{ "uniprot_canonical_ac": "O15254-1", "uniprot_ac": "O15254", "uniprot_id": "ACOX3_HUMAN", "mass": { "chemical_mass": 77629.0, "monoisotopic_mass": 77629.0 }, "refseq": { "ac": "NP_001095137", "name": "peroxisomal acyl-coenzyme A oxidase 3 isoform b", "summary": "Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" }, "gene_names": [ { "name": "ACOX3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15254", "id": "O15254" }, { "name": "ACOX3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137", "id": "NP_001095137" }, { "name": "BRCOX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15254", "id": "O15254" }, { "name": "PRCOX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15254", "id": "O15254" } ], "protein_names": [ { "name": "Peroxisomal acyl-coenzyme A oxidase 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15254" }, { "name": "1.3.3.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15254" }, { "name": "BRCACox", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15254" }, { "name": "Branched-chain acyl-CoA oxidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15254" }, { "name": "Pristanoyl-CoA oxidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15254" }, { "name": "acyl-Coenzyme A oxidase 3, pristanoyl; peroxisomal acyl-coenzyme A oxidase 3; BRCACox; pristanoyl-CoA oxidase; branched-chain acyl-CoA oxidase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137", "id": "NP_001095137" }, { "name": "peroxisomal acyl-coenzyme A oxidase 3 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137", "id": "NP_001095137" } ], "function": [ { "annotation": "ACOX3 Dysfunction as a Potential Cause of Recurrent Spontaneous Vasospasm of Internal Carotid Artery.", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" }, { "database": "PubMed", "id": "31975215", "url": "https://glygen.org/publication/PubMed/31975215" } ] }, { "annotation": "ACOX3, which is expressed at extremely low level in other human organs studied including the liver, might contribute significantly to peroxisomal branched chain fatty acid beta-oxidation in human prostate tissue and some prostate cancer cell lines", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" }, { "database": "PubMed", "id": "15599942", "url": "https://glygen.org/publication/PubMed/15599942" } ] }, { "annotation": "Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" }, { "database": "PubMed", "id": "20677014", "url": "https://glygen.org/publication/PubMed/20677014" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator) Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" }, { "database": "PubMed", "id": "20877624", "url": "https://glygen.org/publication/PubMed/20877624" } ] }, { "annotation": "Oxidizes the CoA-esters of 2-methyl-branched fatty acids.", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254#function" }, { "database": "UniProtKB", "id": "Q63448", "url": "https://www.uniprot.org/uniprot/Q63448#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "70.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "69.1", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "81.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "80.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "81.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "84.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15254", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15254" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "common_name": "Human" } ], "gene": [ { "name": "ACOX3", "url": "https://www.uniprot.org/uniprot/O15254", "locus": { "chromosome": "4", "start_pos": 8366282, "end_pos": 8440723, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000087008", "url": "https://www.ensembl.org/id/ENSG00000087008" } ] } } ], "crossref": [ { "id": "ENSG00000087008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000087008", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01150", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01150", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4105817", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4105817", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ACOX3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ACOX3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8310", "url": "https://www.ncbi.nlm.nih.gov/gene/8310", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "121", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=121", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15254", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15254*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002655", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002655", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006091", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006091", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009100", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009100", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012258", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012258", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034171", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034171", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036250", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036250", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046373", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046373", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8310", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8310", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603402", "url": "http://www.omim.org/entry/603402", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15254", "url": "https://www.nextprot.org/entry/NX_O15254", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O15254", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15254", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "VMPNIQI", "url": "https://omabrowser.org/oma/group/VMPNIQI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5777at2759", "url": "http://www.orthodb.org/?query=5777at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10909", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10909", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10909:SF390", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10909:SF390", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01756", "url": "http://pfam.xfam.org/family/PF01756", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02770", "url": "http://pfam.xfam.org/family/PF02770", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15254", "url": "https://pharos.nih.gov/targets/O15254", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15254", "url": "http://purl.obolibrary.org/obo/PR_O15254", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "38959", "url": "https://www.rhea-db.org/rhea/38959", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40167", "url": "https://www.rhea-db.org/rhea/40167", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40275", "url": "https://www.rhea-db.org/rhea/40275", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40319", "url": "https://www.rhea-db.org/rhea/40319", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40459", "url": "https://www.rhea-db.org/rhea/40459", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D6RJ89", "url": "https://www.uniprot.org/uniprot/D6RJ89", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RJ89-1", "url": "https://www.uniprot.org/uniprot/D6RJ89-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15254-1", "url": "https://www.uniprot.org/uniprot/O15254-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15254-2", "url": "https://www.uniprot.org/uniprot/O15254-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLSRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL", "length": 700, "header": "sp|O15254-1|ACOX3_HUMAN Isoform 1 of Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens OX=9606 GN=ACOX3 PE=1 SV=2 CANONICAL=O15254-1" }, "isoforms": [ { "isoform_ac": "D6RJ89-1", "url": "", "sequence": { "sequence": "MFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTAT", "length": 110, "header": "tr|D6RJ89-1|D6RJ89_HUMAN Computationally mapped isoform of Acyl-CoA oxidase 3, pristanoyl OS=Homo sapiens OX=9606 GN=ACOX3 PE=1 SV=1 CANONICAL=O15254-1" }, "locus": { "chromosome": "4", "start_pos": 8415858, "end_pos": 8410284, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000514423.1", "url": "https://www.ensembl.org/id/ENST00000514423.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000427321.1", "url": "https://www.ensembl.org/id/ENSP00000427321.1" } ] } }, { "isoform_ac": "O15254-1", "url": "", "sequence": { "sequence": "MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLSRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL", "length": 700, "header": "sp|O15254-1|ACOX3_HUMAN Isoform 1 of Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens OX=9606 GN=ACOX3 PE=1 SV=2 CANONICAL=O15254-1" }, "locus": { "chromosome": "4", "start_pos": 8416521, "end_pos": 8366964, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000356406.10", "url": "https://www.ensembl.org/id/ENST00000356406.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000348775.4", "url": "https://www.ensembl.org/id/ENSP00000348775.4" } ] } }, { "isoform_ac": "O15254-2", "url": "", "sequence": { "sequence": "MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLSRHAALLYRAERRCSCPGRRDRSS", "length": 624, "header": "sp|O15254-2|ACOX3_HUMAN Isoform 2 of Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens OX=9606 GN=ACOX3 PE=1 SV=2 CANONICAL=O15254-1" }, "locus": { "chromosome": "4", "start_pos": 8416521, "end_pos": 8370951, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000413009.6", "url": "https://www.ensembl.org/id/ENST00000413009.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000413994.2", "url": "https://www.ensembl.org/id/ENSP00000413994.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O15254", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15254" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "iPTMnet", "id": "O15254", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15254" } ], "site_lbl": "Thr281" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Identification and characterization of the human orthologue of yeast Pex14p.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Will GK, Soukupova M, Hong X, Erdmann KS, Kiel JA, Dodt G, Kunau WH, Erdmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "10022913", "url": "https://glygen.org/publication/PubMed/10022913" } ] }, { "title": "Identification of peroxisomal acyl-CoA thioesterases in yeast and humans.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Jones JM, Nau K, Geraghty MT, Erdmann R, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "10092594", "url": "https://glygen.org/publication/PubMed/10092594" } ] }, { "title": "Molecular cloning and expression of human carnitine octanoyltransferase: evidence for its role in the peroxisomal beta-oxidation of branched-chain fatty acids.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Ferdinandusse S, Mulders J, IJlst L, Denis S, Dacremont G, Waterham HR, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "10486279", "url": "https://glygen.org/publication/PubMed/10486279" } ] }, { "title": "PEX12 interacts with PEX5 and PEX10 and acts downstream of receptor docking in peroxisomal matrix protein import.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Chang CC, Warren DS, Sacksteder KA, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "10562279", "url": "https://glygen.org/publication/PubMed/10562279" } ] }, { "title": "PEX7 gene structure, alternative transcripts, and evidence for a founder haplotype for the frequent RCDP allele, L292ter.", "journal": "Genomics", "date": "2000", "authors": "Braverman N, Steel G, Lin P, Moser A, Moser H, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "10673331", "url": "https://glygen.org/publication/PubMed/10673331" } ] }, { "title": "Mitochondrial and peroxisomal targeting of 2-methylacyl-CoA racemase in humans.", "journal": "Journal of lipid research", "date": "2000", "authors": "Amery L, Fransen M, De Nys K, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "11060344", "url": "https://glygen.org/publication/PubMed/11060344" } ] }, { "title": "Subcellular localization and physiological role of alpha-methylacyl-CoA racemase.", "journal": "Journal of lipid research", "date": "2000", "authors": "Ferdinandusse S, Denis S, IJlst L, Dacremont G, Waterham HR, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "11060359", "url": "https://glygen.org/publication/PubMed/11060359" } ] }, { "title": "Peroxisomal targeting signal-1 recognition by the TPR domains of human PEX5.", "journal": "Nature structural biology", "date": "2000", "authors": "Gatto GJ Jr, Geisbrecht BV, Gould SJ, Berg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11101887", "url": "https://glygen.org/publication/PubMed/11101887" } ] }, { "title": "Domain mapping of human PEX5 reveals functional and structural similarities to Saccharomyces cerevisiae Pex18p and Pex21p.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Dodt G, Warren D, Becker E, Rehling P, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11546814", "url": "https://glygen.org/publication/PubMed/11546814" } ] }, { "title": "Mutational spectrum in the PEX7 gene and functional analysis of mutant alleles in 78 patients with rhizomelic chondrodysplasia punctata type 1.", "journal": "American journal of human genetics", "date": "2002", "authors": "Motley AM, Brites P, Gerez L, Hogenhout E, Haasjes J, Benne R, Tabak HF, Wanders RJ, Waterham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11781871", "url": "https://glygen.org/publication/PubMed/11781871" } ] }, { "title": "Functional studies on human Pex7p: subcellular localization and interaction with proteins containing a peroxisome-targeting signal type 2 and other peroxins.", "journal": "The Biochemical journal", "date": "2002", "authors": "Ghys K, Fransen M, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11931631", "url": "https://glygen.org/publication/PubMed/11931631" } ] }, { "title": "PEX5 binds the PTS1 independently of Hsp70 and the peroxin PEX12.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Harper CC, Berg JM, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12456682", "url": "https://glygen.org/publication/PubMed/12456682" } ] }, { "title": "Protein structure and import into the peroxisomal matrix.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Brocard CB, Jedeszko C, Song HC, Terlecky SR, Walton PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12559034", "url": "https://glygen.org/publication/PubMed/12559034" } ] }, { "title": "Structure of human carnitine acetyltransferase. Molecular basis for fatty acyl transfer.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu D, Govindasamy L, Lian W, Gu Y, Kukar T, Agbandje-McKenna M, McKenna R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "12562770", "url": "https://glygen.org/publication/PubMed/12562770" } ] }, { "title": "Correlating structure and affinity for PEX5:PTS1 complexes.", "journal": "Biochemistry", "date": "2003", "authors": "Gatto GJ Jr, Maynard EL, Guerrerio AL, Geisbrecht BV, Gould SJ, Berg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12578380", "url": "https://glygen.org/publication/PubMed/12578380" } ] }, { "title": "The pathogenic peroxin Pex26p recruits the Pex1p-Pex6p AAA ATPase complexes to peroxisomes.", "journal": "Nature cell biology", "date": "2003", "authors": "Matsumoto N, Tamura S, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12717447", "url": "https://glygen.org/publication/PubMed/12717447" } ] }, { "title": "The energetics of Pex5p-mediated peroxisomal protein import.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oliveira ME, Gouveia AM, Pinto RA, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12885776", "url": "https://glygen.org/publication/PubMed/12885776" } ] }, { "title": "Pex7p translocates in and out of peroxisomes in Saccharomyces cerevisiae.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Nair DM, Purdue PE, Lazarow PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "15545321", "url": "https://glygen.org/publication/PubMed/15545321" } ] }, { "title": "Peroxisomal branched chain fatty acid beta-oxidation pathway is upregulated in prostate cancer.", "journal": "The Prostate", "date": "2005", "authors": "Zha S, Ferdinandusse S, Hicks JL, Denis S, Dunn TA, Wanders RJ, Luo J, De Marzo AM, Isaacs WB", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" }, { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" } ], "reference": [ { "type": "PubMed", "id": "15599942", "url": "https://glygen.org/publication/PubMed/15599942" } ] }, { "title": "Alternative splicing suggests extended function of PEX26 in peroxisome biogenesis.", "journal": "American journal of human genetics", "date": "2005", "authors": "Weller S, Cajigas I, Morrell J, Obie C, Steel G, Gould SJ, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "15858711", "url": "https://glygen.org/publication/PubMed/15858711" } ] }, { "title": "Mutational spectrum of D-bifunctional protein deficiency and structure-based genotype-phenotype analysis.", "journal": "American journal of human genetics", "date": "2006", "authors": "Ferdinandusse S, Ylianttila MS, Gloerich J, Koski MK, Oostheim W, Waterham HR, Hiltunen JK, Wanders RJ, Glumoff T", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "16385454", "url": "https://glygen.org/publication/PubMed/16385454" } ] }, { "title": "Biochemistry of mammalian peroxisomes revisited.", "journal": "Annual review of biochemistry", "date": "2006", "authors": "Wanders RJ, Waterham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "16756494", "url": "https://glygen.org/publication/PubMed/16756494" } ] }, { "title": "Dynamic and functional assembly of the AAA peroxins, Pex1p and Pex6p, and their membrane receptor Pex26p.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tamura S, Yasutake S, Matsumoto N, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "16854980", "url": "https://glygen.org/publication/PubMed/16854980" } ] }, { "title": "Peroxisome targeting signal 1: is it really a simple tripeptide?", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Brocard C, Hartig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "17007944", "url": "https://glygen.org/publication/PubMed/17007944" } ] }, { "title": "Ubiquitination of mammalian Pex5p, the peroxisomal import receptor.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Carvalho AF, Pinto MP, Grou CP, Alencastre IS, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "17726030", "url": "https://glygen.org/publication/PubMed/17726030" } ] }, { "title": "Members of the E2D (UbcH5) family mediate the ubiquitination of the conserved cysteine of Pex5p, the peroxisomal import receptor.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Grou CP, Carvalho AF, Pinto MP, Wiese S, Piechura H, Meyer HE, Warscheid B, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "18359941", "url": "https://glygen.org/publication/PubMed/18359941" } ] }, { "title": "Genotype-phenotype correlation in PEX5-deficient peroxisome biogenesis defective cell lines.", "journal": "Human mutation", "date": "2009", "authors": "Ebberink MS, Mooyer PA, Koster J, Dekker CJ, Eyskens FJ, Dionisi-Vici C, Clayton PT, Barth PG, Wanders RJ, Waterham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "18712838", "url": "https://glygen.org/publication/PubMed/18712838" } ] }, { "title": "Structural basis for competitive interactions of Pex14 with the import receptors Pex5 and Pex19.", "journal": "The EMBO journal", "date": "2009", "authors": "Neufeld C, Filipp FV, Simon B, Neuhaus A, Schuller N, David C, Kooshapur H, Madl T, Erdmann R, Schliebs W, Wilmanns M, Sattler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19197237", "url": "https://glygen.org/publication/PubMed/19197237" } ] }, { "title": "Properties of the ubiquitin-pex5p thiol ester conjugate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Grou CP, Carvalho AF, Pinto MP, Huybrechts SJ, Sa-Miranda C, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19208625", "url": "https://glygen.org/publication/PubMed/19208625" } ] }, { "title": "Large-scale proteomics analysis of the human kinome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" }, { "database": "iPTMnet", "id": "O15254", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15254" } ], "reference": [ { "type": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" } ] }, { "title": "Solution structure of human Pex5.Pex14.PTS1 protein complexes obtained by small angle X-ray scattering.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Shiozawa K, Konarev PV, Neufeld C, Wilmanns M, Svergun DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19584060", "url": "https://glygen.org/publication/PubMed/19584060" } ] }, { "title": "Mapping the cargo protein membrane translocation step into the PEX5 cycling pathway.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Alencastre IS, Rodrigues TA, Grou CP, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19632994", "url": "https://glygen.org/publication/PubMed/19632994" } ] }, { "title": "A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.", "journal": "Journal of the American Chemical Society", "date": "2010", "authors": "Ghosh D, Berg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "20178365", "url": "https://glygen.org/publication/PubMed/20178365" } ] }, { "title": "An approach based on a genome-wide association study reveals candidate loci for narcolepsy.", "journal": "Human genetics", "date": "2010", "authors": "Shimada M, Miyagawa T, Kawashima M, Tanaka S, Honda Y, Honda M, Tokunaga K", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" } ], "reference": [ { "type": "PubMed", "id": "20677014", "url": "https://glygen.org/publication/PubMed/20677014" } ] }, { "title": "Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.", "journal": "PloS one", "date": "2010", "authors": "Hendrickson SL, Lautenberger JA, Chinn LW, Malasky M, Sezgin E, Kingsley LA, Goedert JJ, Kirk GD, Gomperts ED, Buchbinder SP, Troyer JL, O'Brien SJ", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" } ], "reference": [ { "type": "PubMed", "id": "20877624", "url": "https://glygen.org/publication/PubMed/20877624" } ] }, { "title": "Cysteine ubiquitination of PTS1 receptor Pex5p regulates Pex5p recycling.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Okumoto K, Misono S, Miyata N, Matsumoto Y, Mukai S, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "21554508", "url": "https://glygen.org/publication/PubMed/21554508" } ] }, { "title": "PEX5 protein binds monomeric catalase blocking its tetramerization and releases it upon binding the N-terminal domain of PEX14.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Freitas MO, Francisco T, Rodrigues TA, Alencastre IS, Pinto MP, Grou CP, Carvalho AF, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "21976670", "url": "https://glygen.org/publication/PubMed/21976670" } ] }, { "title": "AWP1/ZFAND6 functions in Pex5 export by interacting with cys-monoubiquitinated Pex5 and Pex6 AAA ATPase.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Miyata N, Okumoto K, Mukai S, Noguchi M, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "21980954", "url": "https://glygen.org/publication/PubMed/21980954" } ] }, { "title": "Two proteases, trypsin domain-containing 1 (Tysnd1) and peroxisomal lon protease (PsLon), cooperatively regulate fatty acid beta-oxidation in peroxisomal matrix.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Okumoto K, Kametani Y, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22002062", "url": "https://glygen.org/publication/PubMed/22002062" } ] }, { "title": "Structural requirements for interaction of peroxisomal targeting signal 2 and its receptor PEX7.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kunze M, Neuberger G, Maurer-Stroh S, Ma J, Eck T, Braverman N, Schmid JA, Eisenhaber F, Berger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "title": "Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Identification of ubiquitin-specific protease 9X (USP9X) as a deubiquitinase acting on ubiquitin-peroxin 5 (PEX5) thioester conjugate.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Grou CP, Francisco T, Rodrigues TA, Freitas MO, Pinto MP, Carvalho AF, Domingues P, Wood SA, Rodriguez-Borges JE, Sa-Miranda C, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22371489", "url": "https://glygen.org/publication/PubMed/22371489" } ] }, { "title": "Pex5p imports folded tetrameric catalase by interaction with Pex13p.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Otera H, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22747494", "url": "https://glygen.org/publication/PubMed/22747494" } ] }, { "title": "Purification and properties of carnitine acetyltransferase from human liver.", "journal": "European journal of biochemistry", "date": "1990", "authors": "Bloisi W, Colombo I, Garavaglia B, Giardini R, Finocchiaro G, Didonato S", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "2351134", "url": "https://glygen.org/publication/PubMed/2351134" } ] }, { "title": "A cargo-centered perspective on the PEX5 receptor-mediated peroxisomal protein import pathway.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Francisco T, Rodrigues TA, Freitas MO, Grou CP, Carvalho AF, Sa-Miranda C, Pinto MP, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "23963456", "url": "https://glygen.org/publication/PubMed/23963456" } ] }, { "title": "A novel Pex14 protein-interacting site of human Pex5 is critical for matrix protein import into peroxisomes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neuhaus A, Kooshapur H, Wolf J, Meyer NH, Madl T, Saidowsky J, Hambruch E, Lazam A, Jung M, Sattler M, Schliebs W, Erdmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "24235149", "url": "https://glygen.org/publication/PubMed/24235149" } ] }, { "title": "A PEX7-centered perspective on the peroxisomal targeting signal type 2-mediated protein import pathway.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Rodrigues TA, Alencastre IS, Francisco T, Brites P, Fransen M, Grou CP, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "24865970", "url": "https://glygen.org/publication/PubMed/24865970" } ] }, { "title": "AAA peroxins and their recruiter Pex26p modulate the interactions of peroxins involved in peroxisomal protein import.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Tamura S, Matsumoto N, Takeba R, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "25016021", "url": "https://glygen.org/publication/PubMed/25016021" } ] }, { "title": "Mechanistic insights into PTS2-mediated peroxisomal protein import: the co-receptor PEX5L drastically increases the interaction strength between the cargo protein and the receptor PEX7.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Kunze M, Malkani N, Maurer-Stroh S, Wiesinger C, Schmid JA, Berger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "25538232", "url": "https://glygen.org/publication/PubMed/25538232" } ] }, { "title": "The peroxisomal protein import machinery displays a preference for monomeric substrates.", "journal": "Open biology", "date": "2015", "authors": "Freitas MO, Francisco T, Rodrigues TA, Lismont C, Domingues P, Pinto MP, Grou CP, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "25854684", "url": "https://glygen.org/publication/PubMed/25854684" } ] }, { "title": "Export-deficient monoubiquitinated PEX5 triggers peroxisome removal in SV40 large T antigen-transformed mouse embryonic fibroblasts.", "journal": "Autophagy", "date": "2015", "authors": "Nordgren M, Francisco T, Lismont C, Hennebel L, Brees C, Wang B, Van Veldhoven PP, Azevedo JE, Fransen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26086376", "url": "https://glygen.org/publication/PubMed/26086376" } ] }, { "title": "Revisiting the intraperoxisomal pathway of mammalian PEX7.", "journal": "Scientific reports", "date": "2015", "authors": "Rodrigues TA, Grou CP, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26138649", "url": "https://glygen.org/publication/PubMed/26138649" } ] }, { "title": "A novel type of rhizomelic chondrodysplasia punctata, RCDP5, is caused by loss of the PEX5 long isoform.", "journal": "Human molecular genetics", "date": "2015", "authors": "Baroy T, Koster J, Stromme P, Ebberink MS, Misceo D, Ferdinandusse S, Holmgren A, Hughes T, Merckoll E, Westvik J, Woldseth B, Walter J, Wood N, Tvedt B, Stadskleiv K, Wanders RJ, Waterham HR, Frengen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26220973", "url": "https://glygen.org/publication/PubMed/26220973" } ] }, { "title": "ATM functions at the peroxisome to induce pexophagy in response to ROS.", "journal": "Nature cell biology", "date": "2015", "authors": "Zhang J, Tripathi DN, Jing J, Alexander A, Kim J, Powell RT, Dere R, Tait-Mulder J, Lee JH, Paull TT, Pandita RK, Charaka VK, Pandita TK, Kastan MB, Walker CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26344566", "url": "https://glygen.org/publication/PubMed/26344566" } ] }, { "title": "PEX2 is the E3 ubiquitin ligase required for pexophagy during starvation.", "journal": "The Journal of cell biology", "date": "2016", "authors": "Sargent G, van Zutphen T, Shatseva T, Zhang L, Di Giovanni V, Bandsma R, Kim PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "27597759", "url": "https://glygen.org/publication/PubMed/27597759" } ] }, { "title": "The peroxisomal AAA ATPase complex prevents pexophagy and development of peroxisome biogenesis disorders.", "journal": "Autophagy", "date": "2017", "authors": "Law KB, Bronte-Tinkew D, Di Pietro E, Snowden A, Jones RO, Moser A, Brumell JH, Braverman N, Kim PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28521612", "url": "https://glygen.org/publication/PubMed/28521612" } ] }, { "title": "Structure and Function of p97 and Pex1/6 Type II AAA+ Complexes.", "journal": "Frontiers in molecular biosciences", "date": "2017", "authors": "Saffert P, Enenkel C, Wendler P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28611990", "url": "https://glygen.org/publication/PubMed/28611990" } ] }, { "title": "The peroxisomal matrix protein translocon is a large cavity-forming protein assembly into which PEX5 protein enters to release its cargo.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Dias AF, Rodrigues TA, Pedrosa AG, Barros-Barbosa A, Francisco T, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28765278", "url": "https://glygen.org/publication/PubMed/28765278" } ] }, { "title": "Protein transport into peroxisomes: Knowns and unknowns.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2017", "authors": "Francisco T, Rodrigues TA, Dias AF, Barros-Barbosa A, Bicho D, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28787099", "url": "https://glygen.org/publication/PubMed/28787099" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O15254", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15254" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "ACOX3 Dysfunction as a Potential Cause of Recurrent Spontaneous Vasospasm of Internal Carotid Artery.", "journal": "Translational stroke research", "date": "2020", "authors": "Kim JT, Won SY, Kang K, Kim SH, Park MS, Choi KH, Nam TS, Denis SW, Ferdinandusse S, Lee JE, Choi SY, Kim MK", "evidence": [ { "database": "RefSeq", "id": "NP_001095137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001095137" } ], "reference": [ { "type": "PubMed", "id": "31975215", "url": "https://glygen.org/publication/PubMed/31975215" } ] }, { "title": "Purification and characterization of an alpha-methylacyl-CoA racemase from human liver.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Schmitz W, Albers C, Fingerhut R, Conzelmann E", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "7649182", "url": "https://glygen.org/publication/PubMed/7649182" } ] }, { "title": "Mutations in the PTS1 receptor gene, PXR1, define complementation group 2 of the peroxisome biogenesis disorders.", "journal": "Nature genetics", "date": "1995", "authors": "Dodt G, Braverman N, Wong C, Moser A, Moser HW, Watkins P, Valle D, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "7719337", "url": "https://glygen.org/publication/PubMed/7719337" } ] }, { "title": "Human peroxisomal targeting signal-1 receptor restores peroxisomal protein import in cells from patients with fatal peroxisomal disorders.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Wiemer EA, Nuttley WM, Bertolaet BL, Li X, Francke U, Wheelock MJ, Anne UK, Johnson KR, Subramani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "7790377", "url": "https://glygen.org/publication/PubMed/7790377" } ] }, { "title": "The CoA esters of 2-methyl-branched chain fatty acids and of the bile acid intermediates di- and trihydroxycoprostanic acids are oxidized by one single peroxisomal branched chain acyl-CoA oxidase in human liver and kidney.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Vanhove GF, Van Veldhoven PP, Fransen M, Denis S, Eyssen HJ, Wanders RJ, Mannaerts GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "8387517", "url": "https://glygen.org/publication/PubMed/8387517" } ] }, { "title": "Characterization of the yeast and human receptors for the carboxy-terminal tripeptide peroxisomal targeting signal.", "journal": "Cold Spring Harbor symposia on quantitative biology", "date": "1995", "authors": "Wiemer EA, Terlecky SR, Nuttley WM, Subramani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "8824437", "url": "https://glygen.org/publication/PubMed/8824437" } ] }, { "title": "Pex13p is an SH3 protein of the peroxisome membrane and a docking factor for the predominantly cytoplasmic PTs1 receptor.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Gould SJ, Kalish JE, Morrell JC, Bjorkman J, Urquhart AJ, Crane DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "8858165", "url": "https://glygen.org/publication/PubMed/8858165" } ] }, { "title": "Purification and properties of human D-3-hydroxyacyl-CoA dehydratase: medium-chain enoyl-CoA hydratase is D-3-hydroxyacyl-CoA dehydratase.", "journal": "Journal of biochemistry", "date": "1996", "authors": "Jiang LL, Kobayashi A, Matsuura H, Fukushima H, Hashimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "8902629", "url": "https://glygen.org/publication/PubMed/8902629" } ] }, { "title": "Molecular characterization of the human peroxisomal branched-chain acyl-CoA oxidase: cDNA cloning, chromosomal assignment, tissue distribution, and evidence for the absence of the protein in Zellweger syndrome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Baumgart E, Vanhooren JC, Fransen M, Marynen P, Puype M, Vandekerckhove J, Leunissen JA, Fahimi HD, Mannaerts GP, van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "8943006", "url": "https://glygen.org/publication/PubMed/8943006" } ] }, { "title": "Multiple PEX genes are required for proper subcellular distribution and stability of Pex5p, the PTS1 receptor: evidence that PTS1 protein import is mediated by a cycling receptor.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Dodt G, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "8991089", "url": "https://glygen.org/publication/PubMed/8991089" } ] }, { "title": "Structure of D-3-hydroxyacyl-CoA dehydratase/D-3-hydroxyacyl-CoA dehydrogenase bifunctional protein.", "journal": "Journal of biochemistry", "date": "1997", "authors": "Jiang LL, Miyazawa S, Souri M, Hashimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "9089413", "url": "https://glygen.org/publication/PubMed/9089413" } ] }, { "title": "Human PEX7 encodes the peroxisomal PTS2 receptor and is responsible for rhizomelic chondrodysplasia punctata.", "journal": "Nature genetics", "date": "1997", "authors": "Braverman N, Steel G, Obie C, Moser A, Moser H, Gould SJ, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9090381", "url": "https://glygen.org/publication/PubMed/9090381" } ] }, { "title": "Rhizomelic chondrodysplasia punctata is a peroxisomal protein targeting disease caused by a non-functional PTS2 receptor.", "journal": "Nature genetics", "date": "1997", "authors": "Motley AM, Hettema EH, Hogenhout EM, Brites P, ten Asbroek AL, Wijburg FA, Baas F, Heijmans HS, Tabak HF, Wanders RJ, Distel B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9090382", "url": "https://glygen.org/publication/PubMed/9090382" } ] }, { "title": "Rhizomelic chondrodysplasia punctata is caused by deficiency of human PEX7, a homologue of the yeast PTS2 receptor.", "journal": "Nature genetics", "date": "1997", "authors": "Purdue PE, Zhang JW, Skoneczny M, Lazarow PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9090383", "url": "https://glygen.org/publication/PubMed/9090383" } ] }, { "title": "Evidence for the existence of a pristanoyl-CoA oxidase gene in man.", "journal": "Biochem. J.", "date": "1997", "authors": "Vanhooren JC, Marynen P, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" }, { "database": "Reactome", "id": "R-HSA-389887", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887" } ], "reference": [ { "type": "PubMed", "id": "9271077", "url": "https://glygen.org/publication/PubMed/9271077" } ] }, { "title": "Human PEX1 cloned by functional complementation on a CHO cell mutant is responsible for peroxisome-deficient Zellweger syndrome of complementation group I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Tamura S, Okumoto K, Toyama R, Shimozawa N, Tsukamoto T, Suzuki Y, Osumi T, Kondo N, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9539740", "url": "https://glygen.org/publication/PubMed/9539740" } ] }, { "title": "Identification of a human PTS1 receptor docking protein directly required for peroxisomal protein import.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Fransen M, Terlecky SR, Subramani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9653144", "url": "https://glygen.org/publication/PubMed/9653144" } ] }, { "title": "An isoform of pex5p, the human PTS1 receptor, is required for the import of PTS2 proteins into peroxisomes.", "journal": "Human molecular genetics", "date": "1998", "authors": "Braverman N, Dodt G, Gould SJ, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9668159", "url": "https://glygen.org/publication/PubMed/9668159" } ] }, { "title": "The difference in recognition of terminal tripeptides as peroxisomal targeting signal 1 between yeast and human is due to different affinities of their receptor Pex5p to the cognate signal and to residues adjacent to it.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lametschwandtner G, Brocard C, Fransen M, Van Veldhoven P, Berger J, Hartig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9837948", "url": "https://glygen.org/publication/PubMed/9837948" } ] } ], "pathway": [ { "id": "hsa:8310", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8310", "resource": "KEGG Pathway" }, { "id": "R-HSA-389887", "name": "Beta-oxidation of pristanoyl-CoA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389887", "resource": "Reactome", "description": "Beta-oxidation of pristanoyl-CoA" }, { "id": "R-HSA-9033241", "name": "Peroxisomal protein import", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241", "resource": "Reactome", "description": "Peroxisomal protein import" } ], "orthologs": [ { "uniprot_canonical_ac": "B7Z028-1", "protein_name": "Acyl-coenzyme A oxidase", "gene_name": "Acox3", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MASGVGDGDGGDQNGLNSLLTALGDYYSGRREEKAAANIYDDKRIFPDFRSGPLEEYRERASFCYKRMNVVLEGEDHIRLKHKVWQWMEQHPDYQREPGSDLERTREMANKRQHLLWEQQFYGVNEYLGTPHLLLAFGQAIFSYDFSTSVKFGLSTGMFPSTLVSNGSGRLGKYVAKIADNRILGAYALTEISHGTNALGMRTRATYDVKRQEFIIHTPDFEAAKCWVGNLGKTCTHAIVYAQLYVPDDKHQGLQAFLVPIRDERTLLPFPGVTVGDMGEKIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSKIKDERKRLGASLGALSVGRVNITAITYVALSKAVTIATRYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLATTIALRVATLWIGKENVDLTMKGFTGEDTSQAGMEIHAISSALKPVATWAARDGIQECREACGGHGYLKSSGLGELRNDNDANCTYEGENNTLIQQASNWLISLQRNNADFVAVSPLETVSFLKDMDTILQSKGQERTPAEVLDPLNLLNALNWLTVWQLDTTVKRVEEQQREGKDAFETRNNIQVFAAQKLSIIYGERTIYYVFYKFVIGLPDSAEKKVLQQVLSFYGAHLVTKYSAAFYRGGYFRENSNQLELYEQGILALLPLLKNEAIALVDAIAPTDFILNSPLGMSDGNVYQHLQRTLVSTPGVYERPHWWRDVTYKDYLKRAKL", "length": 724 }, "evidence": [ { "id": "O15254", "url": "https://omabrowser.org/oma/group/O15254/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q63448-1", "protein_name": "Peroxisomal acyl-coenzyme A oxidase 3", "gene_name": "Acox3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGSSSERRDSVLWSDIPKGPLSAYRARASFNSKELMLFWDGQDVLDFKKTIFSTLENDPLFARPFGADLPLEKERELNFLRCKRVFEYGFFNAEDMLKNPLKILVLMNCLGMYDWSLANKCVLHMLVFGSTIIGSGSEHHFKYLEKIYNLEIFGCFALTELSHGSNTKAMRTTAHYDPATQEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYTPDGQCRGLHSFLVQIRDPKTLLPMPGVMVGDMGKKLGQNGLDNGFAMFHKVRIPRQNLLDRTGNVTSEGHYHTPFKDVRQRLGASLGSLSSGRISIISISVVNLKLAVIIAIRFSATRRQFGPTDKEEIPVLEYPLQQWRLLPYLAAAYALDHFSKTIFLDLIELQRAGKVGTTVTGRQSSGREIHALASAGKPLASWTAQRGIQECREVVGGHGYLAMNRFGELRNDNDPNCTYEGDNNVLLQQTSNYLLSLLEHPLQDGAHFTSPLKTVNFLEAYPGILGQKFMASSKADWLDSEAPLAAYRWLVCYLLRESHQRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELTVMQRFHEHTHSSSVPPSLRTVLGRLSMLYGLWCLSQHTALLYRGGYISGEQTGKAMEDAILMLCVQLKDDAVALVDAIAPSDFVLGSPIGRADGELYKNLWAAVLQQSGVLERAAWWPEFTANKSVANRLKSQL", "length": 700 }, "evidence": [ { "id": "45924929", "url": "http://www.informatics.jax.org/homology/45924929", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9EPL9-1", "protein_name": "Peroxisomal acyl-coenzyme A oxidase 3", "gene_name": "Acox3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGSLPEEKDSALWSDTPKGPLSAYRARASFNSGELLLFWDGQDVIHFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKVEELLKNPLKILVLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEIFGCFALTELSHGSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYMPDGQCHGLHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPRQNLLDRTGNITSEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRFSATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGDHSDQQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPNCTYEGDNNVLLQQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKADWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELTVMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMEDAILTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGELYKNLWAAVLQQNGVLERAAWWPEFSANKSVADRLKSQL", "length": 700 }, "evidence": [ { "id": "45924929", "url": "http://www.informatics.jax.org/homology/45924929", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "fatty acid binding", "id": "GO:0005504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "flavin adenine dinucleotide binding", "id": "GO:0050660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050660", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "FAD binding", "id": "GO:0071949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071949", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "pristanoyl-CoA oxidase activity", "id": "GO:0016402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016402", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "acyl-CoA oxidase activity", "id": "GO:0003997", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003997", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "peroxisomal matrix", "id": "GO:0005782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005782", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "fatty acid beta-oxidation using acyl-CoA oxidase", "id": "GO:0033540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033540", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "lipid homeostasis", "id": "GO:0055088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055088", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" }, { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "O15254", "url": "https://www.uniprot.org/uniprot/O15254" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 447, "end_pos": 449, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "38959", "name": "", "equation": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07872-1", "Q63448-1", "O15254-1", "Q15067-1", "Q9R0H0-1", "Q9EPL9-1", "P13711-1", "Q54GQ6-1", "Q7KML2-1" ], "evidence": [ { "id": "38959", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38959" } ] }, { "id": "40167", "name": "", "equation": "hexadecanoyl-CoA + O2 = (2E)-hexadecenoyl-CoA + H2O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07872-1", "Q63448-1", "O15254-1", "Q15067-1", "Q9R0H0-1", "Q9EPL9-1" ], "evidence": [ { "id": "40167", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40167" } ] }, { "id": "40275", "name": "", "equation": "hexadecanedioyl-CoA + O2 = (2E)-hexadecenedioyl-CoA + H2O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07872-1", "Q63448-1", "O15254-1", "Q15067-1", "Q9R0H0-1", "Q9EPL9-1" ], "evidence": [ { "id": "40275", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40275" } ] }, { "id": "40319", "name": "", "equation": "O2 + tetracosanoyl-CoA = (2E)-tetracosenoyl-CoA + H2O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07872-1", "Q63448-1", "O15254-1", "Q15067-1", "Q9R0H0-1", "Q9EPL9-1" ], "evidence": [ { "id": "40319", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40319" } ] }, { "id": "40459", "name": "", "equation": "(2S)-pristanoyl-CoA + O2 = (2E)-pristenoyl-CoA + H2O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63448-1", "O15254-1", "Q9EPL9-1" ], "evidence": [ { "id": "40459", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40459" } ] }, { "id": "R-HSA-389891", "name": "(2S)-pristanoyl-CoA + O2 => trans-2,3-dehydropristanoyl-CoA + H2O2 (ACOX3)", "equation": "", "summary": "Peroxisomal ACOX3 catalyzes the reaction of (2S)-pristanoyl-CoA and O2 to form trans-2,3-dehydropristanoyl-CoA and H2O2. ACOX3 protein and enzyme activity have been observed in prostate tumors, but are undetectable in normal prostate tissue as well as in liver and kidney (where ACOX2 catalyzes the oxidation of pristanoyl-CoA) (Zha et al. 2005; Vanhooren et al. 1997). The physiological consequences of this differential gene expression are unknown.", "cellular_location": "peroxisomal matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15254-1" ], "evidence": [ { "id": "R-HSA-389891", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389891" } ] }, { "id": "R-HSA-9033233", "name": "PEX5S,L binds cargo proteins containing PTS1", "equation": "", "summary": "It is unclear how the long isoform of PEX5 (PEX5L) and the short isoform of PEX5 (PEX5S) are generated. A current hypothesis suggests alternative mRNA splicing. Both isoforms can bind the peroxisome targeting signal 1 (PTS1) located at the C-terminus of most of the proteins that are targeted to the peroxisomal matrix (Dodt et al. 1995, Fransen et al. 1995, Wiemer et al. 1995, Gatto et al. 2000, Brocard et al. 2003, Gatto et al. 2003, Harper et al. 2003, Ghosh and Berg 2010, Freitas et al. 2011, Okumoto et al. 2011). PTS1 typically contains Ser-Lys-Leu (SKL) at the C-terminus but substantial variation in sequences and affinities for PEX5 are observed and upstream residues can modulate binding to PEX5 (Lametschwandtner et al. 1998, Ghosh and Berg 2010, reviewed in Brocard and Hartig 2006).
A minority of peroxisomal matrix proteins contain PTS2. While the PEX5S isoform binds proteins containing PTS1, the PEX5L isoform binds either proteins containing PTS1 or PEX7 bound to proteins containing PTS2 (Braverman et al. 1998). Some proteins appear to be imported as oligomers, however this is rather inefficient as PEX5 appears to have a preference for monomeric substrates (Otera and Fujiki 2012, Freitas et al. 2011, Freitas et al. 2015, also inferred from mouse homologs). Mutations in PEX5 cause defects in peroxisomal import and comprise complementation group 2 of peroxisomal biogenesis disorders (also called Zellweger spectrum disorders) (Dodt et al. 1995, Wiemer et al. 1995). A specific mutation affecting only the PEX5L isoform is the cause of rhizomelic chondrodysplasia punctate type 5 (Bar\u00f8y et al. 2015).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22307-1", "P35914-1", "A8MXV4-1", "Q9NUI1-1", "Q9BTZ2-1", "Q9P0Z9-1", "O15228-1", "Q99489-1", "O14734-1", "P49753-1", "Q8N9L9-1", "P14920-1", "O15254-1", "Q99424-1", "Q15067-1", "Q9UHK6-1", "P04040-1", "P35228-1", "Q9UJM8-1", "Q9UKG9-1", "Q6QHF9-2", "P21549-1", "Q9BY49-1", "Q13011-1", "Q86WA8-1", "P43155-1", "O14975-1", "Q14032-1", "Q9Y2Q3-1", "P14735-1", "P0C024-1", "O75874-1", "Q9NYQ3-1", "Q9UJ83-1", "Q2T9J0-1" ], "evidence": [ { "id": "R-HSA-9033233", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033233" } ] }, { "id": "R-HSA-9033235", "name": "Cargo of PEX5S,L translocates from the cytosol to the peroxisomal matrix", "equation": "", "summary": "After binding the Docking and Translocation Module comprising PEX14, PEX13, PEX2, PEX10 and PEX12 , PEX5S or PEX5L bound to a cargo protein becomes localized to the membrane (Dodt et al. 1995, Wiemer et al. 1995, Alencastre et al. 2009, Francisco et al. 2013, Dias et al. 2017). In a reaction that is not yet fully characterized, the cargo protein is released into the peroxisomal matrix while PEX5S or PEX5L remains in the membrane (Dodt et al. 1995, Wiemer et al. 1995, Alencastre et al. 2009, Franscisco et al. 2013). One model for the reaction hypothesizes that PEX13:PEX14 (associated with PEX2:PEX10:PEX12) forms a barrel in the peroxisomal membrane while PEX5S or PEX5L acts as a plunger to guide the cargo through the barrel (Dias et al. 2017, Francisco et al. 2017). Notably, the reaction does not require a source of energy such as ATP (Oliveira et al. 2003). Mutations in PEX5 cause defects in import of PTS1-containing proteins or PTS2-containing proteins or both (Eberrink et al. 2009, Bar\u00f8y et al. 2015).", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22307-1", "P35914-1", "A8MXV4-1", "P28328-1", "Q9NUI1-1", "Q9BTZ2-1", "Q9P0Z9-1", "O15228-1", "Q99489-1", "O14734-1", "P49753-1", "Q8N9L9-1", "P14920-1", "O15254-1", "Q99424-1", "Q15067-1", "Q9UHK6-1", "P04040-1", "P35228-1", "Q9UJM8-1", "Q9UKG9-1", "Q6QHF9-2", "P21549-1", "O60683-1", "Q9BY49-1", "Q13011-1", "Q86WA8-1", "P43155-1", "O14975-1", "Q14032-1", "Q9Y2Q3-1", "P14735-1", "P0C024-1", "O75874-1", "Q9NYQ3-1", "Q9UJ83-1", "Q2T9J0-1" ], "evidence": [ { "id": "R-HSA-9033235", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033235" } ] }, { "id": "R-HSA-9033236", "name": "PEX5S,L:Cargo binds PEX13:PEX14:PEX2:PEX10:PEX12 (Docking and Translocation Module)", "equation": "", "summary": "PEX5S or PEX5L bound to cargo proteins containing PTS1 interacts with the Docking and Translocation Module (PEX13:PEX14:PEX2:PEX10:PEX12) (Gould et al. 1996, Fransen et al. 1998, Will et al. 1999, Neufeld et al. 2009, Shiozawa et al. 2009, Freitas et al. 2011, Francisco et al. 2013, Neufeld et al. 2014, Dias et al. 2017).", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22307-1", "P35914-1", "A8MXV4-1", "P28328-1", "Q9NUI1-1", "Q9BTZ2-1", "Q9P0Z9-1", "O15228-1", "Q99489-1", "O14734-1", "P49753-1", "Q8N9L9-1", "P14920-1", "O15254-1", "Q99424-1", "Q15067-1", "Q9UHK6-1", "P04040-1", "P35228-1", "Q9UJM8-1", "Q9UKG9-1", "Q6QHF9-2", "P21549-1", "O60683-1", "Q9BY49-1", "Q13011-1", "Q86WA8-1", "P43155-1", "O14975-1", "Q14032-1", "Q9Y2Q3-1", "P14735-1", "P0C024-1", "O75874-1", "Q9NYQ3-1", "Q9UJ83-1", "Q2T9J0-1" ], "evidence": [ { "id": "R-HSA-9033236", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033236" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A8MXV4", "gene_name": "NUDT19", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "A8MXV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8MXV4" } ] } ] }, { "uniprot_ac": "O14734", "gene_name": "ACOT8", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.27", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.1", "activity": "acetyl-CoA + H2O = acetate + CoA + H(+).", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.11", "activity": "acetoacetyl-CoA + H2O = acetoacetate + CoA + H(+).", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.3", "activity": "H2O + succinyl-CoA = CoA + H(+) + succinate.", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.5", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.3", "activity": "", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.1", "activity": "", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.5", "activity": "", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] }, { "ec_number": "3.1.2.11", "activity": "", "evidence": [ { "id": "O14734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14734" } ] } ] }, { "uniprot_ac": "O14975", "gene_name": "SLC27A2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.3", "activity": "", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] } ] }, { "uniprot_ac": "O15228", "gene_name": "GNPAT", "activity": [ { "ec_number": "2.3.1.42", "activity": "an acyl-CoA + dihydroxyacetone phosphate = a 1-acylglycerone 3-phosphate + CoA.", "evidence": [ { "id": "O15228", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15228" } ] }, { "ec_number": "2.3.1.42", "activity": "", "evidence": [ { "id": "O15228", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15228" } ] } ] }, { "uniprot_ac": "O15254", "gene_name": "ACOX3", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "O15254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15254" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "O15254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15254" } ] } ] }, { "uniprot_ac": "O60683", "gene_name": "PEX10", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O60683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60683" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O60683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60683" } ] } ] }, { "uniprot_ac": "O75874", "gene_name": "IDH1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] } ] }, { "uniprot_ac": "P04040", "gene_name": "CAT", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] } ] }, { "uniprot_ac": "P07872", "gene_name": "Acox1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "P07872", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07872" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "P07872", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07872" } ] } ] }, { "uniprot_ac": "P0C024", "gene_name": "NUDT7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "P0C024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C024" } ] } ] }, { "uniprot_ac": "P13711", "gene_name": "POX1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "P13711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13711" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "P13711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13711" } ] } ] }, { "uniprot_ac": "P14735", "gene_name": "IDE", "activity": [ { "ec_number": "3.4.24.56", "activity": "Degradation of insulin, glucagon and other polypeptides. No action on proteins.", "evidence": [ { "id": "P14735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14735" } ] }, { "ec_number": "3.4.24.56", "activity": "", "evidence": [ { "id": "P14735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14735" } ] } ] }, { "uniprot_ac": "P14920", "gene_name": "DAO", "activity": [ { "ec_number": "1.4.3.3", "activity": "a D-alpha-amino acid + H2O + O2 = a 2-oxocarboxylate + H2O2 + NH4(+).", "evidence": [ { "id": "P14920", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14920" } ] }, { "ec_number": "1.4.3.3", "activity": "", "evidence": [ { "id": "P14920", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14920" } ] } ] }, { "uniprot_ac": "P21549", "gene_name": "AGXT", "activity": [ { "ec_number": "2.6.1.51", "activity": "L-serine + pyruvate = 3-hydroxypyruvate + L-alanine.", "evidence": [ { "id": "P21549", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21549" } ] }, { "ec_number": "2.6.1.44", "activity": "2-oxobutanoate + L-alanine = (2S)-2-aminobutanoate + pyruvate.", "evidence": [ { "id": "P21549", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21549" } ] }, { "ec_number": "2.6.1.44", "activity": "", "evidence": [ { "id": "P21549", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21549" } ] } ] }, { "uniprot_ac": "P22307", "gene_name": "SCP2", "activity": [ { "ec_number": "2.3.1.176", "activity": "4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA.", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] }, { "ec_number": "2.3.1.176", "activity": "", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] } ] }, { "uniprot_ac": "P28328", "gene_name": "PEX2", "activity": [ { "ec_number": "2.3.2.36", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] }, { "ec_number": "2.3.2.36", "activity": "", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] }, { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] } ] }, { "uniprot_ac": "P35228", "gene_name": "NOS2", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P35228", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35228" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P35228", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35228" } ] } ] }, { "uniprot_ac": "P35914", "gene_name": "HMGCL", "activity": [ { "ec_number": "4.1.3.4", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA = acetoacetate + acetyl-CoA.", "evidence": [ { "id": "P35914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35914" } ] }, { "ec_number": "4.1.3.4", "activity": "", "evidence": [ { "id": "P35914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35914" } ] } ] }, { "uniprot_ac": "P43155", "gene_name": "CRAT", "activity": [ { "ec_number": "2.3.1.137", "activity": "(R)-carnitine + octanoyl-CoA = CoA + O-octanoyl-(R)-carnitine.", "evidence": [ { "id": "P43155", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43155" } ] }, { "ec_number": "2.3.1.7", "activity": "(R)-carnitine + acetyl-CoA = CoA + O-acetyl-(R)-carnitine.", "evidence": [ { "id": "P43155", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43155" } ] }, { "ec_number": "2.3.1.7", "activity": "", "evidence": [ { "id": "P43155", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43155" } ] }, { "ec_number": "2.3.1.137", "activity": "", "evidence": [ { "id": "P43155", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43155" } ] } ] }, { "uniprot_ac": "P49753", "gene_name": "ACOT2", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P49753", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49753" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "P49753", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49753" } ] } ] }, { "uniprot_ac": "Q13011", "gene_name": "ECH1", "activity": [ { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "Q13011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13011" } ] } ] }, { "uniprot_ac": "Q14032", "gene_name": "BAAT", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q14032", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14032" } ] }, { "ec_number": "3.1.2.27", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "Q14032", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14032" } ] }, { "ec_number": "2.3.1.65", "activity": "choloyl-CoA + glycine = CoA + glycocholate + H(+).", "evidence": [ { "id": "Q14032", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14032" } ] }, { "ec_number": "2.3.1.65", "activity": "", "evidence": [ { "id": "Q14032", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14032" } ] } ] }, { "uniprot_ac": "Q15067", "gene_name": "ACOX1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q15067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15067" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q15067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15067" } ] } ] }, { "uniprot_ac": "Q2T9J0", "gene_name": "TYSND1", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "Q2T9J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2T9J0" } ] } ] }, { "uniprot_ac": "Q54GQ6", "gene_name": "acox1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q54GQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GQ6" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q54GQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GQ6" } ] } ] }, { "uniprot_ac": "Q63448", "gene_name": "Acox3", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q63448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63448" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q63448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63448" } ] } ] }, { "uniprot_ac": "Q6QHF9", "gene_name": "PAOX", "activity": [ { "ec_number": "1.5.3.13", "activity": "H2O + N(1)-acetylspermine + O2 = 3-acetamidopropanal + H2O2 + spermidine.", "evidence": [ { "id": "Q6QHF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QHF9" } ] }, { "ec_number": "1.5.3.13", "activity": "", "evidence": [ { "id": "Q6QHF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QHF9" } ] } ] }, { "uniprot_ac": "Q7KML2", "gene_name": "", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q7KML2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KML2" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q7KML2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KML2" } ] } ] }, { "uniprot_ac": "Q86WA8", "gene_name": "LONP2", "activity": [ { "ec_number": "3.4.21.53", "activity": "Hydrolysis of proteins in presence of ATP.", "evidence": [ { "id": "Q86WA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86WA8" } ] }, { "ec_number": "3.4.21.53", "activity": "", "evidence": [ { "id": "Q86WA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86WA8" } ] } ] }, { "uniprot_ac": "Q8N9L9", "gene_name": "ACOT4", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q8N9L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N9L9" } ] }, { "ec_number": "3.1.2.3", "activity": "H2O + succinyl-CoA = CoA + H(+) + succinate.", "evidence": [ { "id": "Q8N9L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N9L9" } ] }, { "ec_number": "3.1.2.3", "activity": "", "evidence": [ { "id": "Q8N9L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N9L9" } ] } ] }, { "uniprot_ac": "Q99424", "gene_name": "ACOX2", "activity": [ { "ec_number": "1.17.99.3", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + A + H2O = (24R,25R)-3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestan-26-oyl-CoA + AH2.", "evidence": [ { "id": "Q99424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99424" } ] }, { "ec_number": "1.17.99.3", "activity": "", "evidence": [ { "id": "Q99424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99424" } ] } ] }, { "uniprot_ac": "Q99489", "gene_name": "DDO", "activity": [ { "ec_number": "1.4.3.1", "activity": "D-aspartate + H2O + O2 = H2O2 + NH4(+) + oxaloacetate.", "evidence": [ { "id": "Q99489", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99489" } ] }, { "ec_number": "1.4.3.1", "activity": "", "evidence": [ { "id": "Q99489", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99489" } ] } ] }, { "uniprot_ac": "Q9BTZ2", "gene_name": "DHRS4", "activity": [ { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q9BTZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BTZ2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q9BTZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BTZ2" } ] } ] }, { "uniprot_ac": "Q9BY49", "gene_name": "PECR", "activity": [ { "ec_number": "1.3.1.38", "activity": "a (2E)-enoyl-CoA + H(+) + NADPH = a 2,3-saturated acyl-CoA + NADP(+).", "evidence": [ { "id": "Q9BY49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY49" } ] }, { "ec_number": "1.3.1.38", "activity": "", "evidence": [ { "id": "Q9BY49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY49" } ] } ] }, { "uniprot_ac": "Q9EPL9", "gene_name": "Acox3", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q9EPL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPL9" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q9EPL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPL9" } ] } ] }, { "uniprot_ac": "Q9NUI1", "gene_name": "DECR2", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q9NUI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUI1" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q9NUI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUI1" } ] } ] }, { "uniprot_ac": "Q9NYQ3", "gene_name": "HAO2", "activity": [ { "ec_number": "1.1.3.15", "activity": "glycolate + O2 = glyoxylate + H2O2.", "evidence": [ { "id": "Q9NYQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYQ3" } ] }, { "ec_number": "1.1.3.15", "activity": "", "evidence": [ { "id": "Q9NYQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYQ3" } ] } ] }, { "uniprot_ac": "Q9P0Z9", "gene_name": "PIPOX", "activity": [ { "ec_number": "1.5.3.1", "activity": "H2O + O2 + sarcosine = formaldehyde + glycine + H2O2.", "evidence": [ { "id": "Q9P0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0Z9" } ] }, { "ec_number": "1.5.3.1", "activity": "", "evidence": [ { "id": "Q9P0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0Z9" } ] }, { "ec_number": "1.5.3.7", "activity": "L-pipecolate + O2 = H(+) + H2O2 + L-1-piperideine-6-carboxylate.", "evidence": [ { "id": "Q9P0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0Z9" } ] }, { "ec_number": "1.5.3.7", "activity": "", "evidence": [ { "id": "Q9P0Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0Z9" } ] } ] }, { "uniprot_ac": "Q9R0H0", "gene_name": "Acox1", "activity": [ { "ec_number": "1.3.3.6", "activity": "a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2.", "evidence": [ { "id": "Q9R0H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0H0" } ] }, { "ec_number": "1.3.3.6", "activity": "", "evidence": [ { "id": "Q9R0H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0H0" } ] } ] }, { "uniprot_ac": "Q9UHK6", "gene_name": "AMACR", "activity": [ { "ec_number": "5.1.99.4", "activity": "a (2S)-2-methylacyl-CoA = a (2R)-2-methylacyl-CoA.", "evidence": [ { "id": "Q9UHK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHK6" } ] }, { "ec_number": "5.1.99.4", "activity": "", "evidence": [ { "id": "Q9UHK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UHK6" } ] } ] }, { "uniprot_ac": "Q9UJ83", "gene_name": "HACL1", "activity": [ { "ec_number": "4.1.2.63", "activity": "2-hydroxy-3-methylhexadecanoyl-CoA = 2-methylpentadecanal + formyl-CoA.", "evidence": [ { "id": "Q9UJ83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJ83" } ] }, { "ec_number": "4.1.2.63", "activity": "", "evidence": [ { "id": "Q9UJ83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJ83" } ] } ] }, { "uniprot_ac": "Q9UJM8", "gene_name": "HAO1", "activity": [ { "ec_number": "1.1.3.15", "activity": "glycolate + O2 = glyoxylate + H2O2.", "evidence": [ { "id": "Q9UJM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJM8" } ] }, { "ec_number": "1.2.3.5", "activity": "glyoxylate + H2O + O2 = H(+) + H2O2 + oxalate.", "evidence": [ { "id": "Q9UJM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJM8" } ] }, { "ec_number": "1.1.3.15", "activity": "", "evidence": [ { "id": "Q9UJM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UJM8" } ] } ] }, { "uniprot_ac": "Q9UKG9", "gene_name": "CROT", "activity": [ { "ec_number": "2.3.1.137", "activity": "(R)-carnitine + octanoyl-CoA = CoA + O-octanoyl-(R)-carnitine.", "evidence": [ { "id": "Q9UKG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKG9" } ] }, { "ec_number": "2.3.1.137", "activity": "", "evidence": [ { "id": "Q9UKG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKG9" } ] } ] }, { "uniprot_ac": "Q9Y2Q3", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 281 ], "sequon_annotation_sites": [ { "start_pos": 447, "end_pos": 449 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 79 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }