { "database": "PubMed", "id": "12441335", "url": "https://glygen.org/publication/PubMed/12441335" }, { "database": "PubMed", "id": "23149936", "url": "https://glygen.org/publication/PubMed/23149936" } ] }, { "annotation": "Rad51B and Rad51C function through interactions with the human Rad51 recombinase and play a crucial role in the homologous recombinational repair pathway", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" }, { "database": "PubMed", "id": "12427746", "url": "https://glygen.org/publication/PubMed/12427746" } ] }, { "annotation": "Structural insights into BCDX2 complex function in homologous recombination.", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" }, { "database": "PubMed", "id": "37344589", "url": "https://glygen.org/publication/PubMed/37344589" } ] }, { "annotation": "The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" } ] } ], "disease": [ { "disease_id": "DOID:13223", "recommended_name": { "id": "DOID:13223", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13223", "name": "uterine fibroid", "description": "An uterine benign neoplasm derived from the smooth muscle layer of the uterus." }, "synonyms": [ { "id": "DOID:13223", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13223", "name": "Plexiform leiomyoma", "description": "" }, { "id": "DOID:13223", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13223", "name": "UTERUS FIBROMA", "description": "" }, { "id": "DOID:13223", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13223", "name": "leiomyoma of Corpus Uteri", "description": "" }, { "id": "DOID:13223", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13223", "name": "uterine leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine corpus leiomyoma", "description": "A benign smooth muscle neoplasm arising from the body of the uterus. It is characterized by the presence of spindle cells with cigar-shaped nuclei, interlacing fascicles, and a whorled pattern." }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "body of uterus fibroid", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "body of uterus leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "corpus uteri fibroid", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "corpus uteri leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of body of uterus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of corpus uteri", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of the body of uterus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of the corpus uteri", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of the uterine body", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of the uterine corpus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of uterine body", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "fibroid of uterine corpus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of body of uterus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of corpus uteri", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of the body of uterus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of the corpus uteri", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of the uterine body", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of the uterine corpus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of uterine body", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma of uterine corpus", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "plexiform leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine body fibroid", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine body leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine corpus fibroid", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine corpus leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine corpus leiomyomata", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine fibroid", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "UL", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "leiomyoma, uterine", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterine leiomyoma", "description": "" }, { "id": "MONDO:0007886", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007886", "name": "uterus fibroma", "description": "" } ], "evidence": [ { "id": "150699", "database": "MIM", "url": "https://www.omim.org/entry/150699" } ] } ], "snv": [ { "evidence": [ { "id": "rs918511717", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs918511717" }, { "id": "rs918511717", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs918511717#frequency_tab" }, { "id": "rs918511717", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs918511717" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 24, "end_pos": 24, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (ILT->NLT).", "chr_id": "14", "chr_pos": "67823614", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I24", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1308844497", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1308844497" }, { "id": "rs1308844497", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1308844497" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 259, "end_pos": 259, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQI->NQT).", "chr_id": "14", "chr_pos": "68291903", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I259", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15315", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15315" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 40, "end_pos": 40, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KVT->NVT).", "chr_id": "14", "chr_pos": "67825499", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K40", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs577027561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577027561" }, { "id": "rs577027561", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs577027561" }, { "id": "rs577027561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs577027561" }, { "id": "rs577027561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs577027561#frequency_tab" }, { "id": "rs577027561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs577027561" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 66, "end_pos": 66, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "14", "chr_pos": "67825576", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T66", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767643278", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767643278" }, { "id": "rs767643278", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767643278" }, { "id": "rs767643278", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767643278#frequency_tab" }, { "id": "rs767643278", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767643278" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 77, "end_pos": 77, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "14", "chr_pos": "67835110", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D77", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1452464503", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1452464503" }, { "id": "rs1452464503", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1452464503" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLS->NLS).", "chr_id": "14", "chr_pos": "67835138", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T86", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 326, "end_pos": 326, "sequence_org": "P", "sequence_mut": "L", "comment": "Abolishes interaction with BCR-ABLSH3 domain.", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "PubMed", "id": "19657362", "url": "https://glygen.org/publication/PubMed/19657362" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "66.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "59.27", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "70.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "76.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "78.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "70.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "73.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "73.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "76.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "81.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15315" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "common_name": "Human" } ], "gene": [ { "name": "RAD51B", "url": "https://www.uniprot.org/uniprot/O15315", "locus": { "chromosome": "14", "start_pos": 68730218, "end_pos": 67819779, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000182185", "url": "https://www.ensembl.org/id/ENSG00000182185" } ] } } ], "crossref": [ { "id": "ENSG00000182185", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182185", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O15315", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15315", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd19493", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19493", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "RAD51B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RAD51B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5890", "url": "https://www.ncbi.nlm.nih.gov/gene/5890", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9822", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9822", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15315", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15315*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013632", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013632", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016467", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016467", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020588", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020588", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030548", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030548", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5890", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5890", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "150699", "url": "http://www.omim.org/entry/150699", "database": "MIM", "categories": [ "Other" ] }, { "id": "602948", "url": "http://www.omim.org/entry/602948", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15315", "url": "https://www.nextprot.org/entry/NX_O15315", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O15315", "url": "https://oglcnac.org/atlas/detail/O15315", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O15315", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15315", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IHCQGHN", "url": "https://omabrowser.org/oma/group/IHCQGHN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1216351at2759", "url": "http://www.orthodb.org/?query=1216351at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46456", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46456", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46456:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46456:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "8FAZ", "url": "https://www.rcsb.org/structure/8FAZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GBJ", "url": "https://www.rcsb.org/structure/8GBJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OUY", "url": "https://www.rcsb.org/structure/8OUY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OUZ", "url": "https://www.rcsb.org/structure/8OUZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08423", "url": "http://pfam.xfam.org/family/PF08423", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15315", "url": "https://pharos.nih.gov/targets/O15315", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15315", "url": "http://purl.obolibrary.org/obo/PR_O15315", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693537", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693537", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693554", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693554", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9701192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701192", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9709603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9709603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15315-1", "url": "https://www.uniprot.org/uniprot/O15315-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15315-2", "url": "https://www.uniprot.org/uniprot/O15315-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15315-3", "url": "https://www.uniprot.org/uniprot/O15315-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15315-4", "url": "https://www.uniprot.org/uniprot/O15315-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15315-5", "url": "https://www.uniprot.org/uniprot/O15315-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF", "length": 384, "header": "sp|O15315-3|RA51B_HUMAN Isoform 3 of DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2 CANONICAL=O15315-3" }, "isoforms": [ { "isoform_ac": "O15315-1", "url": "", "sequence": { "sequence": "MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQAYGNS", "length": 350, "header": "sp|O15315-1|RA51B_HUMAN Isoform 1 of DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2 CANONICAL=O15315-3" }, "locus": { "chromosome": "14", "start_pos": 68497137, "end_pos": 67823544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000460526.6", "url": "https://www.ensembl.org/id/ENST00000460526.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000518559.1", "url": "https://www.ensembl.org/id/ENSP00000518559.1" } ] } }, { "isoform_ac": "O15315-2", "url": "", "sequence": { "sequence": "MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQGQEKP", "length": 350, "header": "sp|O15315-2|RA51B_HUMAN Isoform 2 of DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2 CANONICAL=O15315-3" }, "locus": { "chromosome": "14", "start_pos": 68477661, "end_pos": 67823544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000471583.6", "url": "https://www.ensembl.org/id/ENST00000471583.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000418859.1", "url": "https://www.ensembl.org/id/ENSP00000418859.1" } ] } }, { "isoform_ac": "O15315-3", "url": "", "sequence": { "sequence": "MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF", "length": 384, "header": "sp|O15315-3|RA51B_HUMAN Isoform 3 of DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2 CANONICAL=O15315-3" }, "locus": { "chromosome": "14", "start_pos": 68594600, "end_pos": 67823544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000487270.5", "url": "https://www.ensembl.org/id/ENST00000487270.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000419471.1", "url": "https://www.ensembl.org/id/ENSP00000419471.1" } ] } }, { "isoform_ac": "O15315-4", "url": "", "sequence": { "sequence": "MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQEFWHICISGFSIQNRLKENES", "length": 366, "header": "sp|O15315-4|RA51B_HUMAN Isoform 4 of DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2 CANONICAL=O15315-3" }, "locus": { "chromosome": "14", "start_pos": 68650842, "end_pos": 67823544, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000488612.5", "url": "https://www.ensembl.org/id/ENST00000488612.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000420061.1", "url": "https://www.ensembl.org/id/ENSP00000420061.1" } ] } }, { "isoform_ac": "O15315-5", "url": "", "sequence": { "sequence": "MMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQGQEKP", "length": 231, "header": "sp|O15315-5|RA51B_HUMAN Isoform 5 of DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2 CANONICAL=O15315-3" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 66, "start_aa": "Thr", "end_pos": 66, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr66", "evidence": [ { "id": "O15315", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15315" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "O15315", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O15315" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Interaction between the product of the breast cancer susceptibility gene BRCA2 and DSS1, a protein functionally conserved from yeast to mammals.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Marston NJ, Richards WJ, Hughes D, Bertwistle D, Marshall CJ, Ashworth A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "10373512", "url": "https://glygen.org/publication/PubMed/10373512" } ] }, { "title": "Truncated BRCA2 is cytoplasmic: implications for cancer-linked mutations.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Spain BH, Larson CJ, Shihabuddin LS, Gage FH, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "10570174", "url": "https://glygen.org/publication/PubMed/10570174" } ] }, { "title": "Nuclear localization signals of the BRCA2 protein.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Yano K, Morotomi K, Saito H, Kato M, Matsuo F, Miki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "10733923", "url": "https://glygen.org/publication/PubMed/10733923" } ] }, { "title": "Low fidelity DNA synthesis by human DNA polymerase-eta.", "journal": "Nature", "date": "2000", "authors": "Matsuda T, Bebenek K, Masutani C, Hanaoka F, Kunkel TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "10801132", "url": "https://glygen.org/publication/PubMed/10801132" } ] }, { "title": "Mechanisms of accurate translesion synthesis by human DNA polymerase eta.", "journal": "The EMBO journal", "date": "2000", "authors": "Masutani C, Kusumoto R, Iwai S, Hanaoka F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "10856253", "url": "https://glygen.org/publication/PubMed/10856253" } ] }, { "title": "Fidelity and processivity of DNA synthesis by DNA polymerase kappa, the product of the human DINB1 gene.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohashi E, Bebenek K, Matsuda T, Feaver WJ, Gerlach VL, Friedberg EC, Ohmori H, Kunkel TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "11006276", "url": "https://glygen.org/publication/PubMed/11006276" } ] }, { "title": "Multitasking in signal transduction by a promiscuous human Ins(3,4,5,6)P(4) 1-kinase/Ins(1,3,4)P(3) 5/6-kinase.", "journal": "The Biochemical journal", "date": "2000", "authors": "Yang X, Shears SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11042108", "url": "https://glygen.org/publication/PubMed/11042108" } ] }, { "title": "Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Nielsen E, Christoforidis S, Uttenweiler-Joseph S, Miaczynska M, Dewitte F, Wilm M, Hoflack B, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11062261", "url": "https://glygen.org/publication/PubMed/11062261" } ] }, { "title": "Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.", "journal": "Nature", "date": "2001", "authors": "Lachner M, O'Carroll D, Rea S, Mechtler K, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" } ] }, { "title": "Complex formation by the human RAD51C and XRCC3 recombination repair proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Masson JY, Stasiak AZ, Stasiak A, Benson FE, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "11459987", "url": "https://glygen.org/publication/PubMed/11459987" } ] }, { "title": "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11744692", "url": "https://glygen.org/publication/PubMed/11744692" } ] }, { "title": "Identification and purification of two distinct complexes containing the five RAD51 paralogs.", "journal": "Genes & development", "date": "2001", "authors": "Masson JY, Tarsounas MC, Stasiak AZ, Stasiak A, Shah R, McIlwraith MJ, Benson FE, West SC", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "11751635", "url": "https://glygen.org/publication/PubMed/11751635" } ] }, { "title": "Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.", "journal": "Genes & development", "date": "2001", "authors": "Sigurdsson S, Van Komen S, Bussen W, Schild D, Albala JS, Sung P", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11751636", "url": "https://glygen.org/publication/PubMed/11751636" } ] }, { "title": "Cancer susceptibility and the functions of BRCA1 and BRCA2.", "journal": "Cell", "date": "2002", "authors": "Venkitaraman AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "11832208", "url": "https://glygen.org/publication/PubMed/11832208" } ] }, { "title": "Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells.", "journal": "Nucleic Acids Res.", "date": "2002", "authors": "Wiese Claudia, Collins David W, Albala Joanna S, Thompson Larry H, Kronenberg Amy, Schild David", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "11842112", "url": "https://glygen.org/publication/PubMed/11842112" } ] }, { "title": "Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells.", "journal": "Nucleic acids research", "date": "2002-02-15", "authors": "Liu Nan, Schild David, Thelen Michael P, Thompson Larry H", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "11842113", "url": "https://glygen.org/publication/PubMed/11842113" } ] }, { "title": "The human beta-globin locus control region.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Levings PP, Bungert J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11895428", "url": "https://glygen.org/publication/PubMed/11895428" } ] }, { "title": "Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo.", "journal": "Journal of cell science", "date": "2002", "authors": "Rojo M, Legros F, Chateau D, Lombes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11950885", "url": "https://glygen.org/publication/PubMed/11950885" } ] }, { "title": "Intragenic breakpoint within RAD51L1 in a t(6;14)(p21.3;q24) of a pulmonary chondroid hamartoma.", "journal": "Cytogenet. Cell Genet.", "date": "2001", "authors": "Blank C, Schoenmakers E F, Rogalla P, Huys E H, van Rijk A A, Drieschner N, Bullerdiek J", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "11978964", "url": "https://glygen.org/publication/PubMed/11978964" } ] }, { "title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" } ] }, { "title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.", "journal": "Nature cell biology", "date": "2002", "authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12134158", "url": "https://glygen.org/publication/PubMed/12134158" } ] }, { "title": "BRCA2 function in DNA binding and recombination from a BRCA2-DSS1-ssDNA structure.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Yang H, Jeffrey PD, Miller J, Kinnucan E, Sun Y, Thoma NH, Zheng N, Chen PL, Lee WH, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "12228710", "url": "https://glygen.org/publication/PubMed/12228710" } ] }, { "title": "Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Lio YC, Mazin AV, Kowalczykowski SC, Chen DJ", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" }, { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" } ], "reference": [ { "type": "PubMed", "id": "12427746", "url": "https://glygen.org/publication/PubMed/12427746" } ] }, { "title": "Holliday junction binding activity of the human Rad51B protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yokoyama H, Kurumizaka H, Ikawa S, Yokoyama S, Shibata T", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "12441335", "url": "https://glygen.org/publication/PubMed/12441335" } ] }, { "title": "Fusion transcripts involving HMGA2 are not a common molecular mechanism in uterine leiomyomata with rearrangements in 12q15.", "journal": "Cancer Res.", "date": "2003", "authors": "Quade Bradley J, Weremowicz Stanislawa, Neskey David M, Vanni Roberta, Ladd Carll, Dal Cin Paola, Morton Cynthia C", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "12649198", "url": "https://glygen.org/publication/PubMed/12649198" } ] }, { "title": "Identification and characterization of human MUS81-MMS4 structure-specific endonuclease.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ogrunc M, Sancar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "12686547", "url": "https://glygen.org/publication/PubMed/12686547" } ] }, { "title": "Identification and characterization of the human mus81-eme1 endonuclease.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ciccia A, Constantinou A, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "12721304", "url": "https://glygen.org/publication/PubMed/12721304" } ] }, { "title": "Rad51 recombinase and recombination mediators.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Sung P, Krejci L, Van Komen S, Sehorn MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "12912992", "url": "https://glygen.org/publication/PubMed/12912992" } ] }, { "title": "Generating crossovers by resolution of nicked Holliday junctions: a role for Mus81-Eme1 in meiosis.", "journal": "Molecular cell", "date": "2003", "authors": "Osman F, Dixon J, Doe CL, Whitby MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "14527420", "url": "https://glygen.org/publication/PubMed/14527420" } ] }, { "title": "Domain mapping of the Rad51 paralog protein complexes.", "journal": "Nucleic Acids Res.", "date": "2004", "authors": "Miller Kristi A, Sawicka Dorota, Barsky Daniel, Albala Joanna S", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "14704354", "url": "https://glygen.org/publication/PubMed/14704354" } ] }, { "title": "RAD51C is required for Holliday junction processing in mammalian cells.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Liu Y, Masson JY, Shah R, O'Regan P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "14716019", "url": "https://glygen.org/publication/PubMed/14716019" } ] }, { "title": "Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Naslavsky N, Boehm M, Backlund PS Jr, Caplan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15020713", "url": "https://glygen.org/publication/PubMed/15020713" } ] }, { "title": "The novel Cdc42 guanine nucleotide exchange factor, zizimin1, dimerizes via the Cdc42-binding CZH2 domain.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Meller N, Irani-Tehrani M, Ratnikov BI, Paschal BM, Schwartz MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15247287", "url": "https://glygen.org/publication/PubMed/15247287" } ] }, { "title": "DSS1 is required for RAD51 focus formation and genomic stability in mammalian cells.", "journal": "EMBO reports", "date": "2004", "authors": "Gudmundsdottir K, Lord CJ, Witt E, Tutt AN, Ashworth A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "15359272", "url": "https://glygen.org/publication/PubMed/15359272" } ] }, { "title": "The cell-cycle checkpoint kinase Chk1 is required for mammalian homologous recombination repair.", "journal": "Nature cell biology", "date": "2005", "authors": "Sorensen CS, Hansen LT, Dziegielewski J, Syljuasen RG, Lundin C, Bartek J, Helleday T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "15665856", "url": "https://glygen.org/publication/PubMed/15665856" } ] }, { "title": "The BRCA2 homologue Brh2 nucleates RAD51 filament formation at a dsDNA-ssDNA junction.", "journal": "Nature", "date": "2005", "authors": "Yang H, Li Q, Fan J, Holloman WK, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "15703751", "url": "https://glygen.org/publication/PubMed/15703751" } ] }, { "title": "Zizimin2: a novel, DOCK180-related Cdc42 guanine nucleotide exchange factor expressed predominantly in lymphocytes.", "journal": "FEBS letters", "date": "2005", "authors": "Nishikimi A, Meller N, Uekawa N, Isobe K, Schwartz MA, Maruyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15710388", "url": "https://glygen.org/publication/PubMed/15710388" } ] }, { "title": "Trading places: how do DNA polymerases switch during translesion DNA synthesis?", "journal": "Molecular cell", "date": "2005", "authors": "Friedberg EC, Lehmann AR, Fuchs RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "15916957", "url": "https://glygen.org/publication/PubMed/15916957" } ] }, { "title": "Mammalian CARMIL inhibits actin filament capping by capping protein.", "journal": "Developmental cell", "date": "2005", "authors": "Yang C, Pring M, Wear MA, Huang M, Cooper JA, Svitkina TM, Zigmond SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "16054028", "url": "https://glygen.org/publication/PubMed/16054028" } ] }, { "title": "Inducible processing of interferon regulatory factor-2.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Palombella VJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "1630448", "url": "https://glygen.org/publication/PubMed/1630448" } ] }, { "title": "Human DNA polymerase eta promotes DNA synthesis from strand invasion intermediates of homologous recombination.", "journal": "Molecular cell", "date": "2005", "authors": "McIlwraith MJ, Vaisman A, Liu Y, Fanning E, Woodgate R, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "16337601", "url": "https://glygen.org/publication/PubMed/16337601" } ] }, { "title": "Control of BRCA2 cellular and clinical functions by a nuclear partner, PALB2.", "journal": "Molecular cell", "date": "2006", "authors": "Xia B, Sheng Q, Nakanishi K, Ohashi A, Wu J, Christ N, Liu X, Jasin M, Couch FJ, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9709603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9709603" } ], "reference": [ { "type": "PubMed", "id": "16793542", "url": "https://glygen.org/publication/PubMed/16793542" } ] }, { "title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.", "journal": "Experimental cell research", "date": "2006", "authors": "Hiramoto K, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17027967", "url": "https://glygen.org/publication/PubMed/17027967" } ] }, { "title": "Role of RAD51C and XRCC3 in genetic recombination and DNA repair.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Liu Y, Tarsounas M, O'regan P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "17114795", "url": "https://glygen.org/publication/PubMed/17114795" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "PALB2, which encodes a BRCA2-interacting protein, is a breast cancer susceptibility gene.", "journal": "Nature genetics", "date": "2007", "authors": "Rahman N, Seal S, Thompson D, Kelly P, Renwick A, Elliott A, Reid S, Spanova K, Barfoot R, Chagtai T, Jayatilake H, McGuffog L, Hanks S, Evans DG, Eccles D, Easton DF, Stratton MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "17200668", "url": "https://glygen.org/publication/PubMed/17200668" } ] }, { "title": "Biallelic mutations in PALB2 cause Fanconi anemia subtype FA-N and predispose to childhood cancer.", "journal": "Nature genetics", "date": "2007", "authors": "Reid S, Schindler D, Hanenberg H, Barker K, Hanks S, Kalb R, Neveling K, Kelly P, Seal S, Freund M, Wurm M, Batish SD, Lach FP, Yetgin S, Neitzel H, Ariffin H, Tischkowitz M, Mathew CG, Auerbach AD, Rahman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "17200671", "url": "https://glygen.org/publication/PubMed/17200671" } ] }, { "title": "Fanconi anemia is associated with a defect in the BRCA2 partner PALB2.", "journal": "Nature genetics", "date": "2007", "authors": "Xia B, Dorsman JC, Ameziane N, de Vries Y, Rooimans MA, Sheng Q, Pals G, Errami A, Gluckman E, Llera J, Wang W, Livingston DM, Joenje H, de Winter JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "17200672", "url": "https://glygen.org/publication/PubMed/17200672" } ] }, { "title": "Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM.", "journal": "Molecular cell", "date": "2007", "authors": "Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "17289582", "url": "https://glygen.org/publication/PubMed/17289582" } ] }, { "title": "Analysis of PALB2/FANCN-associated breast cancer families.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Tischkowitz M, Xia B, Sabbaghian N, Reis-Filho JS, Hamel N, Li G, van Beers EH, Li L, Khalil T, Quenneville LA, Omeroglu A, Poll A, Lepage P, Wong N, Nederlof PM, Ashworth A, Tonin PN, Narod SA, Livingston DM, Foulkes WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "17420451", "url": "https://glygen.org/publication/PubMed/17420451" } ] }, { "title": "RAD51AP1 is a structure-specific DNA binding protein that stimulates joint molecule formation during RAD51-mediated homologous recombination.", "journal": "Molecular cell", "date": "2007", "authors": "Modesti M, Budzowska M, Baldeyron C, Demmers JA, Ghirlando R, Kanaar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "17996710", "url": "https://glygen.org/publication/PubMed/17996710" } ] }, { "title": "Promotion of homologous recombination and genomic stability by RAD51AP1 via RAD51 recombinase enhancement.", "journal": "Molecular cell", "date": "2007", "authors": "Wiese C, Dray E, Groesser T, San Filippo J, Shi I, Collins DW, Tsai MS, Williams GJ, Rydberg B, Sung P, Schild D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "17996711", "url": "https://glygen.org/publication/PubMed/17996711" } ] }, { "title": "The checkpoint kinases Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage.", "journal": "Oncogene", "date": "2008", "authors": "Bahassi EM, Ovesen JL, Riesenberg AL, Bernstein WZ, Hasty PE, Stambrook PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "18317453", "url": "https://glygen.org/publication/PubMed/18317453" } ] }, { "title": "RTEL1 maintains genomic stability by suppressing homologous recombination.", "journal": "Cell", "date": "2008", "authors": "Barber LJ, Youds JL, Ward JD, McIlwraith MJ, O'Neil NJ, Petalcorin MI, Martin JS, Collis SJ, Cantor SB, Auclair M, Tissenbaum H, West SC, Rose AM, Boulton SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693554", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693554" } ], "reference": [ { "type": "PubMed", "id": "18957201", "url": "https://glygen.org/publication/PubMed/18957201" } ] }, { "title": "RAD54 controls access to the invading 3'-OH end after RAD51-mediated DNA strand invasion in homologous recombination in Saccharomyces cerevisiae.", "journal": "Nucleic acids research", "date": "2009", "authors": "Li X, Heyer WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "19074197", "url": "https://glygen.org/publication/PubMed/19074197" } ] }, { "title": "PALB2 links BRCA1 and BRCA2 in the DNA-damage response.", "journal": "Current biology : CB", "date": "2009", "authors": "Zhang F, Ma J, Wu J, Ye L, Cai H, Xia B, Yu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "19268590", "url": "https://glygen.org/publication/PubMed/19268590" } ] }, { "title": "Lnk inhibits myeloproliferative disorder-associated JAK2 mutant, JAK2V617F.", "journal": "Journal of leukocyte biology", "date": "2009", "authors": "Gery S, Cao Q, Gueller S, Xing H, Tefferi A, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "19293402", "url": "https://glygen.org/publication/PubMed/19293402" } ] }, { "title": "A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1).", "journal": "Nature genetics", "date": "2009", "authors": "Thomas G, Jacobs KB, Kraft P, Yeager M, Wacholder S, Cox DG, Hankinson SE, Hutchinson A, Wang Z, Yu K, Chatterjee N, Garcia-Closas M, Gonzalez-Bosquet J, Prokunina-Olsson L, Orr N, Willett WC, Colditz GA, Ziegler RG, Berg CD, Buys SS, McCarty CA, Feigelson HS, Calle EE, Thun MJ, Diver R, Prentice R, Jackson R, Kooperberg C, Chlebowski R, Lissowska J, Peplonska B, Brinton LA, Sigurdson A, Doody M, Bhatti P, Alexander BH, Buring J, Lee IM, Vatten LJ, Hveem K, Kumle M, Hayes RB, Tucker M, Gerhard DS, Fraumeni JF Jr, Hoover RN, Chanock SJ, Hunter DJ", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" } ], "reference": [ { "type": "PubMed", "id": "19330030", "url": "https://glygen.org/publication/PubMed/19330030" } ] }, { "title": "PALB2 is an integral component of the BRCA complex required for homologous recombination repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Sy SM, Huen MS, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "19369211", "url": "https://glygen.org/publication/PubMed/19369211" } ] }, { "title": "PALB2 functionally connects the breast cancer susceptibility proteins BRCA1 and BRCA2.", "journal": "Molecular cancer research : MCR", "date": "2009", "authors": "Zhang F, Fan Q, Ren K, Andreassen PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "19584259", "url": "https://glygen.org/publication/PubMed/19584259" } ] }, { "title": "Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases.", "journal": "Cell", "date": "2009", "authors": "Fekairi S, Scaglione S, Chahwan C, Taylor ER, Tissier A, Coulon S, Dong MQ, Ruse C, Yates JR 3rd, Russell P, Fuchs RP, McGowan CH, Gaillard PHL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "19596236", "url": "https://glygen.org/publication/PubMed/19596236" } ] }, { "title": "Structural basis for recruitment of BRCA2 by PALB2.", "journal": "EMBO reports", "date": "2009", "authors": "Oliver AW, Swift S, Lord CJ, Ashworth A, Pearl LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "19609323", "url": "https://glygen.org/publication/PubMed/19609323" } ] }, { "title": "BCR/ABL kinase interacts with and phosphorylates the RAD51 paralog, RAD51B.", "journal": "Leukemia", "date": "2009", "authors": "Slupianek A, Jozwiakowski SK, Gurdek E, Skorski T", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" } ], "reference": [ { "type": "PubMed", "id": "19657362", "url": "https://glygen.org/publication/PubMed/19657362" } ] }, { "title": "PCNA is required for initiation of recombination-associated DNA synthesis by DNA polymerase delta.", "journal": "Molecular cell", "date": "2009", "authors": "Li X, Stith CM, Burgers PM, Heyer WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "19941829", "url": "https://glygen.org/publication/PubMed/19941829" } ] }, { "title": "Ring-shaped Rad51 paralog protein complexes bind Holliday junctions and replication forks as visualized by electron microscopy.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Compton SA, Ozgur S, Griffith JD", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "20207730", "url": "https://glygen.org/publication/PubMed/20207730" } ] }, { "title": "Regulation of mouse steroidogenesis by WHISTLE and JMJD1C through histone methylation balance.", "journal": "Nucleic acids research", "date": "2010", "authors": "Kim SM, Kim JY, Choe NW, Cho IH, Kim JR, Kim DW, Seol JE, Lee SE, Kook H, Nam KI, Kook H, Bhak YY, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20530532", "url": "https://glygen.org/publication/PubMed/20530532" } ] }, { "title": "Regulation of immune cell homeostasis by type I interferons.", "journal": "Cytokine & growth factor reviews", "date": "2010", "authors": "Mattei F, Schiavoni G, Tough DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20627800", "url": "https://glygen.org/publication/PubMed/20627800" } ] }, { "title": "Purified human BRCA2 stimulates RAD51-mediated recombination.", "journal": "Nature", "date": "2010", "authors": "Jensen RB, Carreira A, Kowalczykowski SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "20729832", "url": "https://glygen.org/publication/PubMed/20729832" } ] }, { "title": "The breast cancer tumor suppressor BRCA2 promotes the specific targeting of RAD51 to single-stranded DNA.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Thorslund T, McIlwraith MJ, Compton SA, Lekomtsev S, Petronczki M, Griffith JD, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "20729858", "url": "https://glygen.org/publication/PubMed/20729858" } ] }, { "title": "Human BRCA2 protein promotes RAD51 filament formation on RPA-covered single-stranded DNA.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Liu J, Doty T, Gibson B, Heyer WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "20729859", "url": "https://glygen.org/publication/PubMed/20729859" } ] }, { "title": "Cooperation of breast cancer proteins PALB2 and piccolo BRCA2 in stimulating homologous recombination.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Buisson R, Dion-Cote AM, Coulombe Y, Launay H, Cai H, Stasiak AZ, Stasiak A, Xia B, Masson JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "20871615", "url": "https://glygen.org/publication/PubMed/20871615" } ] }, { "title": "Enhancement of RAD51 recombinase activity by the tumor suppressor PALB2.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Dray E, Etchin J, Wiese C, Saro D, Williams GJ, Hammel M, Yu X, Galkin VE, Liu D, Tsai MS, Sy SM, Schild D, Egelman E, Chen J, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "20871616", "url": "https://glygen.org/publication/PubMed/20871616" } ] }, { "title": "The DNA damage response: making it safe to play with knives.", "journal": "Molecular cell", "date": "2010", "authors": "Ciccia A, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "20965415", "url": "https://glygen.org/publication/PubMed/20965415" } ] }, { "title": "LOVD v.2.0: the next generation in gene variant databases.", "journal": "Human mutation", "date": "2011", "authors": "Fokkema IF, Taschner PE, Schaafsma GC, Celli J, Laros JF, den Dunnen JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "21520333", "url": "https://glygen.org/publication/PubMed/21520333" } ] }, { "title": "Mitochondrial GTP-AMP phosphotransferase. 2. Kinetic and equilibrium dialysis studies.", "journal": "European journal of biochemistry", "date": "1979", "authors": "Tomasselli AG, Noda LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "218813", "url": "https://glygen.org/publication/PubMed/218813" } ] }, { "title": "hSWS1.SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Liu T, Wan L, Wu Y, Chen J, Huang J", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "21965664", "url": "https://glygen.org/publication/PubMed/21965664" } ] }, { "title": "Plasticity of BRCA2 function in homologous recombination: genetic interactions of the PALB2 and DNA binding domains.", "journal": "PLoS genetics", "date": "2011", "authors": "Siaud N, Barbera MA, Egashira A, Lam I, Christ N, Schlacher K, Xia B, Jasin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "22194698", "url": "https://glygen.org/publication/PubMed/22194698" } ] }, { "title": "RTEL1 contributes to DNA replication and repair and telomere maintenance.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Uringa EJ, Lisaingo K, Pickett HA, Brind'Amour J, Rohde JH, Zelensky A, Essers J, Lansdorp PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693554", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693554" } ], "reference": [ { "type": "PubMed", "id": "22593209", "url": "https://glygen.org/publication/PubMed/22593209" } ] }, { "title": "Mus81-Mms4 functions as a single heterodimer to cleave nicked intermediates in recombinational DNA repair.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Schwartz EK, Wright WD, Ehmsen KT, Evans JE, Stahlberg H, Heyer WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "22645308", "url": "https://glygen.org/publication/PubMed/22645308" } ] }, { "title": "The RAD51 paralogs ensure cellular protection against mitotic defects and aneuploidy.", "journal": "Journal of cell science", "date": "2013", "authors": "Rodrigue A, Coulombe Y, Jacquet K, Gagne JP, Roques C, Gobeil S, Poirier G, Masson JY", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "23108668", "url": "https://glygen.org/publication/PubMed/23108668" } ] }, { "title": "Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Chun J, Buechelmaier ES, Powell SN", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "23149936", "url": "https://glygen.org/publication/PubMed/23149936" } ] }, { "title": "Scaffolding protein SPIDR/KIAA0146 connects the Bloom syndrome helicase with homologous recombination repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Wan L, Han J, Liu T, Dong S, Xie F, Chen H, Huang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "23509288", "url": "https://glygen.org/publication/PubMed/23509288" } ] }, { "title": "Preferential D-loop extension by a translesion DNA polymerase underlies error-prone recombination.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Pomerantz RT, Kurth I, Goodman MF, O'Donnell ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "23686288", "url": "https://glygen.org/publication/PubMed/23686288" } ] }, { "title": "Role of PCNA and TLS polymerases in D-loop extension during homologous recombination in humans.", "journal": "DNA repair", "date": "2013", "authors": "Sebesta M, Burkovics P, Juhasz S, Zhang S, Szabo JE, Lee MY, Haracska L, Krejci L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "23731732", "url": "https://glygen.org/publication/PubMed/23731732" } ] }, { "title": "The HsRAD51B-HsRAD51C stabilizes the HsRAD51 nucleoprotein filament.", "journal": "DNA repair", "date": "2013", "authors": "Amunugama R, Groden J, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "23810717", "url": "https://glygen.org/publication/PubMed/23810717" } ] }, { "title": "Helq acts in parallel to Fancc to suppress replication-associated genome instability.", "journal": "Nucleic Acids Res.", "date": "2013", "authors": "Luebben SW, Kawabata T, Akre MK, Lee WL, Johnson CS, O'Sullivan MG, Shima N", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "24005041", "url": "https://glygen.org/publication/PubMed/24005041" } ] }, { "title": "A cancer-associated BRCA2 mutation reveals masked nuclear export signals controlling localization.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Jeyasekharan AD, Liu Y, Hattori H, Pisupati V, Jonsdottir AB, Rajendra E, Lee M, Sundaramoorthy E, Schlachter S, Kaminski CF, Ofir-Rosenfeld Y, Sato K, Savill J, Ayoub N, Venkitaraman AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "24013206", "url": "https://glygen.org/publication/PubMed/24013206" } ] }, { "title": "Coordinated actions of SLX1-SLX4 and MUS81-EME1 for Holliday junction resolution in human cells.", "journal": "Molecular cell", "date": "2013", "authors": "Wyatt HD, Sarbajna S, Matos J, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "24076221", "url": "https://glygen.org/publication/PubMed/24076221" } ] }, { "title": "Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.", "journal": "Oncogene", "date": "2014", "authors": "Park JY, Singh TR, Nassar N, Zhang F, Freund M, Hanenberg H, Meetei AR, Andreassen PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "24141787", "url": "https://glygen.org/publication/PubMed/24141787" } ] }, { "title": "Substrate specificity of the MUS81-EME2 structure selective endonuclease.", "journal": "Nucleic acids research", "date": "2014", "authors": "Pepe A, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "24371268", "url": "https://glygen.org/publication/PubMed/24371268" } ] }, { "title": "Breast cancer proteins PALB2 and BRCA2 stimulate polymerase eta in recombination-associated DNA synthesis at blocked replication forks.", "journal": "Cell reports", "date": "2014", "authors": "Buisson R, Niraj J, Pauty J, Maity R, Zhao W, Coulombe Y, Sung P, Masson JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942" } ], "reference": [ { "type": "PubMed", "id": "24485656", "url": "https://glygen.org/publication/PubMed/24485656" } ] }, { "title": "Structural and mechanistic insight into Holliday-junction dissolution by topoisomerase IIIalpha and RMI1.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Bocquet N, Bizard AH, Abdulrahman W, Larsen NB, Faty M, Cavadini S, Bunker RD, Kowalczykowski SC, Cejka P, Hickson ID, Thoma NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "24509834", "url": "https://glygen.org/publication/PubMed/24509834" } ] }, { "title": "Roles of SLX1-SLX4, MUS81-EME1, and GEN1 in avoiding genome instability and mitotic catastrophe.", "journal": "Genes & development", "date": "2014", "authors": "Sarbajna S, Davies D, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693568", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568" } ], "reference": [ { "type": "PubMed", "id": "24831703", "url": "https://glygen.org/publication/PubMed/24831703" } ] }, { "title": "Promotion of BRCA2-Dependent Homologous Recombination by DSS1 via RPA Targeting and DNA Mimicry.", "journal": "Molecular cell", "date": "2015", "authors": "Zhao W, Vaithiyalingam S, San Filippo J, Maranon DG, Jimenez-Sainz J, Fontenay GV, Kwon Y, Leung SG, Lu L, Jensen RB, Chazin WJ, Wiese C, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "26145171", "url": "https://glygen.org/publication/PubMed/26145171" } ] }, { "title": "Properties and catalytic activities of MICAL1, the flavoenzyme involved in cytoskeleton dynamics, and modulation by its CH, LIM and C-terminal domains.", "journal": "Archives of biochemistry and biophysics", "date": "2016", "authors": "Vitali T, Maffioli E, Tedeschi G, Vanoni MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "26845023", "url": "https://glygen.org/publication/PubMed/26845023" } ] }, { "title": "COSMIC: somatic cancer genetics at high-resolution.", "journal": "Nucleic acids research", "date": "2017", "authors": "Forbes SA, Beare D, Boutselakis H, Bamford S, Bindal N, Tate J, Cole CG, Ward S, Dawson E, Ponting L, Stefancsik R, Harsha B, Kok CY, Jia M, Jubb H, Sondka Z, Thompson S, De T, Campbell PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "27899578", "url": "https://glygen.org/publication/PubMed/27899578" } ] }, { "title": "Coupling of Homologous Recombination and the Checkpoint by ATR.", "journal": "Molecular cell", "date": "2017", "authors": "Buisson R, Niraj J, Rodrigue A, Ho CK, Kreuzer J, Foo TK, Hardy EJ, Dellaire G, Haas W, Xia B, Masson JY, Zou L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693579", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579" } ], "reference": [ { "type": "PubMed", "id": "28089683", "url": "https://glygen.org/publication/PubMed/28089683" } ] }, { "title": "Cancer-causing mutations in the tumor suppressor PALB2 reveal a novel cancer mechanism using a hidden nuclear export signal in the WD40 repeat motif.", "journal": "Nucleic acids research", "date": "2017", "authors": "Pauty J, Couturier AM, Rodrigue A, Caron MC, Coulombe Y, Dellaire G, Masson JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "28158555", "url": "https://glygen.org/publication/PubMed/28158555" } ] }, { "title": "A PALB2-interacting domain in RNF168 couples homologous recombination to DNA break-induced chromatin ubiquitylation.", "journal": "eLife", "date": "2017", "authors": "Luijsterburg MS, Typas D, Caron MC, Wiegant WW, van den Heuvel D, Boonen RA, Couturier AM, Mullenders LH, Masson JY, van Attikum H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646" } ], "reference": [ { "type": "PubMed", "id": "28240985", "url": "https://glygen.org/publication/PubMed/28240985" } ] }, { "title": "Compromised BRCA1-PALB2 interaction is associated with breast cancer risk.", "journal": "Oncogene", "date": "2017", "authors": "Foo TK, Tischkowitz M, Simhadri S, Boshari T, Zayed N, Burke KA, Berman SH, Blecua P, Riaz N, Huo Y, Ding YC, Neuhausen SL, Weigelt B, Reis-Filho JS, Foulkes WD, Xia B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "28319063", "url": "https://glygen.org/publication/PubMed/28319063" } ] }, { "title": "ClinVar: improving access to variant interpretations and supporting evidence.", "journal": "Nucleic acids research", "date": "2018", "authors": "Landrum MJ, Lee JM, Benson M, Brown GR, Chao C, Chitipiralla S, Gu B, Hart J, Hoffman D, Jang W, Karapetyan K, Katz K, Liu C, Maddipatla Z, Malheiro A, McDaniel K, Ovetsky M, Riley G, Zhou G, Holmes JB, Kattman BL, Maglott DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9701192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701192" } ], "reference": [ { "type": "PubMed", "id": "29165669", "url": "https://glygen.org/publication/PubMed/29165669" } ] }, { "title": "Antiparallel Coiled-Coil Interactions Mediate the Homodimerization of the DNA Damage-Repair Protein PALB2.", "journal": "Biochemistry", "date": "2018", "authors": "Song F, Li M, Liu G, Swapna GVT, Daigham NS, Xia B, Montelione GT, Bunting SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "30289697", "url": "https://glygen.org/publication/PubMed/30289697" } ] }, { "title": "ClinGen Allele Registry links information about genetic variants.", "journal": "Human mutation", "date": "2018", "authors": "Pawliczek P, Patel RY, Ashmore LR, Jackson AR, Bizon C, Nelson T, Powell B, Freimuth RR, Strande N, Shah N, Paithankar S, Wright MW, Dwight S, Zhen J, Landrum M, McGarvey P, Babb L, Plon SE, Milosavljevic A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "30311374", "url": "https://glygen.org/publication/PubMed/30311374" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O15315", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15315" }, { "database": "O-GlcNAc Atlas", "id": "O15315", "url": "https://oglcnac.org/atlas/detail/O15315" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "A global functional analysis of missense mutations reveals two major hotspots in the PALB2 tumor suppressor.", "journal": "Nucleic acids research", "date": "2019", "authors": "Rodrigue A, Margaillan G, Torres Gomes T, Coulombe Y, Montalban G, da Costa E Silva Carvalho S, Milano L, Ducy M, De-Gregoriis G, Dellaire G, Araujo da Silva W Jr, Monteiro AN, Carvalho MA, Simard J, Masson JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "31586400", "url": "https://glygen.org/publication/PubMed/31586400" } ] }, { "title": "Functional characterization of 84 PALB2 variants of uncertain significance.", "journal": "Genetics in medicine : official journal of the American College of Medical Genetics", "date": "2020", "authors": "Wiltshire T, Ducy M, Foo TK, Hu C, Lee KY, Belur Nagaraj A, Rodrigue A, Gomes TT, Simard J, Monteiro ANA, Xia B, Carvalho MA, Masson JY, Couch FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "31636395", "url": "https://glygen.org/publication/PubMed/31636395" } ] }, { "title": "Functional analysis of genetic variants in the high-risk breast cancer susceptibility gene PALB2.", "journal": "Nature communications", "date": "2019", "authors": "Boonen RACM, Rodrigue A, Stoepker C, Wiegant WW, Vroling B, Sharma M, Rother MB, Celosse N, Vreeswijk MPG, Couch F, Simard J, Devilee P, Masson JY, van Attikum H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "31757951", "url": "https://glygen.org/publication/PubMed/31757951" } ] }, { "title": "Ablation of the Brca1-Palb2 Interaction Phenocopies Fanconi Anemia in Mice.", "journal": "Cancer research", "date": "2020", "authors": "Park D, Bergin SM, Jones D, Ru P, Koivisto CS, Jeon YJ, Sizemore GM, Kladney RD, Hadjis A, Shakya R, Ludwig T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9701192", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701192" } ], "reference": [ { "type": "PubMed", "id": "32732220", "url": "https://glygen.org/publication/PubMed/32732220" } ] }, { "title": "Functional Characterization of PALB2 Variants of Uncertain Significance: Toward Cancer Risk and Therapy Response Prediction.", "journal": "Frontiers in molecular biosciences", "date": "2020", "authors": "Boonen RACM, Vreeswijk MPG, van Attikum H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9704331", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331" } ], "reference": [ { "type": "PubMed", "id": "33195396", "url": "https://glygen.org/publication/PubMed/33195396" } ] }, { "title": "Cancer-causing BRCA2 missense mutations disrupt an intracellular protein assembly mechanism to disable genome maintenance.", "journal": "Nucleic acids research", "date": "2021", "authors": "Lee M, Shorthouse D, Mahen R, Hall BA, Venkitaraman AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "33978741", "url": "https://glygen.org/publication/PubMed/33978741" } ] }, { "title": "Regulated expression of a gene encoding a nuclear factor, IRF-1, that specifically binds to IFN-beta gene regulatory elements.", "journal": "Cell", "date": "1988", "authors": "Miyamoto M, Fujita T, Kimura Y, Maruyama M, Harada H, Sudo Y, Miyata T, Taniguchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "3409321", "url": "https://glygen.org/publication/PubMed/3409321" } ] }, { "title": "Guardians of the Genome: BRCA2 and Its Partners.", "journal": "Genes", "date": "2021", "authors": "Le HP, Heyer WD, Liu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5693616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616" } ], "reference": [ { "type": "PubMed", "id": "34440403", "url": "https://glygen.org/publication/PubMed/34440403" } ] }, { "title": "Structural insights into BCDX2 complex function in homologous recombination.", "journal": "Nature", "date": "2023-07", "authors": "Rawal Yashpal, Jia Lijia, Meir Aviv, Zhou Shuo, Kaur Hardeep, Ruben Eliza A, Kwon Youngho, Bernstein Kara A, Jasin Maria, Taylor Alexander B, Burma Sandeep, Hromas Robert, Mazin Alexander V, Zhao Weixing, Zhou Daohong, Wasmuth Elizabeth V, Greene Eric C, Sung Patrick, Olsen Shaun K", "evidence": [ { "database": "RefSeq", "id": "NP_001308746", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308746" } ], "reference": [ { "type": "PubMed", "id": "37344589", "url": "https://glygen.org/publication/PubMed/37344589" } ] }, { "title": "Isolation of inositol 1,3,4-trisphosphate 5/6-kinase, cDNA cloning and expression of the recombinant enzyme.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wilson MP, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8662638", "url": "https://glygen.org/publication/PubMed/8662638" } ] }, { "title": "NF-E2 disrupts chromatin structure at human beta-globin locus control region hypersensitive site 2 in vitro.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Armstrong JA, Emerson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8816476", "url": "https://glygen.org/publication/PubMed/8816476" } ] }, { "title": "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9065479", "url": "https://glygen.org/publication/PubMed/9065479" } ] }, { "title": "Isolation of human and mouse genes based on homology to REC2, a recombinational repair gene from the fungus Ustilago maydis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Rice M C, Smith S T, Bullrich F, Havre P, Kmiec E B", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "9207106", "url": "https://glygen.org/publication/PubMed/9207106" } ] }, { "title": "FOG, a multitype zinc finger protein, acts as a cofactor for transcription factor GATA-1 in erythroid and megakaryocytic differentiation.", "journal": "Cell", "date": "1997", "authors": "Tsang AP, Visvader JE, Turner CA, Fujiwara Y, Yu C, Weiss MJ, Crossley M, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9230307", "url": "https://glygen.org/publication/PubMed/9230307" } ] }, { "title": "D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9326583", "url": "https://glygen.org/publication/PubMed/9326583" } ] }, { "title": "Vertebrates have conserved capping protein alpha isoforms with specific expression patterns.", "journal": "Cell motility and the cytoskeleton", "date": "1997", "authors": "Hart MC, Korshunova YO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9331217", "url": "https://glygen.org/publication/PubMed/9331217" } ] }, { "title": "Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.", "journal": "Nature", "date": "1998", "authors": "Escalante CR, Yie J, Thanos D, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9422515", "url": "https://glygen.org/publication/PubMed/9422515" } ] }, { "title": "Identification of a novel human RAD51 homolog, RAD51B.", "journal": "Genomics", "date": "1997", "authors": "Albala JS, Thelen MP, Prange C, Fan W, Christensen M, Thompson LH, Lennon GG", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "9441753", "url": "https://glygen.org/publication/PubMed/9441753" } ] }, { "title": "Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family.", "journal": "Nucleic Acids Res.", "date": "1998", "authors": "Cartwright R, Dunn A M, Simpson P J, Tambini C E, Thacker J", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "9512535", "url": "https://glygen.org/publication/PubMed/9512535" } ] }, { "title": "Allelic knockout of novel splice variants of human recombination repair gene RAD51B in t(12;14) uterine leiomyomas.", "journal": "Cancer Res.", "date": "1999", "authors": "Schoenmakers E F, Huysmans C, Van de Ven W J", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "reference": [ { "type": "PubMed", "id": "9892177", "url": "https://glygen.org/publication/PubMed/9892177" } ] }, { "title": "FOG-2: A novel GATA-family cofactor related to multitype zinc-finger proteins Friend of GATA-1 and U-shaped.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Tevosian SG, Deconinck AE, Cantor AB, Rieff HI, Fujiwara Y, Corfas G, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9927674", "url": "https://glygen.org/publication/PubMed/9927674" } ] } ], "pathway": [ { "id": "hsa:5890", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5890", "resource": "KEGG Pathway" }, { "id": "R-HSA-5685942", "name": "HDR through Homologous Recombination (HRR)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685942", "resource": "Reactome", "description": "HDR through Homologous Recombination (HRR)" }, { "id": "R-HSA-5693537", "name": "Resolution of D-Loop Structures", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693537", "resource": "Reactome", "description": "Resolution of D-Loop Structures" }, { "id": "R-HSA-5693554", "name": "Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693554", "resource": "Reactome", "description": "Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)" }, { "id": "R-HSA-5693568", "name": "Resolution of D-loop Structures through Holliday Junction Intermediates", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693568", "resource": "Reactome", "description": "Resolution of D-loop Structures through Holliday Junction Intermediates" }, { "id": "R-HSA-5693579", "name": "Homologous DNA Pairing and Strand Exchange", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693579", "resource": "Reactome", "description": "Homologous DNA Pairing and Strand Exchange" }, { "id": "R-HSA-5693616", "name": "Presynaptic phase of homologous DNA pairing and strand exchange", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693616", "resource": "Reactome", "description": "Presynaptic phase of homologous DNA pairing and strand exchange" }, { "id": "R-HSA-9701192", "name": "Defective homologous recombination repair (HRR) due to BRCA1 loss of function", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9701192", "resource": "Reactome", "description": "Defective homologous recombination repair (HRR) due to BRCA1 loss of function" }, { "id": "R-HSA-9704331", "name": "Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA1 binding function", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704331", "resource": "Reactome", "description": "Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA1 binding function" }, { "id": "R-HSA-9704646", "name": "Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA2/RAD51/RAD51C binding function", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9704646", "resource": "Reactome", "description": "Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA2/RAD51/RAD51C binding function" }, { "id": "R-HSA-9709603", "name": "Impaired BRCA2 binding to PALB2", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9709603", "resource": "Reactome", "description": "Impaired BRCA2 binding to PALB2" }, { "id": "R-HSA-983231", "name": "Factors involved in megakaryocyte development and platelet production", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "resource": "Reactome", "description": "Factors involved in megakaryocyte development and platelet production" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZYE0-1", "protein_name": "RAD51 paralog B", "gene_name": "Rad51b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSKKLRRAGLSQELCDRLCRYQIVNCQDFLNLSPLELMKVTGLSYRGVHELLHTVSKACAPQMQTAYELKTRRSAHLSPAFLSTTLGALDEALHGGVPCGSLTEVTGPPGCGKTQFCIMMSVLATLPTRLGGLEGAVLYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCQELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPQLQGNIKERNKFLGKGASLLKYLSGEFSVPVILTNQITTHLSGALPSQADLVSPADDLSPSEGASGSSCLVAALGNTWSHCVNTRLILQYLDSERRQILIAKSPVAPLTSFVYTIKGEGLVLQGQERP", "length": 350 }, "evidence": [ { "id": "O15315", "url": "https://omabrowser.org/oma/group/O15315/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O35719-1", "protein_name": "DNA repair protein RAD51 homolog 2", "gene_name": "Rad51b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSKKLRRVGLSPELCDRLSRYQIVNCQHFLSLSPLELMKVTGLSYRGVHELLHTVSKACAPQMQTAYELKTRRSAHLSPAFLSTTLCALDEALHGGVPCGSLTEITGPPGCGKTQFCIMMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP", "length": 350 }, "evidence": [ { "id": "45925072", "url": "http://www.informatics.jax.org/homology/45925072", "database": "MGI" }, { "id": "O15315", "url": "https://omabrowser.org/oma/group/O15315/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "ATP hydrolysis activity", "id": "GO:0016887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016887", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "ATP-dependent activity, acting on DNA", "id": "GO:0008094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008094", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "ATP-dependent DNA damage sensor activity", "id": "GO:0140664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140664", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "replication fork", "id": "GO:0005657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005657", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "Rad51B-Rad51C-Rad51D-XRCC2 complex", "id": "GO:0033063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033063", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "DNA recombination", "id": "GO:0006310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006310", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "positive regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010971", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "double-strand break repair via homologous recombination", "id": "GO:0000724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000724", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "blastocyst growth", "id": "GO:0001832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001832", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "reciprocal meiotic recombination", "id": "GO:0007131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007131", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" }, { "name": "somite development", "id": "GO:0061053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061053", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated on tyrosine residues by BCR-ABL.", "evidence": [ { "database": "UniProtKB", "id": "O15315", "url": "https://www.uniprot.org/uniprot/O15315" }, { "database": "PubMed", "id": "19657362", "url": "https://glygen.org/publication/PubMed/19657362" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 66 ], "snv_sites": [ 24, 40, 66, 77, 86, 259 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 125 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }