{ "uniprot_canonical_ac": "O15197-1", "uniprot_ac": "O15197", "uniprot_id": "EPHB6_HUMAN", "mass": { "chemical_mass": 110700.0, "monoisotopic_mass": 110700.0 }, "refseq": { "ac": "NP_001267724", "name": "ephrin type-B receptor 6 isoform b", "summary": "This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" }, "gene_names": [ { "name": "EPHB6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15197", "id": "O15197" }, { "name": "EPHB6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724", "id": "NP_001267724" }, { "name": "HEP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724", "id": "NP_001267724" } ], "protein_names": [ { "name": "Ephrin type-B receptor 6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15197" }, { "name": "HEP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15197" }, { "name": "Tyrosine-protein kinase-defective receptor EPH-6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15197" }, { "name": "ephrin type-B receptor 6 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724", "id": "NP_001267724" }, { "name": "ephrin type-B receptor 6; tyrosine-protein kinase-defective receptor EPH-6; human kinase-defective Eph-family receptor protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724", "id": "NP_001267724" } ], "function": [ { "annotation": "EphB6 deficiency in intestinal neurons promotes tumor growth in colorectal cancer by neurotransmitter GABA signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" }, { "database": "PubMed", "id": "37294054", "url": "https://glygen.org/publication/PubMed/37294054" } ] }, { "annotation": "Kinase-defective receptor for members of the ephrin-B family. Binds to ephrin-B1 and ephrin-B2. Modulates cell adhesion and migration by exerting both positive and negative effects upon stimulation with ephrin-B2. Inhibits JNK activation, T-cell receptor-induced IL-2 secretion and CD25 expression upon stimulation with ephrin-B2.", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197#function" }, { "database": "PubMed", "id": "15955811", "url": "https://glygen.org/publication/PubMed/15955811" }, { "database": "PubMed", "id": "12517763", "url": "https://glygen.org/publication/PubMed/12517763" } ] }, { "annotation": "Structure of the EphB6 receptor ectodomain. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" }, { "database": "PubMed", "id": "33770085", "url": "https://glygen.org/publication/PubMed/33770085" } ] }, { "annotation": "The gut microbiota regulates autism-like behavior by mediating vitamin B6 homeostasis in EphB6-deficient mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" }, { "database": "PubMed", "id": "32819434", "url": "https://glygen.org/publication/PubMed/32819434" } ] }, { "annotation": "This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "76.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "71.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "84.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "86.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "70.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "62.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "82.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "61.53", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "65.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "77.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15197", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15197" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "common_name": "Human" } ], "gene": [ { "name": "EPHB6", "url": "https://www.uniprot.org/uniprot/O15197", "locus": { "chromosome": "7", "start_pos": 142871094, "end_pos": 142855061, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000106123", "url": "https://www.ensembl.org/id/ENSG00000106123" } ] } } ], "crossref": [ { "id": "ENSG00000106123", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000106123", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00063", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00063", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09555", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09555", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10475", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10475", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5836", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5836", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "EPHB6", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EPHB6", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2051", "url": "https://www.ncbi.nlm.nih.gov/gene/2051", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3396", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3396", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15197", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15197*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001090", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001090", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001245", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001245", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001426", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001426", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001660", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001660", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003961", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003961", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011641", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011641", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013761", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013761", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016257", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016257", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2051", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2051", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602757", "url": "http://www.omim.org/entry/602757", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15197", "url": "https://www.nextprot.org/entry/NX_O15197", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PQGPSCM", "url": "https://omabrowser.org/oma/group/PQGPSCM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1614410at2759", "url": "http://www.orthodb.org/?query=1614410at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46877", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46877", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46877:SF15", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46877:SF15", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7K7J", "url": "https://www.rcsb.org/structure/7K7J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00041", "url": "http://pfam.xfam.org/family/PF00041", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00536", "url": "http://pfam.xfam.org/family/PF00536", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01404", "url": "http://pfam.xfam.org/family/PF01404", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07647", "url": "http://pfam.xfam.org/family/PF07647", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07699", "url": "http://pfam.xfam.org/family/PF07699", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07714", "url": "http://pfam.xfam.org/family/PF07714", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14575", "url": "http://pfam.xfam.org/family/PF14575", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15197", "url": "https://pharos.nih.gov/targets/O15197", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15197", "url": "http://purl.obolibrary.org/obo/PR_O15197", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WTE3", "url": "https://www.uniprot.org/uniprot/A0A087WTE3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WTE3-1", "url": "https://www.uniprot.org/uniprot/A0A087WTE3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WYP8", "url": "https://www.uniprot.org/uniprot/A0A087WYP8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WYP8-1", "url": "https://www.uniprot.org/uniprot/A0A087WYP8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WZL4", "url": "https://www.uniprot.org/uniprot/A0A087WZL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WZL4-1", "url": "https://www.uniprot.org/uniprot/A0A087WZL4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JNC5", "url": "https://www.uniprot.org/uniprot/A0A0G2JNC5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JNC5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JNC5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JNH7", "url": "https://www.uniprot.org/uniprot/A0A0G2JNH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JNH7-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JNH7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YXG1", "url": "https://www.uniprot.org/uniprot/A0A0J9YXG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YXG1-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YXG1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCM8", "url": "https://www.uniprot.org/uniprot/F8WCM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCM8-1", "url": "https://www.uniprot.org/uniprot/F8WCM8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KQU5", "url": "https://www.uniprot.org/uniprot/J3KQU5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KQU5-1", "url": "https://www.uniprot.org/uniprot/J3KQU5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15197-1", "url": "https://www.uniprot.org/uniprot/O15197-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15197-2", "url": "https://www.uniprot.org/uniprot/O15197-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15197-3", "url": "https://www.uniprot.org/uniprot/O15197-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 1021, "header": "sp|O15197-1|EPHB6_HUMAN Isoform 1 of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4 CANONICAL=O15197-1" }, "isoforms": [ { "isoform_ac": "A0A087WTE3-1", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKRRRPVGLGGPPWWQLWAPVWLMQSQRRME", "length": 183, "header": "tr|A0A087WTE3-1|A0A087WTE3_HUMAN Computationally mapped isoform of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=1 CANONICAL=O15197-1" }, "locus": { "chromosome": "7", "start_pos": 142864620, "end_pos": 142863228, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000611578.4", "url": "https://www.ensembl.org/id/ENST00000611578.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000477807.1", "url": "https://www.ensembl.org/id/ENSP00000477807.1" } ] } }, { "isoform_ac": "A0A087WYP8-1", "url": "", "sequence": { "sequence": "GERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 112, "header": "tr|A0A087WYP8-1|A0A087WYP8_HUMAN Computationally mapped isoform of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=1 CANONICAL=O15197-1" }, "locus": { "chromosome": "7", "start_pos": 142870901, "end_pos": 142869931, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000476059.2", "url": "https://www.ensembl.org/id/ENST00000476059.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000481996.1", "url": "https://www.ensembl.org/id/ENSP00000481996.1" } ] } }, { "isoform_ac": "A0A087WZL4-1", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEVGRGECSGRPATPDSDL", "length": 50, "header": "tr|A0A087WZL4-1|A0A087WZL4_HUMAN Computationally mapped isoform of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=4 SV=1 CANONICAL=O15197-1" }, "locus": { "chromosome": "HSCHR7_2_CTG6", "start_pos": 887058, "end_pos": 886271, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000634148.1", "url": "https://www.ensembl.org/id/ENST00000634148.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487720.1", "url": "https://www.ensembl.org/id/ENSP00000487720.1" } ] } }, { "isoform_ac": "A0A0G2JNC5-1", "url": "", "sequence": { "sequence": "MVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 729, "header": "tr|A0A0G2JNC5-1|EPHB6_HUMAN Computationally mapped isoform of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=1 CANONICAL=O15197-1" }, "locus": { "chromosome": "HSCHR7_2_CTG6", "start_pos": 893944, "end_pos": 887723, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000615824.1", "url": "https://www.ensembl.org/id/ENST00000615824.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000481087.1", "url": "https://www.ensembl.org/id/ENSP00000481087.1" } ] } }, { "isoform_ac": "A0A0G2JNH7-1", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 1022, "header": "tr|A0A0G2JNH7-1|A0A0G2JNH7_HUMAN Computationally mapped isoform of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=1 CANONICAL=O15197-1" }, "locus": { "chromosome": "HSCHR7_2_CTG6", "start_pos": 893944, "end_pos": 886271, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000618483.4", "url": "https://www.ensembl.org/id/ENST00000618483.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000481418.1", "url": "https://www.ensembl.org/id/ENSP00000481418.1" } ] } }, { "isoform_ac": "A0A0J9YXG1-1", "url": "", "sequence": { "sequence": "FGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPGFQPLDWSATRTTSPSLASVPSVMWLSSA", "length": 118, "header": "tr|A0A0J9YXG1-1|A0A0J9YXG1_HUMAN Computationally mapped isoform of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=1 CANONICAL=O15197-1" }, "locus": { "chromosome": "HSCHR7_2_CTG6", "start_pos": 893724, "end_pos": 892941, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000632242.1", "url": "https://www.ensembl.org/id/ENST00000632242.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488389.1", "url": "https://www.ensembl.org/id/ENSP00000488389.1" } ] } }, { "isoform_ac": "F8WCM8-1", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKASAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 1022, "header": "tr|F8WCM8-1|F8WCM8_HUMAN Computationally mapped isoform of EPH receptor B6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=2 CANONICAL=O15197-1" }, "locus": { "chromosome": "7", "start_pos": 142870901, "end_pos": 142863228, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000422643.5", "url": "https://www.ensembl.org/id/ENST00000422643.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000404786.2", "url": "https://www.ensembl.org/id/ENSP00000404786.2" } ] } }, { "isoform_ac": "J3KQU5-1", "url": "", "sequence": { "sequence": "MVAVGGCRCQPGYQPARGDKACQACPRGLYKASAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 729, "header": "tr|J3KQU5-1|J3KQU5_HUMAN Computationally mapped isoform of EPH receptor B6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=2 CANONICAL=O15197-1" }, "locus": { "chromosome": "7", "start_pos": 142870901, "end_pos": 142864680, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000411471.6", "url": "https://www.ensembl.org/id/ENST00000411471.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000409061.3", "url": "https://www.ensembl.org/id/ENSP00000409061.3" } ] } }, { "isoform_ac": "O15197-1", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 1021, "header": "sp|O15197-1|EPHB6_HUMAN Isoform 1 of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4 CANONICAL=O15197-1" }, "locus": {} }, { "isoform_ac": "O15197-2", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV", "length": 744, "header": "sp|O15197-2|EPHB6_HUMAN Isoform 2 of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4 CANONICAL=O15197-1" }, "locus": {} }, { "isoform_ac": "O15197-3", "url": "", "sequence": { "sequence": "MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEGELFSLAFRIPCLRSFEPPSLLLISSLVHPCRPPLKADPAPRDSYPHNNFPFAL", "length": 540, "header": "sp|O15197-3|EPHB6_HUMAN Isoform 3 of Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4 CANONICAL=O15197-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 480, "start_aa": "Asn", "end_pos": 480, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn480", "evidence": [ { "id": "O15197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15197#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 645, "end_pos": 645, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "PRO", "id": "O15197", "url": "http://purl.obolibrary.org/obo/O15197" }, { "database": "iPTMnet", "id": "O15197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15197" } ], "site_lbl": "Tyr645" }, { "start_pos": 651, "end_pos": 651, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "PRO", "id": "O15197", "url": "http://purl.obolibrary.org/obo/O15197" }, { "database": "iPTMnet", "id": "O15197", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15197" } ], "site_lbl": "Tyr651" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Phosphorylation of non-muscle myosin II regulatory light chain by p21-activated kinase (gamma-PAK).", "journal": "Journal of muscle research and cell motility", "date": "1998", "authors": "Chew TL, Masaracchia RA, Goeckeler ZM, Wysolmerski RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "10047984", "url": "https://glygen.org/publication/PubMed/10047984" } ] }, { "title": "The interaction between N-WASP and the Arp2/3 complex links Cdc42-dependent signals to actin assembly.", "journal": "Cell", "date": "1999", "authors": "Rohatgi R, Ma L, Miki H, Lopez M, Kirchhausen T, Takenawa T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "10219243", "url": "https://glygen.org/publication/PubMed/10219243" } ] }, { "title": "Phosphorylation of tyrosine residues in the kinase domain and juxtamembrane region regulates the biological and catalytic activities of Eph receptors.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Binns KL, Taylor PP, Sicheri F, Pawson T, Holland SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "10848605", "url": "https://glygen.org/publication/PubMed/10848605" } ] }, { "title": "Mechanism of N-WASP activation by CDC42 and phosphatidylinositol 4, 5-bisphosphate.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Rohatgi R, Ho HY, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "10995436", "url": "https://glygen.org/publication/PubMed/10995436" } ] }, { "title": "Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "van Horck FP, Ahmadian MR, Haeusler LC, Moolenaar WH, Kranenburg O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "11058585", "url": "https://glygen.org/publication/PubMed/11058585" } ] }, { "title": "Temporal and spatial distribution of activated Pak1 in fibroblasts.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Sells MA, Pfaff A, Chernoff J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "11134074", "url": "https://glygen.org/publication/PubMed/11134074" } ] }, { "title": "Vav2 is required for cell spreading.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Marignani PA, Carpenter CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "11448999", "url": "https://glygen.org/publication/PubMed/11448999" } ] }, { "title": "The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.", "journal": "Nature", "date": "2001", "authors": "Cowan CA, Henkemeyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "11557983", "url": "https://glygen.org/publication/PubMed/11557983" } ] }, { "title": "EphB/syndecan-2 signaling in dendritic spine morphogenesis.", "journal": "Neuron", "date": "2001", "authors": "Ethell IM, Irie F, Kalo MS, Couchman JR, Pasquale EB, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "11580899", "url": "https://glygen.org/publication/PubMed/11580899" } ] }, { "title": "The kinase-null EphB6 receptor undergoes transphosphorylation in a complex with EphB1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Freywald A, Sharfe N, Roifman CM", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "11713248", "url": "https://glygen.org/publication/PubMed/11713248" } ] }, { "title": "Different WASP family proteins stimulate different Arp2/3 complex-dependent actin-nucleating activities.", "journal": "Current biology : CB", "date": "2001", "authors": "Zalevsky J, Lempert L, Kranitz H, Mullins RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "11747816", "url": "https://glygen.org/publication/PubMed/11747816" } ] }, { "title": "Crystal structure of an Eph receptor-ephrin complex.", "journal": "Nature", "date": "2001", "authors": "Himanen JP, Rajashankar KR, Lackmann M, Cowan CA, Henkemeyer M, Nikolov DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "11780069", "url": "https://glygen.org/publication/PubMed/11780069" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "EphrinB phosphorylation and reverse signaling: regulation by Src kinases and PTP-BL phosphatase.", "journal": "Molecular cell", "date": "2002", "authors": "Palmer A, Zimmer M, Erdmann KS, Eulenburg V, Porthin A, Heumann R, Deutsch U, Klein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "11983165", "url": "https://glygen.org/publication/PubMed/11983165" } ] }, { "title": "Interactions between Eph kinases and ephrins provide a mechanism to support platelet aggregation once cell-to-cell contact has occurred.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Prevost N, Woulfe D, Tanaka T, Brass LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "12084815", "url": "https://glygen.org/publication/PubMed/12084815" } ] }, { "title": "Eph signaling: a structural view.", "journal": "Trends in neurosciences", "date": "2003", "authors": "Himanen JP, Nikolov DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "12495863", "url": "https://glygen.org/publication/PubMed/12495863" } ] }, { "title": "The EphB6 receptor inhibits JNK activation in T lymphocytes and modulates T cell receptor-mediated responses.", "journal": "The Journal of biological chemistry", "date": "2003-03-21", "authors": "Freywald Andrew, Sharfe Nigel, Rashotte Cher, Grunberger Thomas, Roifman Chaim M", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "12517763", "url": "https://glygen.org/publication/PubMed/12517763" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "Biology of the p21-activated kinases.", "journal": "Annual review of biochemistry", "date": "2003", "authors": "Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "12676796", "url": "https://glygen.org/publication/PubMed/12676796" } ] }, { "title": "Synapse formation is regulated by the signaling adaptor GIT1.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Zhang H, Webb DJ, Asmussen H, Horwitz AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "12695502", "url": "https://glygen.org/publication/PubMed/12695502" } ] }, { "title": "Direct interaction of focal adhesion kinase with p190RhoGEF.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhai J, Lin H, Nie Z, Wu J, Canete-Soler R, Schlaepfer WW, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "12702722", "url": "https://glygen.org/publication/PubMed/12702722" } ] }, { "title": "Rac-dependent trans-endocytosis of ephrinBs regulates Eph-ephrin contact repulsion.", "journal": "Nature cell biology", "date": "2003", "authors": "Marston DJ, Dickinson S, Nobes CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "12973357", "url": "https://glygen.org/publication/PubMed/12973357" } ] }, { "title": "Tiam1 mediates neurite outgrowth induced by ephrin-B1 and EphA2.", "journal": "The EMBO journal", "date": "2004", "authors": "Tanaka M, Ohashi R, Nakamura R, Shinmura K, Kamo T, Sakai R, Sugimura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "14988728", "url": "https://glygen.org/publication/PubMed/14988728" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "Reverse endocytosis of transmembrane ephrin-B ligands via a clathrin-mediated pathway.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Parker M, Roberts R, Enriquez M, Zhao X, Takahashi T, Pat Cerretti D, Daniel T, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "15351694", "url": "https://glygen.org/publication/PubMed/15351694" } ] }, { "title": "Control of axonal branching and synapse formation by focal adhesion kinase.", "journal": "Nature neuroscience", "date": "2004", "authors": "Rico B, Beggs HE, Schahin-Reed D, Kimes N, Schmidt A, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "15378065", "url": "https://glygen.org/publication/PubMed/15378065" } ] }, { "title": "PAK and other Rho-associated kinases--effectors with surprisingly diverse mechanisms of regulation.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zhao ZS, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "15548136", "url": "https://glygen.org/publication/PubMed/15548136" } ] }, { "title": "The Rac1-GEF Tiam1 couples the NMDA receptor to the activity-dependent development of dendritic arbors and spines.", "journal": "Neuron", "date": "2005", "authors": "Tolias KF, Bikoff JB, Burette A, Paradis S, Harrar D, Tavazoie S, Weinberg RJ, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "15721239", "url": "https://glygen.org/publication/PubMed/15721239" } ] }, { "title": "A GIT1/PIX/Rac/PAK signaling module regulates spine morphogenesis and synapse formation through MLC.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Zhang H, Webb DJ, Asmussen H, Niu S, Horwitz AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "15800193", "url": "https://glygen.org/publication/PubMed/15800193" } ] }, { "title": "Vav family GEFs link activated Ephs to endocytosis and axon guidance.", "journal": "Neuron", "date": "2005", "authors": "Cowan CW, Shao YR, Sahin M, Shamah SM, Lin MZ, Greer PL, Gao S, Griffith EC, Brugge JS, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "15848800", "url": "https://glygen.org/publication/PubMed/15848800" } ] }, { "title": "Biphasic functions of the kinase-defective Ephb6 receptor in cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Matsuoka H, Obama H, Kelly ML, Matsui T, Nakamoto M", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "15955811", "url": "https://glygen.org/publication/PubMed/15955811" } ] }, { "title": "EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Moeller ML, Shi Y, Reichardt LF, Ethell IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "16298995", "url": "https://glygen.org/publication/PubMed/16298995" } ] }, { "title": "Metalloproteinase/Presenilin1 processing of ephrinB regulates EphB-induced Src phosphorylation and signaling.", "journal": "The EMBO journal", "date": "2006", "authors": "Georgakopoulos A, Litterst C, Ghersi E, Baki L, Xu C, Serban G, Robakis NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "16511561", "url": "https://glygen.org/publication/PubMed/16511561" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "Grb4 and GIT1 transduce ephrinB reverse signals modulating spine morphogenesis and synapse formation.", "journal": "Nature neuroscience", "date": "2007", "authors": "Segura I, Essmann CL, Weinges S, Acker-Palmer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "17310244", "url": "https://glygen.org/publication/PubMed/17310244" } ] }, { "title": "Kinetic analysis of the binding of monomeric and dimeric ephrins to Eph receptors: correlation to function in a growth cone collapse assay.", "journal": "Protein science : a publication of the Protein Society", "date": "2007", "authors": "Pabbisetty KB, Yue X, Li C, Himanen JP, Zhou R, Nikolov DB, Hu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "17322526", "url": "https://glygen.org/publication/PubMed/17322526" } ] }, { "title": "Patterns of somatic mutation in human cancer genomes.", "journal": "Nature", "date": "2007", "authors": "Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "17344846", "url": "https://glygen.org/publication/PubMed/17344846" } ] }, { "title": "Ligand binding and calcium influx induce distinct ectodomain/gamma-secretase-processing pathways of EphB2 receptor.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Litterst C, Georgakopoulos A, Shioi J, Ghersi E, Wisniewski T, Wang R, Ludwig A, Robakis NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "17428795", "url": "https://glygen.org/publication/PubMed/17428795" } ] }, { "title": "The Rac1 guanine nucleotide exchange factor Tiam1 mediates EphB receptor-dependent dendritic spine development.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Tolias KF, Bikoff JB, Kane CG, Tolias CS, Hu L, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "17440041", "url": "https://glygen.org/publication/PubMed/17440041" } ] }, { "title": "Syndecan-2 induces filopodia and dendritic spine formation via the neurofibromin-PKA-Ena/VASP pathway.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Lin YL, Lei YT, Hong CJ, Hsueh YP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "17548511", "url": "https://glygen.org/publication/PubMed/17548511" } ] }, { "title": "Cell-cell signaling via Eph receptors and ephrins.", "journal": "Current opinion in cell biology", "date": "2007", "authors": "Himanen JP, Saha N, Nikolov DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "17928214", "url": "https://glygen.org/publication/PubMed/17928214" } ] }, { "title": "Identification of EphB6 variant-derived epitope peptides recognized by cytotoxic T-lymphocytes from HLA-A24+ malignant glioma patients.", "journal": "Oncol. Rep.", "date": "2008", "authors": "Jin Mingyue, Komohara Yoshihiro, Shichijo Shigeki, Harada Mamoru, Yamanaka Ryuya, Miyamoto Shigeaki, Nikawa Junichi, Itoh Kyogo, Yamada Akira", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "18425388", "url": "https://glygen.org/publication/PubMed/18425388" } ] }, { "title": "Ephrin-B2-induced cleavage of EphB2 receptor is mediated by matrix metalloproteinases to trigger cell repulsion.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lin KT, Sloniowski S, Ethell DW, Ethell IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "18713744", "url": "https://glygen.org/publication/PubMed/18713744" } ] }, { "title": "Erythropoietin-producing hepatocyte B6 variant-derived peptides with the ability to induce glioma-reactive cytotoxic T lymphocytes in human leukocyte antigen-A2+ glioma patients.", "journal": "Cancer Sci.", "date": "2008", "authors": "Jin Mingyue, Komohara Yoshihiro, Shichijo Shigeki, Yamanaka Ryuya, Nikawa Junichi, Itoh Kyogo, Yamada Akira", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "18754880", "url": "https://glygen.org/publication/PubMed/18754880" } ] }, { "title": "EphB6 receptor significantly alters invasiveness and other phenotypic characteristics of human breast carcinoma cells.", "journal": "Oncogene", "date": "2009", "authors": "Fox B P, Kandpal R P", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "19234485", "url": "https://glygen.org/publication/PubMed/19234485" } ] }, { "title": "Ligand recognition by A-class Eph receptors: crystal structures of the EphA2 ligand-binding domain and the EphA2/ephrin-A1 complex.", "journal": "EMBO reports", "date": "2009", "authors": "Himanen JP, Goldgur Y, Miao H, Myshkin E, Guo H, Buck M, Nguyen M, Rajashankar KR, Wang B, Nikolov DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "19525919", "url": "https://glygen.org/publication/PubMed/19525919" } ] }, { "title": "Focal adhesion kinase acts downstream of EphB receptors to maintain mature dendritic spines by regulating cofilin activity.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Shi Y, Pontrello CG, DeFea KA, Reichardt LF, Ethell IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "19553453", "url": "https://glygen.org/publication/PubMed/19553453" } ] }, { "title": "Ephrin-B1 and ephrin-B2 mediate EphB-dependent presynaptic development via syntenin-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "McClelland AC, Sheffler-Collins SI, Kayser MS, Dalva MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "19915143", "url": "https://glygen.org/publication/PubMed/19915143" } ] }, { "title": "EphA8-ephrinA5 signaling and clathrin-mediated endocytosis is regulated by Tiam-1, a Rac-specific guanine nucleotide exchange factor.", "journal": "Molecules and cells", "date": "2010", "authors": "Yoo S, Shin J, Park S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665" } ], "reference": [ { "type": "PubMed", "id": "20496116", "url": "https://glygen.org/publication/PubMed/20496116" } ] }, { "title": "Suppression of c-ras transformation by GTPase-activating protein.", "journal": "Nature", "date": "1990", "authors": "Zhang K, DeClue JE, Vass WC, Papageorge AG, McCormick F, Lowy DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "2201922", "url": "https://glygen.org/publication/PubMed/2201922" } ] }, { "title": "The gut microbiota regulates autism-like behavior by mediating vitamin B6 homeostasis in EphB6-deficient mice.", "journal": "Microbiome", "date": "2020", "authors": "Li Y, Luo ZY, Hu YY, Bi YW, Yang JM, Zou WJ, Song YL, Li S, Shen T, Li SJ, Huang L, Zhou AJ, Gao TM, Li JM", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" } ], "reference": [ { "type": "PubMed", "id": "32819434", "url": "https://glygen.org/publication/PubMed/32819434" } ] }, { "title": "Structure of the EphB6 receptor ectodomain.", "journal": "PloS one", "date": "2021", "authors": "Mason EO, Goldgur Y, Robev D, Freywald A, Nikolov DB, Himanen JP", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" } ], "reference": [ { "type": "PubMed", "id": "33770085", "url": "https://glygen.org/publication/PubMed/33770085" } ] }, { "title": "EphB6 deficiency in intestinal neurons promotes tumor growth in colorectal cancer by neurotransmitter GABA signaling.", "journal": "Carcinogenesis", "date": "2023-12-02", "authors": "Yu Hao, Qin Xiao-Kang, Yin Kai-Wen, Li Zi-Ming, Ni En-De, Yang Jian-Ming, Liu Xun-Hua, Zhou Ai-Jun, Li Shu-Ji, Gao Tian-Ming, Li Ying, Li Jian-Ming", "evidence": [ { "database": "RefSeq", "id": "NP_001267724", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001267724" } ], "reference": [ { "type": "PubMed", "id": "37294054", "url": "https://glygen.org/publication/PubMed/37294054" } ] }, { "title": "Regulation of the Ras signaling pathway by GTPase-activating protein in PC12 cells.", "journal": "Oncogene", "date": "1995", "authors": "Yao R, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928662", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662" } ], "reference": [ { "type": "PubMed", "id": "7478585", "url": "https://glygen.org/publication/PubMed/7478585" } ] }, { "title": "Expression of a kinase-defective Eph-like receptor in the normal human brain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Matsuoka H, Iwata N, Ito M, Shimoyama M, Nagata A, Chihara K, Takai S, Matsui T", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "reference": [ { "type": "PubMed", "id": "9207182", "url": "https://glygen.org/publication/PubMed/9207182" } ] }, { "title": "Eph receptors discriminate specific ligand oligomers to determine alternative signaling complexes, attachment, and assembly responses.", "journal": "Genes & development", "date": "1998", "authors": "Stein E, Lane AA, Cerretti DP, Schoecklmann HO, Schroff AD, Van Etten RL, Daniel TO", "evidence": [ { "database": "Reactome", "id": "R-HSA-2682334", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334" } ], "reference": [ { "type": "PubMed", "id": "9499402", "url": "https://glygen.org/publication/PubMed/9499402" } ] } ], "pathway": [ { "id": "hsa:2051", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2051", "resource": "KEGG Pathway" }, { "id": "R-HSA-2682334", "name": "EPH-Ephrin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2682334", "resource": "Reactome", "description": "EPH-Ephrin signaling" }, { "id": "R-HSA-3928662", "name": "EPHB-mediated forward signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928662", "resource": "Reactome", "description": "EPHB-mediated forward signaling" }, { "id": "R-HSA-3928664", "name": "Ephrin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664", "resource": "Reactome", "description": "Ephrin signaling" }, { "id": "R-HSA-3928665", "name": "EPH-ephrin mediated repulsion of cells", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928665", "resource": "Reactome", "description": "EPH-ephrin mediated repulsion of cells" } ], "orthologs": [ { "uniprot_canonical_ac": "O08644-1", "protein_name": "Ephrin type-B receptor 6", "gene_name": "Ephb6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATEGTTGSGSRVVAGMVCSLWLLVLGSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGLPPGSGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQADEPDGPDSIAAWHLKRWTKVDTIAADESFPASSSSSSWAVGPHRTGQRVGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCPSVLRAFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGRWMVAVGGCRCQPGHQPARGDKLCQACPEGSYKALAGNVPCSPCPARSHSPDPAAPVCPCLQGFYRASSDPPEAPCTGPPSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECGGHGEPSSGGMCRRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVMHQVSRAANSITVSWPQPEQTNGNILDYQLRYYDQAEDESHSFTMTSETNTATVTRLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPEKLSLVIGSILGALAFLLLAAITVLAVIFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYDDPCQAIRELAREVDPTYIKIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLKMTFLGRAALLGQFQHPNILRLEGVVTKSRPVMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRALSARSVLVNSHLVCKVARLGHSPQGSSSLLRWAAPEVITHGKYTTSSDVWSFGILMWEVMSYGERPYWDMNEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAEGGSGDRPSQALLNPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLSTFSDVAQLSLEDLPGLGITLAGHQKKLLHNIQLLQQHLRQPGSVEV", "length": 1014 }, "evidence": [ { "id": "45931735", "url": "http://www.informatics.jax.org/homology/45931735", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P0C0K7-1", "protein_name": "Ephrin type-B receptor 6", "gene_name": "Ephb6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASENTAGSGSRVAGMVYSLWLLVLGPSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGLPPGSGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQADEPDSPDSISAWHLKRWTKVDTIAADESFPASSSSSSWAVGPHRTDQRVGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCPSVLRAFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGRWMVAVGGCRCQPGHQPARGDKLCQACPEGSYKALPGNVPCSPCPARSHSPDPAAPVCPCLQGFYRASSDPPEAPCTGPPSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECGGHKEPSSGGMCRRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVMHQVSRAANSITVSWPQPEQTNGNILDYQLRYYDQAEDESHSFTMTSETNTATVTRLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPEKLSLVIGSILGALAFLLLAAITVLAVIFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYDDPCQAIRELAREVDPTYIKIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLKMTFLGRAALLGQFQHPNILRLEGVVTRSRPVMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRALSARSVLVNSHLVCKVARLGHSPQGSSSLLRWAAPEVITHGKYTTSSDVWSFGILMWEVMSYGERPYWDMSDQEVLNAIEQEFRLPPPPGCPTGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAEGSSGDRPSQALLNPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLSTFSDVAQLSLEDLPGLGITLAGHQKKLLHNIQLLQQHLRQPGSVEV", "length": 1013 }, "evidence": [ { "id": "45931735", "url": "http://www.informatics.jax.org/homology/45931735", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "ephrin receptor activity", "id": "GO:0005003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005003", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "protein kinase activity", "id": "GO:0004672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004672", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "transmembrane-ephrin receptor activity", "id": "GO:0005005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005005", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "activated T cell proliferation", "id": "GO:0050798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050798", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "type IV hypersensitivity", "id": "GO:0001806", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001806", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "positive regulation of T cell costimulation", "id": "GO:2000525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000525", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "ephrin receptor signaling pathway", "id": "GO:0048013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048013", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" }, { "name": "axon guidance", "id": "GO:0007411", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007411", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 480, "end_pos": 482, "annotation": "n_glycosylation_sequon" }, { "start_pos": 968, "end_pos": 970, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ligand-binding increases phosphorylation on tyrosine residues. Phosphorylation on tyrosine residues is mediated by transphosphorylation by the catalytically active EPHB1 in a ligand-independent manner. Tyrosine phosphorylation of the receptor may act as a switch on the functional transition from cell adhesion/attraction to de-adhesion/repulsion.", "evidence": [ { "database": "UniProtKB", "id": "O15197", "url": "https://www.uniprot.org/uniprot/O15197" }, { "database": "PubMed", "id": "15955811", "url": "https://glygen.org/publication/PubMed/15955811" }, { "database": "PubMed", "id": "11713248", "url": "https://glygen.org/publication/PubMed/11713248" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 480 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 645, 651 ], "sequon_annotation_sites": [ { "start_pos": 480, "end_pos": 482 }, { "start_pos": 968, "end_pos": 970 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }