{ "uniprot_canonical_ac": "O15151-1", "uniprot_ac": "O15151", "uniprot_id": "MDM4_HUMAN", "mass": { "chemical_mass": 54864.0, "monoisotopic_mass": 54864.0 }, "refseq": { "ac": "NP_001265447", "name": "protein Mdm4 isoform 6", "summary": "This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Feb 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" }, "gene_names": [ { "name": "MDM4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15151", "id": "O15151" }, { "name": "BMFS6; HDMX; MDMX; MRP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447", "id": "NP_001265447" }, { "name": "DKFZp781B1423", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15151", "id": "O15151" }, { "name": "MDM4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447", "id": "NP_001265447" }, { "name": "MDMX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15151", "id": "O15151" } ], "protein_names": [ { "name": "Protein Mdm4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15151" }, { "name": "Double minute 4 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15151" }, { "name": "Mdm2-like p53-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15151" }, { "name": "Protein Mdmx", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15151" }, { "name": "double minute 4, human homolog of; p53-binding protein; MDM4-related protein 1; MDM4, p53 regulator; protein Mdmx; mdm2-like p53-binding protein; Mdm4 p53 binding protein homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447", "id": "NP_001265447" }, { "name": "p53-binding protein Mdm4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15151" }, { "name": "protein Mdm4 isoform 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447", "id": "NP_001265447" } ], "function": [ { "annotation": "Along with MDM2, contributes to TP53 regulation (PubMed:32300648). Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151#function" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "16511572", "url": "https://glygen.org/publication/PubMed/16511572" }, { "database": "PubMed", "id": "32300648", "url": "https://glygen.org/publication/PubMed/32300648" } ] }, { "annotation": "HDMX gene was amplified in 17% of soft tissue sarcoma patienets and gene amplification was associated with poor prognosis.", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" }, { "database": "PubMed", "id": "15906355", "url": "https://glygen.org/publication/PubMed/15906355" } ] }, { "annotation": "LINC01094 accelerates the metastasis of hepatocellular carcinoma via the miR-26b-3p/MDM4 axis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" }, { "database": "PubMed", "id": "37605571", "url": "https://glygen.org/publication/PubMed/37605571" } ] }, { "annotation": "Murine double minute X plays a central role in leukemic transformation and may be a promising target for leukemia prevention strategies. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" }, { "database": "PubMed", "id": "37086813", "url": "https://glygen.org/publication/PubMed/37086813" } ] }, { "annotation": "Reduced murine double minute 2 and 4 protein, but not messenger RNA, expression is associated with more severe disease in myelodysplastic syndromes and acute myeloblastic leukaemia.", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" }, { "database": "PubMed", "id": "36546586", "url": "https://glygen.org/publication/PubMed/36546586" } ] }, { "annotation": "This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Feb 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" } ] } ], "disease": [ { "disease_id": "MONDO:0030015", "recommended_name": { "id": "MONDO:0030015", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030015", "name": "bone marrow failure syndrome 6", "description": "" }, "synonyms": [ { "id": "MONDO:0030015", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030015", "name": "BMFS6", "description": "" }, { "id": "MONDO:0030015", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030015", "name": "BONE MARROW FAILURE SYNDROME 6", "description": "" }, { "id": "MONDO:0030015", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030015", "name": "bone marrow failure syndrome 6", "description": "" }, { "id": "MIM:618849", "resource": "MIM", "url": "https://www.omim.org/entry/618849", "name": "Bone marrow failure syndrome 6", "description": "Bone marrow failure syndrome 6" } ], "evidence": [ { "id": "618849", "database": "MIM", "url": "https://www.omim.org/entry/618849" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 437, "end_pos": 437, "sequence_org": "C", "sequence_mut": "G", "comment": "Fails to interact with MDM2.", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "PubMed", "id": "10608892", "url": "https://glygen.org/publication/PubMed/10608892" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "73.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "94.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "77.59", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "86.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "86.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "90.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "88.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "86.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "89.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15151", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15151" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "common_name": "Human" } ], "gene": [ { "name": "MDM4", "url": "https://www.uniprot.org/uniprot/O15151", "locus": { "chromosome": "1", "start_pos": 204558120, "end_pos": 204516379, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000198625", "url": "https://www.ensembl.org/id/ENSG00000198625" } ] } } ], "crossref": [ { "id": "ENSG00000198625", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198625", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16784", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16784", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd17673", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd17673", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1255126", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1255126", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MDM4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MDM4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4194", "url": "https://www.ncbi.nlm.nih.gov/gene/4194", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6974", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6974", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15151", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15151*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001876", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001876", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003121", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003121", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015458", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015458", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016495", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016495", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036443", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036443", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036885", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036885", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4194", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4194", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602704", "url": "http://www.omim.org/entry/602704", "database": "MIM", "categories": [ "Other" ] }, { "id": "618849", "url": "http://www.omim.org/entry/618849", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15151", "url": "https://www.nextprot.org/entry/NX_O15151", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "IPDCRRT", "url": "https://omabrowser.org/oma/group/IPDCRRT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2916169at2759", "url": "http://www.orthodb.org/?query=2916169at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12183", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12183", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12183:SF37", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12183:SF37", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46858", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46858", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46858:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46858:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2CR8", "url": "https://www.rcsb.org/structure/2CR8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MWY", "url": "https://www.rcsb.org/structure/2MWY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N06", "url": "https://www.rcsb.org/structure/2N06", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N0U", "url": "https://www.rcsb.org/structure/2N0U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N0W", "url": "https://www.rcsb.org/structure/2N0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N14", "url": "https://www.rcsb.org/structure/2N14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VJE", "url": "https://www.rcsb.org/structure/2VJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VJF", "url": "https://www.rcsb.org/structure/2VJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VYR", "url": "https://www.rcsb.org/structure/2VYR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DAB", "url": "https://www.rcsb.org/structure/3DAB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3EQY", "url": "https://www.rcsb.org/structure/3EQY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FDO", "url": "https://www.rcsb.org/structure/3FDO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FE7", "url": "https://www.rcsb.org/structure/3FE7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FEA", "url": "https://www.rcsb.org/structure/3FEA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JZO", "url": "https://www.rcsb.org/structure/3JZO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JZP", "url": "https://www.rcsb.org/structure/3JZP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JZQ", "url": "https://www.rcsb.org/structure/3JZQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LBJ", "url": "https://www.rcsb.org/structure/3LBJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MQR", "url": "https://www.rcsb.org/structure/3MQR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U15", "url": "https://www.rcsb.org/structure/3U15", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4RXZ", "url": "https://www.rcsb.org/structure/4RXZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MNJ", "url": "https://www.rcsb.org/structure/5MNJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UML", "url": "https://www.rcsb.org/structure/5UML", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VK1", "url": "https://www.rcsb.org/structure/5VK1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9Q", "url": "https://www.rcsb.org/structure/6Q9Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9S", "url": "https://www.rcsb.org/structure/6Q9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9U", "url": "https://www.rcsb.org/structure/6Q9U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9W", "url": "https://www.rcsb.org/structure/6Q9W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9Y", "url": "https://www.rcsb.org/structure/6Q9Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YR5", "url": "https://www.rcsb.org/structure/6YR5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YR7", "url": "https://www.rcsb.org/structure/6YR7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7C3Q", "url": "https://www.rcsb.org/structure/7C3Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7C3Y", "url": "https://www.rcsb.org/structure/7C3Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7C44", "url": "https://www.rcsb.org/structure/7C44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EL4", "url": "https://www.rcsb.org/structure/7EL4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KJN", "url": "https://www.rcsb.org/structure/7KJN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MLA", "url": "https://www.rcsb.org/structure/7MLA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HDG", "url": "https://www.rcsb.org/structure/8HDG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IA5", "url": "https://www.rcsb.org/structure/8IA5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00641", "url": "http://pfam.xfam.org/family/PF00641", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02201", "url": "http://pfam.xfam.org/family/PF02201", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13920", "url": "http://pfam.xfam.org/family/PF13920", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15151", "url": "https://pharos.nih.gov/targets/O15151", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15151", "url": "http://purl.obolibrary.org/obo/PR_O15151", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WTR9", "url": "https://www.uniprot.org/uniprot/A0A087WTR9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WTR9-1", "url": "https://www.uniprot.org/uniprot/A0A087WTR9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WUE3", "url": "https://www.uniprot.org/uniprot/A0A087WUE3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WUE3-1", "url": "https://www.uniprot.org/uniprot/A0A087WUE3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WZ58", "url": "https://www.uniprot.org/uniprot/A0A087WZ58", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WZ58-1", "url": "https://www.uniprot.org/uniprot/A0A087WZ58-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15151-1", "url": "https://www.uniprot.org/uniprot/O15151-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15151-2", "url": "https://www.uniprot.org/uniprot/O15151-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15151-3", "url": "https://www.uniprot.org/uniprot/O15151-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15151-4", "url": "https://www.uniprot.org/uniprot/O15151-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15151-5", "url": "https://www.uniprot.org/uniprot/O15151-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0Y2", "url": "https://www.uniprot.org/uniprot/Q5T0Y2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0Y2-1", "url": "https://www.uniprot.org/uniprot/Q5T0Y2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0Y3", "url": "https://www.uniprot.org/uniprot/Q5T0Y3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0Y3-1", "url": "https://www.uniprot.org/uniprot/Q5T0Y3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0Y4", "url": "https://www.uniprot.org/uniprot/Q5T0Y4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0Y4-1", "url": "https://www.uniprot.org/uniprot/Q5T0Y4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q68DC0", "url": "https://www.uniprot.org/uniprot/Q68DC0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q68DC0-1", "url": "https://www.uniprot.org/uniprot/Q68DC0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA", "length": 490, "header": "sp|O15151-1|MDM4_HUMAN Isoform 1 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2 CANONICAL=O15151-1" }, "isoforms": [ { "isoform_ac": "A0A087WTR9-1", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA", "length": 267, "header": "tr|A0A087WTR9-1|MDM4_HUMAN Computationally mapped isoform of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549679, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000612738.4", "url": "https://www.ensembl.org/id/ENST00000612738.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000478080.1", "url": "https://www.ensembl.org/id/ENSP00000478080.1" } ] } }, { "isoform_ac": "A0A087WUE3-1", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTGD", "length": 116, "header": "tr|A0A087WUE3-1|MDM4_HUMAN Computationally mapped isoform of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204546801, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000616250.4", "url": "https://www.ensembl.org/id/ENST00000616250.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000478581.1", "url": "https://www.ensembl.org/id/ENSP00000478581.1" } ] } }, { "isoform_ac": "A0A087WZ58-1", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA", "length": 392, "header": "tr|A0A087WZ58-1|A0A087WZ58_HUMAN Computationally mapped isoform of MDM4 regulator of p53 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549679, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000614459.4", "url": "https://www.ensembl.org/id/ENST00000614459.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000482388.1", "url": "https://www.ensembl.org/id/ENSP00000482388.1" } ] } }, { "isoform_ac": "O15151-1", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA", "length": 490, "header": "sp|O15151-1|MDM4_HUMAN Isoform 1 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549679, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367182.8", "url": "https://www.ensembl.org/id/ENST00000367182.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000356150.3", "url": "https://www.ensembl.org/id/ENSP00000356150.3" } ] } }, { "isoform_ac": "O15151-2", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTSASNNTARCNRILQSQKKN", "length": 127, "header": "sp|O15151-2|MDM4_HUMAN Isoform 2 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2 CANONICAL=O15151-1" }, "locus": {} }, { "isoform_ac": "O15151-3", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTSASNNTDAAQTLALAQDHT", "length": 127, "header": "sp|O15151-3|MDM4_HUMAN Isoform 3 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2 CANONICAL=O15151-1" }, "locus": {} }, { "isoform_ac": "O15151-4", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA", "length": 164, "header": "sp|O15151-4|MDM4_HUMAN Isoform 4 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549679, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367183.7", "url": "https://www.ensembl.org/id/ENST00000367183.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000356151.3", "url": "https://www.ensembl.org/id/ENSP00000356151.3" } ] } }, { "isoform_ac": "O15151-5", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA", "length": 440, "header": "sp|O15151-5|MDM4_HUMAN Isoform 5 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549679, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000454264.6", "url": "https://www.ensembl.org/id/ENST00000454264.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000396840.2", "url": "https://www.ensembl.org/id/ENSP00000396840.2" } ] } }, { "isoform_ac": "Q5T0Y2-1", "url": "", "sequence": { "sequence": "MPNFVVDWRVYTDSLFLTVDFGLCAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRK", "length": 213, "header": "tr|Q5T0Y2-1|MDM4_HUMAN Computationally mapped isoform of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549193, "end_pos": 204537914, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367179.7", "url": "https://www.ensembl.org/id/ENST00000367179.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000356147.3", "url": "https://www.ensembl.org/id/ENSP00000356147.3" } ] } }, { "isoform_ac": "Q5T0Y3-1", "url": "", "sequence": { "sequence": "DLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVE", "length": 171, "header": "tr|Q5T0Y3-1|MDM4_HUMAN Computationally mapped isoform of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204549388, "end_pos": 204542789, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000444261.1", "url": "https://www.ensembl.org/id/ENST00000444261.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000395254.1", "url": "https://www.ensembl.org/id/ENSP00000395254.1" } ] } }, { "isoform_ac": "Q5T0Y4-1", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTEMGHLFCRISHALELAD", "length": 131, "header": "tr|Q5T0Y4-1|MDM4_HUMAN Computationally mapped isoform of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204532819, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367180.5", "url": "https://www.ensembl.org/id/ENST00000367180.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000356148.1", "url": "https://www.ensembl.org/id/ENSP00000356148.1" } ] } }, { "isoform_ac": "Q68DC0-1", "url": "", "sequence": { "sequence": "MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTAKCRGKFHFQKKNYRRRYPHTAYLRA", "length": 140, "header": "tr|Q68DC0-1|MDM4_HUMAN Computationally mapped isoform of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1 CANONICAL=O15151-1" }, "locus": { "chromosome": "1", "start_pos": 204538285, "end_pos": 204525519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000507825.3", "url": "https://www.ensembl.org/id/ENST00000507825.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000443816.2", "url": "https://www.ensembl.org/id/ENSP00000443816.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 119, "end_pos": 119, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr119" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" } ], "site_lbl": "Ser161" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "P48729-1", "kinase_gene_name": "CSNK1A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16024788", "url": "https://glygen.org/publication/PubMed/16024788" }, { "database": "PubMed", "id": "23028042", "url": "https://glygen.org/publication/PubMed/23028042" } ], "site_lbl": "Ser289" }, { "start_pos": 314, "end_pos": 314, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "27777309", "url": "https://glygen.org/publication/PubMed/27777309" } ], "site_lbl": "Ser314" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "O14757-1", "kinase_gene_name": "CHEK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" } ], "site_lbl": "Ser342" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "O96017-1", "kinase_gene_name": "CHEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" } ], "site_lbl": "Ser342" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "16511560", "url": "https://glygen.org/publication/PubMed/16511560" } ], "site_lbl": "Ser342" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "P54646-1", "kinase_gene_name": "PRKAA2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "24190973", "url": "https://glygen.org/publication/PubMed/24190973" } ], "site_lbl": "Ser342" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16943424", "url": "https://glygen.org/publication/PubMed/16943424" } ], "site_lbl": "Ser342" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CHEK2", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "PRO", "id": "O15151", "url": "http://purl.obolibrary.org/obo/O15151" }, { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "19808970", "url": "https://glygen.org/publication/PubMed/19808970" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser342" }, { "start_pos": 365, "end_pos": 365, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "15788536", "url": "https://glygen.org/publication/PubMed/15788536" } ], "site_lbl": "Thr365" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "O14757-1", "kinase_gene_name": "CHEK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "17110929", "url": "https://glygen.org/publication/PubMed/17110929" }, { "database": "PubMed", "id": "16511572", "url": "https://glygen.org/publication/PubMed/16511572" }, { "database": "PubMed", "id": "18356162", "url": "https://glygen.org/publication/PubMed/18356162" } ], "site_lbl": "Ser367" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "O96017-1", "kinase_gene_name": "CHEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "16511560", "url": "https://glygen.org/publication/PubMed/16511560" }, { "database": "PubMed", "id": "18356162", "url": "https://glygen.org/publication/PubMed/18356162" } ], "site_lbl": "Ser367" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "18356162", "url": "https://glygen.org/publication/PubMed/18356162" } ], "site_lbl": "Ser367" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16943424", "url": "https://glygen.org/publication/PubMed/16943424" } ], "site_lbl": "Ser367" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CHEK1 and CHEK2", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16511572", "url": "https://glygen.org/publication/PubMed/16511572" }, { "database": "IntAct", "id": "O15151", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15151*" }, { "database": "PubMed", "id": "16511560", "url": "https://glygen.org/publication/PubMed/16511560" }, { "database": "PRO", "id": "O15151", "url": "http://purl.obolibrary.org/obo/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "16227609", "url": "https://glygen.org/publication/PubMed/16227609" }, { "database": "PubMed", "id": "18356162", "url": "https://glygen.org/publication/PubMed/18356162" }, { "database": "PubMed", "id": "19808970", "url": "https://glygen.org/publication/PubMed/19808970" }, { "database": "PubMed", "id": "22120712", "url": "https://glygen.org/publication/PubMed/22120712" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser367" }, { "start_pos": 391, "end_pos": 391, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "16511560", "url": "https://glygen.org/publication/PubMed/16511560" } ], "site_lbl": "Ser391" }, { "start_pos": 403, "end_pos": 403, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "15788536", "url": "https://glygen.org/publication/PubMed/15788536" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "16511560", "url": "https://glygen.org/publication/PubMed/16511560" }, { "database": "PubMed", "id": "16943424", "url": "https://glygen.org/publication/PubMed/16943424" } ], "site_lbl": "Ser403" }, { "start_pos": 403, "end_pos": 403, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O15151", "url": "http://purl.obolibrary.org/obo/O15151" }, { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" } ], "site_lbl": "Ser403" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "15735705", "url": "https://glygen.org/publication/PubMed/15735705" } ], "site_lbl": "Ser96" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "15735705", "url": "https://glygen.org/publication/PubMed/15735705" } ], "site_lbl": "Ser96" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" }, { "database": "PubMed", "id": "26148237", "url": "https://glygen.org/publication/PubMed/26148237" } ], "site_lbl": "Tyr99" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Oligomerization is required for p53 to be efficiently ubiquitinated by MDM2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10347217", "url": "https://glygen.org/publication/PubMed/10347217" } ] }, { "title": "p300/cAMP-responsive element-binding protein interactions with ets-1 and ets-2 in the transcriptional activation of the human stromelysin promoter.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Jayaraman G, Srinivas R, Duggan C, Ferreira E, Swaminathan S, Somasundaram K, Williams J, Hauser C, Kurkinen M, Dhar R, Weitzman S, Buttice G, Thimmapaya B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "10358095", "url": "https://glygen.org/publication/PubMed/10358095" } ] }, { "title": "The ataxia-telangiectasia related protein ATR mediates DNA-dependent phosphorylation of p53.", "journal": "Oncogene", "date": "1999", "authors": "Lakin ND, Hann BC, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10435622", "url": "https://glygen.org/publication/PubMed/10435622" } ] }, { "title": "Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases.", "journal": "Genomics", "date": "1999", "authors": "Baker RT, Wang XW, Woollatt E, White JA, Sutherland GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10444327", "url": "https://glygen.org/publication/PubMed/10444327" } ] }, { "title": "Regulation of cyclin-dependent kinase 5 catalytic activity by phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sharma P, Sharma M, Amin ND, Albers RW, Pant HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10500146", "url": "https://glygen.org/publication/PubMed/10500146" } ] }, { "title": "A novel cofactor for p300 that regulates the p53 response.", "journal": "Molecular cell", "date": "1999", "authors": "Shikama N, Lee CW, France S, Delavaine L, Lyon J, Krstic-Demonacos M, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "10518217", "url": "https://glygen.org/publication/PubMed/10518217" } ] }, { "title": "Phosphorylation of Ser-20 mediates stabilization of human p53 in response to DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Chehab NH, Malikzay A, Stavridi ES, Halazonetis TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10570149", "url": "https://glygen.org/publication/PubMed/10570149" } ] }, { "title": "Conversion of p35 to p25 deregulates Cdk5 activity and promotes neurodegeneration.", "journal": "Nature", "date": "1999", "authors": "Patrick GN, Zukerberg L, Nikolic M, de la Monte S, Dikkes P, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10604467", "url": "https://glygen.org/publication/PubMed/10604467" } ] }, { "title": "Stabilization of the MDM2 oncoprotein by interaction with the structurally related MDMX protein.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Sharp DA, Kratowicz SA, Sank MJ, George DL", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "10608892", "url": "https://glygen.org/publication/PubMed/10608892" } ] }, { "title": "Chk2/hCds1 functions as a DNA damage checkpoint in G(1) by stabilizing p53.", "journal": "Genes & development", "date": "2000", "authors": "Chehab NH, Malikzay A, Appel M, Halazonetis TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10673500", "url": "https://glygen.org/publication/PubMed/10673500" } ] }, { "title": "The human homologs of checkpoint kinases Chk1 and Cds1 (Chk2) phosphorylate p53 at multiple DNA damage-inducible sites.", "journal": "Genes & development", "date": "2000", "authors": "Shieh SY, Ahn J, Tamai K, Taya Y, Prives C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10673501", "url": "https://glygen.org/publication/PubMed/10673501" } ] }, { "title": "DNA damage-induced activation of p53 by the checkpoint kinase Chk2.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Hirao A, Kong YY, Matsuoka S, Wakeham A, Ruland J, Yoshida H, Liu D, Elledge SJ, Mak TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10710310", "url": "https://glygen.org/publication/PubMed/10710310" } ] }, { "title": "Mdm2 is a RING finger-dependent ubiquitin protein ligase for itself and p53.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Fang S, Jensen JP, Ludwig RL, Vousden KH, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10722742", "url": "https://glygen.org/publication/PubMed/10722742" } ] }, { "title": "Immunolocalization of human p14(ARF) to the granular component of the interphase nucleolus.", "journal": "Experimental cell research", "date": "2000", "authors": "Lindstrom MS, Klangby U, Inoue R, Pisa P, Wiman KG, Asker CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10772813", "url": "https://glygen.org/publication/PubMed/10772813" } ] }, { "title": "c-Jun inhibits transforming growth factor beta-mediated transcription by repressing Smad3 transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Dennler S, Prunier C, Ferrand N, Gauthier JM, Atfi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10871633", "url": "https://glygen.org/publication/PubMed/10871633" } ] }, { "title": "The C-terminal regulatory domain of p53 contains a functional docking site for cyclin A.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Luciani MG, Hutchins JR, Zheleva D, Hupp TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "10884347", "url": "https://glygen.org/publication/PubMed/10884347" } ] }, { "title": "An intact HDM2 RING-finger domain is required for nuclear exclusion of p53.", "journal": "Nature cell biology", "date": "2000", "authors": "Boyd SD, Tsai KY, Jacks T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "10980695", "url": "https://glygen.org/publication/PubMed/10980695" } ] }, { "title": "The MDM2 RING-finger domain is required to promote p53 nuclear export.", "journal": "Nature cell biology", "date": "2000", "authors": "Geyer RK, Yu ZK, Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "10980696", "url": "https://glygen.org/publication/PubMed/10980696" } ] }, { "title": "A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kato M, Miyazawa K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10982817", "url": "https://glygen.org/publication/PubMed/10982817" } ] }, { "title": "Opposing effects of Ets and Id proteins on p16INK4a expression during cellular senescence.", "journal": "Nature", "date": "2001", "authors": "Ohtani N, Zebedee Z, Huot TJ, Stinson JA, Sugimoto M, Ohashi Y, Sharrocks AD, Peters G, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "11234019", "url": "https://glygen.org/publication/PubMed/11234019" } ] }, { "title": "A DNA damage-induced p53 serine 392 kinase complex contains CK2, hSpt16, and SSRP1.", "journal": "Molecular cell", "date": "2001", "authors": "Keller DM, Zeng X, Wang Y, Zhang QH, Kapoor M, Shu H, Goodman R, Lozano G, Zhao Y, Lu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11239457", "url": "https://glygen.org/publication/PubMed/11239457" } ] }, { "title": "Cyclin a-CDK phosphorylation regulates MDM2 protein interactions.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zhang T, Prives C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "11359766", "url": "https://glygen.org/publication/PubMed/11359766" } ] }, { "title": "Reactive oxygen species-induced phosphorylation of p53 on serine 20 is mediated in part by polo-like kinase-3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Xie S, Wang Q, Wu H, Cogswell J, Lu L, Jhanwar-Uniyal M, Dai W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11447225", "url": "https://glygen.org/publication/PubMed/11447225" } ] }, { "title": "A phosphatidylinositol 3-kinase/Akt pathway promotes translocation of Mdm2 from the cytoplasm to the nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Mayo LD, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "11504915", "url": "https://glygen.org/publication/PubMed/11504915" } ] }, { "title": "A TPR motif cofactor contributes to p300 activity in the p53 response.", "journal": "Molecular cell", "date": "2001", "authors": "Demonacos C, Krstic-Demonacos M, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "11511361", "url": "https://glygen.org/publication/PubMed/11511361" } ] }, { "title": "p53DINP1, a p53-inducible gene, regulates p53-dependent apoptosis.", "journal": "Molecular cell", "date": "2001", "authors": "Okamura S, Arakawa H, Tanaka T, Nakanishi H, Ng CC, Taya Y, Monden M, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11511362", "url": "https://glygen.org/publication/PubMed/11511362" } ] }, { "title": "Cloning and characterization of a p53-related protein kinase expressed in interleukin-2-activated cytotoxic T-cells, epithelial tumor cell lines, and the testes.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Abe Y, Matsumoto S, Wei S, Nezu K, Miyoshi A, Kito K, Ueda N, Shigemoto K, Hitsumoto Y, Nikawa J, Enomoto Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11546806", "url": "https://glygen.org/publication/PubMed/11546806" } ] }, { "title": "Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Xie S, Wu H, Wang Q, Cogswell JP, Husain I, Conn C, Stambrook P, Jhanwar-Uniyal M, Dai W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11551930", "url": "https://glygen.org/publication/PubMed/11551930" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "A novel active site-directed probe specific for deubiquitylating enzymes reveals proteasome association of USP14.", "journal": "The EMBO journal", "date": "2001", "authors": "Borodovsky A, Kessler BM, Casagrande R, Overkleeft HS, Wilkinson KD, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11566882", "url": "https://glygen.org/publication/PubMed/11566882" } ] }, { "title": "Regulation of p53 activity by its interaction with homeodomain-interacting protein kinase-2.", "journal": "Nature cell biology", "date": "2002", "authors": "Hofmann TG, Moller A, Sirma H, Zentgraf H, Taya Y, Droge W, Will H, Schmitz ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11740489", "url": "https://glygen.org/publication/PubMed/11740489" } ] }, { "title": "Homeodomain-interacting protein kinase-2 phosphorylates p53 at Ser 46 and mediates apoptosis.", "journal": "Nature cell biology", "date": "2002", "authors": "D'Orazi G, Cecchinelli B, Bruno T, Manni I, Higashimoto Y, Saito S, Gostissa M, Coen S, Marchetti A, Del Sal G, Piaggio G, Fanciulli M, Appella E, Soddu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "11780126", "url": "https://glygen.org/publication/PubMed/11780126" } ] }, { "title": "An ERK2 docking site in the Pointed domain distinguishes a subset of ETS transcription factors.", "journal": "Genes & development", "date": "2002", "authors": "Seidel JJ, Graves BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "11782450", "url": "https://glygen.org/publication/PubMed/11782450" } ] }, { "title": "Cluster analysis of an extensive human breast cancer cell line protein expression map database.", "journal": "Proteomics", "date": "2002", "authors": "Harris RA, Yang A, Stein RC, Lucy K, Brusten L, Herath A, Parekh R, Waterfield MD, O'Hare MJ, Neville MA, Page MJ, Zvelebil MJ", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "reference": [ { "type": "PubMed", "id": "11840567", "url": "https://glygen.org/publication/PubMed/11840567" } ] }, { "title": "Transcriptional regulation of the human tumor suppressor p14(ARF) by E2F1, E2F2, E2F3, and Sp1-like factors.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Parisi T, Pollice A, Di Cristofano A, Calabro V, La Mantia G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "11883935", "url": "https://glygen.org/publication/PubMed/11883935" } ] }, { "title": "Deubiquitination of p53 by HAUSP is an important pathway for p53 stabilization.", "journal": "Nature", "date": "2002", "authors": "Li M, Chen D, Shiloh A, Luo J, Nikolaev AY, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "11923872", "url": "https://glygen.org/publication/PubMed/11923872" } ] }, { "title": "Cyclin G recruits PP2A to dephosphorylate Mdm2.", "journal": "Molecular cell", "date": "2002", "authors": "Okamoto K, Li H, Jensen MR, Zhang T, Taya Y, Thorgeirsson SS, Prives C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "11983168", "url": "https://glygen.org/publication/PubMed/11983168" } ] }, { "title": "Cdk5 phosphorylates p53 and regulates its activity.", "journal": "Journal of neurochemistry", "date": "2002", "authors": "Zhang J, Krishnamurthy PK, Johnson GV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "12064478", "url": "https://glygen.org/publication/PubMed/12064478" } ] }, { "title": "Molecular interpretation of ERK signal duration by immediate early gene products.", "journal": "Nature cell biology", "date": "2002", "authors": "Murphy LO, Smith S, Chen RH, Fingar DC, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ] }, { "title": "Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuura H, Nishitoh H, Takeda K, Matsuzawa A, Amagasa T, Ito M, Yoshioka K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12189133", "url": "https://glygen.org/publication/PubMed/12189133" } ] }, { "title": "Evidence of functional modulation of the MEKK/JNK/cJun signaling cascade by the low density lipoprotein receptor-related protein (LRP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lutz C, Nimpf J, Jenny M, Boecklinger K, Enzinger C, Utermann G, Baier-Bitterlich G, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12193592", "url": "https://glygen.org/publication/PubMed/12193592" } ] }, { "title": "p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Keller DM, Lu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "12393879", "url": "https://glygen.org/publication/PubMed/12393879" } ] }, { "title": "Acetylation of p53 inhibits its ubiquitination by Mdm2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li M, Luo J, Brooks CL, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12421820", "url": "https://glygen.org/publication/PubMed/12421820" } ] }, { "title": "Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.", "journal": "Genes & development", "date": "2002", "authors": "Kuzmichev A, Nishioka K, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12435631", "url": "https://glygen.org/publication/PubMed/12435631" } ] }, { "title": "Characterization of cells and gene-targeted mice deficient for the p53-binding kinase homeodomain-interacting protein kinase 1 (HIPK1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Kondo S, Lu Y, Debbas M, Lin AW, Sarosi I, Itie A, Wakeham A, Tuan J, Saris C, Elliott G, Ma W, Benchimol S, Lowe SW, Mak TW, Thukral SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "12702766", "url": "https://glygen.org/publication/PubMed/12702766" } ] }, { "title": "Identification of a domain within MDMX-S that is responsible for its high affinity interaction with p53 and high-level expression in mammalian cells.", "journal": "J. Cell. Biochem.", "date": "2003", "authors": "Rallapalli Ravikumar, Strachan Gordon, Tuan Rocky S, Hall David J", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "reference": [ { "type": "PubMed", "id": "12761890", "url": "https://glygen.org/publication/PubMed/12761890" } ] }, { "title": "Regulation of PRAK subcellular location by p38 MAP kinases.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "New L, Jiang Y, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12808055", "url": "https://glygen.org/publication/PubMed/12808055" } ] }, { "title": "TP53INP1s and homeodomain-interacting protein kinase-2 (HIPK2) are partners in regulating p53 activity.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tomasini R, Samir AA, Carrier A, Isnardon D, Cecchinelli B, Soddu S, Malissen B, Dagorn JC, Iovanna JL, Dusetti NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "12851404", "url": "https://glygen.org/publication/PubMed/12851404" } ] }, { "title": "Functional homology between yeast piD261/Bud32 and human PRPK: both phosphorylate p53 and PRPK partially complements piD261/Bud32 deficiency.", "journal": "FEBS letters", "date": "2003", "authors": "Facchin S, Lopreiato R, Ruzzene M, Marin O, Sartori G, Gotz C, Montenarh M, Carignani G, Pinna LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "12914926", "url": "https://glygen.org/publication/PubMed/12914926" } ] }, { "title": "CYLD is a deubiquitinating enzyme that negatively regulates NF-kappaB activation by TNFR family members.", "journal": "Nature", "date": "2003", "authors": "Trompouki E, Hatzivassiliou E, Tsichritzis T, Farmer H, Ashworth A, Mosialos G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917689", "url": "https://glygen.org/publication/PubMed/12917689" } ] }, { "title": "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination.", "journal": "Nature", "date": "2003", "authors": "Kovalenko A, Chable-Bessia C, Cantarella G, Israel A, Wallach D, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917691", "url": "https://glygen.org/publication/PubMed/12917691" } ] }, { "title": "Expression of the MAPK kinases MKK-4 and MKK-7 in rheumatoid arthritis and their role as key regulators of JNK.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Sundarrajan M, Boyle DL, Chabaud-Riou M, Hammaker D, Firestein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "13130464", "url": "https://glygen.org/publication/PubMed/13130464" } ] }, { "title": "HdmX stimulates Hdm2-mediated ubiquitination and degradation of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Linares LK, Hengstermann A, Ciechanover A, Muller S, Scheffner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "14507994", "url": "https://glygen.org/publication/PubMed/14507994" } ] }, { "title": "EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Bracken AP, Pasini D, Capra M, Prosperini E, Colli E, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14532106", "url": "https://glygen.org/publication/PubMed/14532106" } ] }, { "title": "Two isoforms of otubain 1 regulate T cell anergy via GRAIL.", "journal": "Nature immunology", "date": "2004", "authors": "Soares L, Seroogy C, Skrenta H, Anandasabapathy N, Lovelace P, Chung CD, Engleman E, Fathman CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "14661020", "url": "https://glygen.org/publication/PubMed/14661020" } ] }, { "title": "Phosphorylation by aurora kinase A induces Mdm2-mediated destabilization and inhibition of p53.", "journal": "Nature genetics", "date": "2004", "authors": "Katayama H, Sasai K, Kawai H, Yuan ZM, Bondaruk J, Suzuki F, Fujii S, Arlinghaus RB, Czerniak BA, Sen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "14702041", "url": "https://glygen.org/publication/PubMed/14702041" } ] }, { "title": "ERF nuclear shuttling, a continuous monitor of Erk activity that links it to cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Le Gallic L, Virgilio L, Cohen P, Biteau B, Mavrothalassitis G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "14729966", "url": "https://glygen.org/publication/PubMed/14729966" } ] }, { "title": "Phosphorylation on Thr-55 by TAF1 mediates degradation of p53: a role for TAF1 in cell G1 progression.", "journal": "Molecular cell", "date": "2004", "authors": "Li HH, Li AG, Sheppard HM, Liu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "15053879", "url": "https://glygen.org/publication/PubMed/15053879" } ] }, { "title": "A dynamic role of HAUSP in the p53-Mdm2 pathway.", "journal": "Molecular cell", "date": "2004", "authors": "Li M, Brooks CL, Kon N, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "15053880", "url": "https://glygen.org/publication/PubMed/15053880" } ] }, { "title": "Catalysis and function of the p38 alpha.MK2a signaling complex.", "journal": "Biochemistry", "date": "2004", "authors": "Lukas SM, Kroe RR, Wildeson J, Peet GW, Frego L, Davidson W, Ingraham RH, Pargellis CA, Labadia ME, Werneburg BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15287722", "url": "https://glygen.org/publication/PubMed/15287722" } ] }, { "title": "The mdm-2 oncogene product forms a complex with the p53 protein and inhibits p53-mediated transactivation.", "journal": "Cell", "date": "1992", "authors": "Momand J, Zambetti GP, Olson DC, George D, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "1535557", "url": "https://glygen.org/publication/PubMed/1535557" } ] }, { "title": "A new effector pathway links ATM kinase with the DNA damage response.", "journal": "Nature cell biology", "date": "2004", "authors": "Demonacos C, Krstic-Demonacos M, Smith L, Xu D, O'Connor DP, Jansson M, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "15448695", "url": "https://glygen.org/publication/PubMed/15448695" } ] }, { "title": "Regulation of p53 activity through lysine methylation.", "journal": "Nature", "date": "2004", "authors": "Chuikov S, Kurash JK, Wilson JR, Xiao B, Justin N, Ivanov GS, McKinney K, Tempst P, Prives C, Gamblin SJ, Barlev NA, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "15525938", "url": "https://glygen.org/publication/PubMed/15525938" } ] }, { "title": "MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Voncken JW, Niessen H, Neufeld B, Rennefahrt U, Dahlmans V, Kubben N, Holzer B, Ludwig S, Rapp UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15563468", "url": "https://glygen.org/publication/PubMed/15563468" } ] }, { "title": "Ras/mitogen-activated protein kinase signaling activates Ets-1 and Ets-2 by CBP/p300 recruitment.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Foulds CE, Nelson ML, Blaszczak AG, Graves BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "15572696", "url": "https://glygen.org/publication/PubMed/15572696" } ] }, { "title": "Phosphorylation of MdmX by CDK2/Cdc2(p34) is required for nuclear export of Mdm2.", "journal": "Oncogene", "date": "2005", "authors": "Elias B, Laine A, Ronai Z", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "15735705", "url": "https://glygen.org/publication/PubMed/15735705" } ] }, { "title": "Phosphorylation of Hdmx mediates its Hdm2- and ATM-dependent degradation in response to DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Pereg Y, Shkedy D, de Graaf P, Meulmeester E, Edelson-Averbukh M, Salek M, Biton S, Teunisse AF, Lehmann WD, Jochemsen AG, Shiloh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" }, { "database": "iPTMnet", "id": "O15151-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151-1" } ], "reference": [ { "type": "PubMed", "id": "15788536", "url": "https://glygen.org/publication/PubMed/15788536" } ] }, { "title": "AMP-activated protein kinase induces a p53-dependent metabolic checkpoint.", "journal": "Molecular cell", "date": "2005", "authors": "Jones RG, Plas DR, Kubek S, Buzzai M, Mu J, Xu Y, Birnbaum MJ, Thompson CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "15866171", "url": "https://glygen.org/publication/PubMed/15866171" } ] }, { "title": "Conserved docking site is essential for activation of mammalian MAP kinase kinases by specific MAP kinase kinase kinases.", "journal": "Molecular cell", "date": "2005", "authors": "Takekawa M, Tatebayashi K, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15866172", "url": "https://glygen.org/publication/PubMed/15866172" } ] }, { "title": "Significance of HDMX-S (or MDM4) mRNA splice variant overexpression and HDMX gene amplification on primary soft tissue sarcoma prognosis.", "journal": "International journal of cancer", "date": "2005", "authors": "Bartel F, Schulz J, Bohnke A, Blumke K, Kappler M, Bache M, Schmidt H, Wurl P, Taubert H, Hauptmann S", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" } ], "reference": [ { "type": "PubMed", "id": "15906355", "url": "https://glygen.org/publication/PubMed/15906355" } ] }, { "title": "Loss of HAUSP-mediated deubiquitination contributes to DNA damage-induced destabilization of Hdmx and Hdm2.", "journal": "Molecular cell", "date": "2005", "authors": "Meulmeester E, Maurice MM, Boutell C, Teunisse AF, Ovaa H, Abraham TE, Dirks RW, Jochemsen AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "15916963", "url": "https://glygen.org/publication/PubMed/15916963" } ] }, { "title": "Regulation of p53-MDMX interaction by casein kinase 1 alpha.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Chen L, Li C, Pan Y, Chen J", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "16024788", "url": "https://glygen.org/publication/PubMed/16024788" } ] }, { "title": "Amplification of a gene encoding a p53-associated protein in human sarcomas.", "journal": "Nature", "date": "1992", "authors": "Oliner JD, Kinzler KW, Meltzer PS, George DL, Vogelstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "1614537", "url": "https://glygen.org/publication/PubMed/1614537" } ] }, { "title": "ATM and Chk2-dependent phosphorylation of MDMX contribute to p53 activation after DNA damage.", "journal": "The EMBO journal", "date": "2005", "authors": "Chen L, Gilkes DM, Pan Y, Lane WS, Chen J", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" }, { "database": "iPTMnet", "id": "O15151-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151-1" } ], "reference": [ { "type": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Distinct E2F-mediated transcriptional program regulates p14ARF gene expression.", "journal": "The EMBO journal", "date": "2005", "authors": "Komori H, Enomoto M, Nakamura M, Iwanaga R, Ohtani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "16211008", "url": "https://glygen.org/publication/PubMed/16211008" } ] }, { "title": "Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.", "journal": "Cellular signalling", "date": "2006", "authors": "Tzimas C, Michailidou G, Arsenakis M, Kieff E, Mosialos G, Hatzivassiliou EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16214042", "url": "https://glygen.org/publication/PubMed/16214042" } ] }, { "title": "DNA damage-induced phosphorylation of MdmX at serine 367 activates p53 by targeting MdmX for Mdm2-dependent degradation.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Okamoto K, Kashima K, Pereg Y, Ishida M, Yamazaki S, Nota A, Teunisse A, Migliorini D, Kitabayashi I, Marine JC, Prives C, Shiloh Y, Jochemsen AG, Taya Y", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "16227609", "url": "https://glygen.org/publication/PubMed/16227609" } ] }, { "title": "Identification of an aberrantly spliced form of HDMX in human tumors: a new mechanism for HDM2 stabilization.", "journal": "Cancer Res.", "date": "2005", "authors": "Giglio Simona, Mancini Francesca, Gentiletti Francesca, Sparaco Giorgia, Felicioni Lara, Barassi Fabio, Martella Carla, Prodosmo Andrea, Iacovelli Stefano, Buttitta Fiamma, Farsetti Antonella, Soddu Silvia, Marchetti Antonio, Sacchi Ada, Pontecorvi Alfredo, Moretti Fabiola", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "reference": [ { "type": "PubMed", "id": "16266988", "url": "https://glygen.org/publication/PubMed/16266988" } ] }, { "title": "NIR is a novel INHAT repressor that modulates the transcriptional activity of p53.", "journal": "Genes & development", "date": "2005", "authors": "Hublitz P, Kunowska N, Mayer UP, Muller JM, Heyne K, Yin N, Fritzsche C, Poli C, Miguet L, Schupp IW, van Grunsven LA, Potiers N, van Dorsselaer A, Metzger E, Roemer K, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "16322561", "url": "https://glygen.org/publication/PubMed/16322561" } ] }, { "title": "Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells.", "journal": "Molecular cell", "date": "2005", "authors": "Nicke B, Bastien J, Khanna SJ, Warne PH, Cowling V, Cook SJ, Peters G, Delpuech O, Schulze A, Berns K, Mullenders J, Beijersbergen RL, Bernards R, Ganesan TS, Downward J, Hancock DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16337592", "url": "https://glygen.org/publication/PubMed/16337592" } ] }, { "title": "Structural basis of competitive recognition of p53 and MDM2 by HAUSP/USP7: implications for the regulation of the p53-MDM2 pathway.", "journal": "PLoS biology", "date": "2006", "authors": "Hu M, Gu L, Li M, Jeffrey PD, Gu W, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "16402859", "url": "https://glygen.org/publication/PubMed/16402859" } ] }, { "title": "Structural basis for the methylation site specificity of SET7/9.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Couture JF, Collazo E, Hauk G, Trievel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "16415881", "url": "https://glygen.org/publication/PubMed/16415881" } ] }, { "title": "DNA damage signaling and p53-dependent senescence after prolonged beta-interferon stimulation.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Moiseeva O, Mallette FA, Mukhopadhyay UK, Moores A, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16436515", "url": "https://glygen.org/publication/PubMed/16436515" } ] }, { "title": "Molecular recognition of p53 and MDM2 by USP7/HAUSP.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Sheng Y, Saridakis V, Sarkari F, Duan S, Wu T, Arrowsmith CH, Frappier L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "16474402", "url": "https://glygen.org/publication/PubMed/16474402" } ] }, { "title": "Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3.", "journal": "The EMBO journal", "date": "2006", "authors": "LeBron C, Chen L, Gilkes DM, Chen J", "evidence": [ { "database": "iPTMnet", "id": "O15151-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151-1" } ], "reference": [ { "type": "PubMed", "id": "16511560", "url": "https://glygen.org/publication/PubMed/16511560" } ] }, { "title": "14-3-3gamma binds to MDMX that is phosphorylated by UV-activated Chk1, resulting in p53 activation.", "journal": "The EMBO journal", "date": "2006", "authors": "Jin Y, Dai MS, Lu SZ, Xu Y, Luo Z, Zhao Y, Lu H", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "iPTMnet", "id": "O15151-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151-1" } ], "reference": [ { "type": "PubMed", "id": "16511572", "url": "https://glygen.org/publication/PubMed/16511572" } ] }, { "title": "Coupling mitochondrial respiratory chain to cell death: an essential role of mitochondrial complex I in the interferon-beta and retinoic acid-induced cancer cell death.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Huang G, Chen Y, Lu H, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16826196", "url": "https://glygen.org/publication/PubMed/16826196" } ] }, { "title": "Critical role for Daxx in regulating Mdm2.", "journal": "Nature cell biology", "date": "2006", "authors": "Tang J, Qu LK, Zhang J, Wang W, Michaelson JS, Degenhardt YY, El-Deiry WS, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "16845383", "url": "https://glygen.org/publication/PubMed/16845383" } ] }, { "title": "A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response.", "journal": "Cell", "date": "2006", "authors": "Zhang D, Zaugg K, Mak TW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16901786", "url": "https://glygen.org/publication/PubMed/16901786" } ] }, { "title": "Differential roles of ATM- and Chk2-mediated phosphorylations of Hdmx in response to DNA damage.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Pereg Y, Lam S, Teunisse A, Biton S, Meulmeester E, Mittelman L, Buscemi G, Okamoto K, Taya Y, Shiloh Y, Jochemsen AG", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "16943424", "url": "https://glygen.org/publication/PubMed/16943424" } ] }, { "title": "FOXO4 transcriptional activity is regulated by monoubiquitination and USP7/HAUSP.", "journal": "Nature cell biology", "date": "2006", "authors": "van der Horst A, de Vries-Smits AM, Brenkman AB, van Triest MH, van den Broek N, Colland F, Maurice MM, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16964248", "url": "https://glygen.org/publication/PubMed/16964248" } ] }, { "title": "LKB1 is recruited to the p21/WAF1 promoter by p53 to mediate transcriptional activation.", "journal": "Cancer research", "date": "2006", "authors": "Zeng PY, Berger SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "17108107", "url": "https://glygen.org/publication/PubMed/17108107" } ] }, { "title": "Repression of p53 activity by Smyd2-mediated methylation.", "journal": "Nature", "date": "2006", "authors": "Huang J, Perez-Burgos L, Placek BJ, Sengupta R, Richter M, Dorsey JA, Kubicek S, Opravil S, Jenuwein T, Berger SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "17108971", "url": "https://glygen.org/publication/PubMed/17108971" } ] }, { "title": "MDMX regulation of p53 response to ribosomal stress.", "journal": "The EMBO journal", "date": "2006", "authors": "Gilkes DM, Chen L, Chen J", "evidence": [ { "database": "iPTMnet", "id": "O15151-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151-1" } ], "reference": [ { "type": "PubMed", "id": "17110929", "url": "https://glygen.org/publication/PubMed/17110929" } ] }, { "title": "CARPs are ubiquitin ligases that promote MDM2-independent p53 and phospho-p53ser20 degradation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Yang W, Rozan LM, McDonald ER 3rd, Navaraj A, Liu JJ, Matthew EM, Wang W, Dicker DT, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "17121812", "url": "https://glygen.org/publication/PubMed/17121812" } ] }, { "title": "Mdm2 targets the p53 transcription cofactor JMY for degradation.", "journal": "EMBO reports", "date": "2007", "authors": "Coutts AS, Boulahbel H, Graham A, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "17170761", "url": "https://glygen.org/publication/PubMed/17170761" } ] }, { "title": "pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene.", "journal": "Genes & development", "date": "2007", "authors": "Kotake Y, Cao R, Viatour P, Sage J, Zhang Y, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17210787", "url": "https://glygen.org/publication/PubMed/17210787" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "Crystal structure of the p38 alpha-MAPKAP kinase 2 heterodimer.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "ter Haar E, Prabhakar P, Liu X, Lepre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17255097", "url": "https://glygen.org/publication/PubMed/17255097" } ] }, { "title": "The deubiquitinating enzyme USP2a regulates the p53 pathway by targeting Mdm2.", "journal": "The EMBO journal", "date": "2007", "authors": "Stevenson LF, Sparks A, Allende-Vega N, Xirodimas DP, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17290220", "url": "https://glygen.org/publication/PubMed/17290220" } ] }, { "title": "Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.", "journal": "The EMBO journal", "date": "2007", "authors": "Dietrich N, Bracken AP, Trinh E, Schjerling CK, Koseki H, Rappsilber J, Helin K, Hansen KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17332741", "url": "https://glygen.org/publication/PubMed/17332741" } ] }, { "title": "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.", "journal": "Genes & development", "date": "2007", "authors": "Bracken AP, Kleine-Kohlbrecher D, Dietrich N, Pasini D, Gargiulo G, Beekman C, Theilgaard-Monch K, Minucci S, Porse BT, Marine JC, Hansen KH, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17344414", "url": "https://glygen.org/publication/PubMed/17344414" } ] }, { "title": "DYRK2 is targeted to the nucleus and controls p53 via Ser46 phosphorylation in the apoptotic response to DNA damage.", "journal": "Molecular cell", "date": "2007", "authors": "Taira N, Nihira K, Yamaguchi T, Miki Y, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "17349958", "url": "https://glygen.org/publication/PubMed/17349958" } ] }, { "title": "Molecular basis of MAPK-activated protein kinase 2:p38 assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "White A, Pargellis CA, Studts JM, Werneburg BG, Farmer BT 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17395714", "url": "https://glygen.org/publication/PubMed/17395714" } ] }, { "title": "Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.", "journal": "Nature", "date": "2007", "authors": "Stegmeier F, Rape M, Draviam VM, Nalepa G, Sowa ME, Ang XL, McDonald ER 3rd, Li MZ, Hannon GJ, Sorger PK, Kirschner MW, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17443180", "url": "https://glygen.org/publication/PubMed/17443180" } ] }, { "title": "Stabilization and activation of p53 induced by Cdk5 contributes to neuronal cell death.", "journal": "Journal of cell science", "date": "2007", "authors": "Lee JH, Kim HS, Lee SJ, Kim KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "17591690", "url": "https://glygen.org/publication/PubMed/17591690" } ] }, { "title": "Modulation of p53 function by SET8-mediated methylation at lysine 382.", "journal": "Molecular cell", "date": "2007", "authors": "Shi X, Kachirskaia I, Yamaguchi H, West LE, Wen H, Wang EW, Dutta S, Appella E, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "17707234", "url": "https://glygen.org/publication/PubMed/17707234" } ] }, { "title": "Pro-inflammatory cytokines increase reactive oxygen species through mitochondria and NADPH oxidase in cultured RPE cells.", "journal": "Experimental eye research", "date": "2007", "authors": "Yang D, Elner SG, Bian ZM, Till GO, Petty HR, Elner VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17765224", "url": "https://glygen.org/publication/PubMed/17765224" } ] }, { "title": "The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing.", "journal": "Cell", "date": "2007", "authors": "De Santa F, Totaro MG, Prosperini E, Notarbartolo S, Testa G, Natoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17825402", "url": "https://glygen.org/publication/PubMed/17825402" } ] }, { "title": "Fbw7 and Usp28 regulate myc protein stability in response to DNA damage.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Popov N, Herold S, Llamazares M, Schulein C, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17873522", "url": "https://glygen.org/publication/PubMed/17873522" } ] }, { "title": "Targeted deletion of the mitogen-activated protein kinase kinase 4 gene in the nervous system causes severe brain developmental defects and premature death.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Wang X, Nadarajah B, Robinson AC, McColl BW, Jin JW, Dajas-Bailador F, Boot-Handford RP, Tournier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17875933", "url": "https://glygen.org/publication/PubMed/17875933" } ] }, { "title": "Human USP3 is a chromatin modifier required for S phase progression and genome stability.", "journal": "Current biology : CB", "date": "2007", "authors": "Nicassio F, Corrado N, Vissers JH, Areces LB, Bergink S, Marteijn JA, Geverts B, Houtsmuller AB, Vermeulen W, Di Fiore PP, Citterio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17980597", "url": "https://glygen.org/publication/PubMed/17980597" } ] }, { "title": "Regulation of early wave of germ cell apoptosis and spermatogenesis by deubiquitinating enzyme CYLD.", "journal": "Developmental cell", "date": "2007", "authors": "Wright A, Reiley WW, Chang M, Jin W, Lee AJ, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17981138", "url": "https://glygen.org/publication/PubMed/17981138" } ] }, { "title": "Deubiquitylation of histone H2A activates transcriptional initiation via trans-histone cross-talk with H3K4 di- and trimethylation.", "journal": "Genes & development", "date": "2008", "authors": "Nakagawa T, Kajitani T, Togo S, Masuko N, Ohdan H, Hishikawa Y, Koji T, Matsuyama T, Ikura T, Muramatsu M, Ito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18172164", "url": "https://glygen.org/publication/PubMed/18172164" } ] }, { "title": "Phosphorylation of MDMX mediated by Akt leads to stabilization and induces 14-3-3 binding.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lopez-Pajares V, Kim MM, Yuan ZM", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "18356162", "url": "https://glygen.org/publication/PubMed/18356162" } ] }, { "title": "p16(INK4a) translation suppressed by miR-24.", "journal": "PloS one", "date": "2008", "authors": "Lal A, Kim HH, Abdelmohsen K, Kuwano Y, Pullmann R Jr, Srikantan S, Subrahmanyam R, Martindale JL, Yang X, Ahmed F, Navarro F, Dykxhoorn D, Lieberman J, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18365017", "url": "https://glygen.org/publication/PubMed/18365017" } ] }, { "title": "Regulation of IkappaB kinase-related kinases and antiviral responses by tumor suppressor CYLD.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhang M, Wu X, Lee AJ, Jin W, Chang M, Wright A, Imaizumi T, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18467330", "url": "https://glygen.org/publication/PubMed/18467330" } ] }, { "title": "Cooperative roles of c-Abl and Cdk5 in regulation of p53 in response to oxidative stress.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lee JH, Jeong MW, Kim W, Choi YH, Kim KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "18490454", "url": "https://glygen.org/publication/PubMed/18490454" } ] }, { "title": "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18632802", "url": "https://glygen.org/publication/PubMed/18632802" } ] }, { "title": "The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.", "journal": "EMBO reports", "date": "2008", "authors": "Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18636086", "url": "https://glygen.org/publication/PubMed/18636086" } ] }, { "title": "c-Jun expression, activation and function in neural cell death, inflammation and repair.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Raivich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" } ] }, { "title": "ATM and Chk2 kinase target the p53 cofactor Strap.", "journal": "EMBO reports", "date": "2008", "authors": "Adams CJ, Graham AL, Jansson M, Coutts AS, Edelmann M, Smith L, Kessler B, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "18833288", "url": "https://glygen.org/publication/PubMed/18833288" } ] }, { "title": "Arginine methylation regulates the p53 response.", "journal": "Nature cell biology", "date": "2008", "authors": "Jansson M, Durant ST, Cho EC, Sheahan S, Edelmann M, Kessler B, La Thangue NB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "19011621", "url": "https://glygen.org/publication/PubMed/19011621" } ] }, { "title": "USP19 deubiquitinating enzyme supports cell proliferation by stabilizing KPC1, a ubiquitin ligase for p27Kip1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Lu Y, Adegoke OA, Nepveu A, Nakayama KI, Bedard N, Cheng D, Peng J, Wing SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19015242", "url": "https://glygen.org/publication/PubMed/19015242" } ] }, { "title": "Phosphorylation of p53 is regulated by TPX2-Aurora A in xenopus oocytes.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Pascreau G, Eckerdt F, Lewellyn AL, Prigent C, Maller JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "19121998", "url": "https://glygen.org/publication/PubMed/19121998" } ] }, { "title": "FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.", "journal": "Cell", "date": "2009", "authors": "Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19135894", "url": "https://glygen.org/publication/PubMed/19135894" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shenoy SK, Modi AS, Shukla AK, Xiao K, Berthouze M, Ahn S, Wilkinson KD, Miller WE, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19363159", "url": "https://glygen.org/publication/PubMed/19363159" } ] }, { "title": "The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bomberger JM, Barnaby RL, Stanton BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19398555", "url": "https://glygen.org/publication/PubMed/19398555" } ] }, { "title": "The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.", "journal": "The EMBO journal", "date": "2009", "authors": "Berthouze M, Venkataramanan V, Li Y, Shenoy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19424180", "url": "https://glygen.org/publication/PubMed/19424180" } ] }, { "title": "The H3K27me3 demethylase JMJD3 contributes to the activation of the INK4A-ARF locus in response to oncogene- and stress-induced senescence.", "journal": "Genes & development", "date": "2009", "authors": "Agger K, Cloos PA, Rudkjaer L, Williams K, Andersen G, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451217", "url": "https://glygen.org/publication/PubMed/19451217" } ] }, { "title": "Histone demethylase JMJD3 contributes to epigenetic control of INK4a/ARF by oncogenic RAS.", "journal": "Genes & development", "date": "2009", "authors": "Barradas M, Anderton E, Acosta JC, Li S, Banito A, Rodriguez-Niedenfuhr M, Maertens G, Banck M, Zhou MM, Walsh MJ, Peters G, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451218", "url": "https://glygen.org/publication/PubMed/19451218" } ] }, { "title": "Polycomb mediated epigenetic silencing and replication timing at the INK4a/ARF locus during senescence.", "journal": "PloS one", "date": "2009", "authors": "Agherbi H, Gaussmann-Wenger A, Verthuy C, Chasson L, Serrano M, Djabali M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19462008", "url": "https://glygen.org/publication/PubMed/19462008" } ] }, { "title": "Mitochondrial dysfunction contributes to oncogene-induced senescence.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Moiseeva O, Bourdeau V, Roux A, Deschenes-Simard X, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19528227", "url": "https://glygen.org/publication/PubMed/19528227" } ] }, { "title": "Sgk1 activates MDM2-dependent p53 degradation and affects cell proliferation, survival, and differentiation.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2009", "authors": "Amato R, D'Antona L, Porciatti G, Agosti V, Menniti M, Rinaldo C, Costa N, Bellacchio E, Mattarocci S, Fuiano G, Soddu S, Paggi MG, Lang F, Perrotti N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "19756449", "url": "https://glygen.org/publication/PubMed/19756449" } ] }, { "title": "Phosphorylation and degradation of MdmX is inhibited by Wip1 phosphatase in the DNA damage response.", "journal": "Cancer research", "date": "2009", "authors": "Zhang X, Lin L, Guo H, Yang J, Jones SN, Jochemsen A, Lu X", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "19808970", "url": "https://glygen.org/publication/PubMed/19808970" } ] }, { "title": "ATM activates p53 by regulating MDM2 oligomerization and E3 processivity.", "journal": "The EMBO journal", "date": "2009", "authors": "Cheng Q, Chen L, Li Z, Lane WS, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "19816404", "url": "https://glygen.org/publication/PubMed/19816404" } ] }, { "title": "MdmX is a substrate for the deubiquitinating enzyme USP2a.", "journal": "Oncogene", "date": "2010", "authors": "Allende-Vega N, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" } ] }, { "title": "USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha.", "journal": "Cellular signalling", "date": "2010", "authors": "Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19874889", "url": "https://glygen.org/publication/PubMed/19874889" } ] }, { "title": "Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19910467", "url": "https://glygen.org/publication/PubMed/19910467" } ] }, { "title": "ATM augments nuclear stabilization of DYRK2 by inhibiting MDM2 in the apoptotic response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Taira N, Yamamoto H, Yamaguchi T, Miki Y, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "19965871", "url": "https://glygen.org/publication/PubMed/19965871" } ] }, { "title": "USP10 regulates p53 localization and stability by deubiquitinating p53.", "journal": "Cell", "date": "2010", "authors": "Yuan J, Luo K, Zhang L, Cheville JC, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20096447", "url": "https://glygen.org/publication/PubMed/20096447" } ] }, { "title": "G9a and Glp methylate lysine 373 in the tumor suppressor p53.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Huang J, Dorsey J, Chuikov S, Perez-Burgos L, Zhang X, Jenuwein T, Reinberg D, Berger SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "20118233", "url": "https://glygen.org/publication/PubMed/20118233" } ] }, { "title": "Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.", "journal": "Nature cell biology", "date": "2010", "authors": "Pereg Y, Liu BY, O'Rourke KM, Sagolla M, Dey A, Komuves L, French DM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20228808", "url": "https://glygen.org/publication/PubMed/20228808" } ] }, { "title": "The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.", "journal": "Cell research", "date": "2010", "authors": "Chen R, Zhang L, Zhong B, Tan B, Liu Y, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20368735", "url": "https://glygen.org/publication/PubMed/20368735" } ] }, { "title": "Phospholipase D stabilizes HDM2 through an mTORC2/SGK1 pathway.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Lyo D, Xu L, Foster DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "20438709", "url": "https://glygen.org/publication/PubMed/20438709" } ] }, { "title": "The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Dirac AM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20501646", "url": "https://glygen.org/publication/PubMed/20501646" } ] }, { "title": "Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to coactivator CBP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Nelson ML, Kang HS, Lee GM, Blaszczak AG, Lau DK, McIntosh LP, Graves BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "20534573", "url": "https://glygen.org/publication/PubMed/20534573" } ] }, { "title": "Further insight into substrate recognition by USP7: structural and biochemical analysis of the HdmX and Hdm2 interactions with USP7.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Sarkari F, La Delfa A, Arrowsmith CH, Frappier L, Sheng Y, Saridakis V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "20713061", "url": "https://glygen.org/publication/PubMed/20713061" } ] }, { "title": "The MBT repeats of L3MBTL1 link SET8-mediated p53 methylation at lysine 382 to target gene repression.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "West LE, Roy S, Lachmi-Weiner K, Hayashi R, Shi X, Appella E, Kutateladze TG, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "20870725", "url": "https://glygen.org/publication/PubMed/20870725" } ] }, { "title": "Aurora B interacts with NIR-p53, leading to p53 phosphorylation in its DNA-binding domain and subsequent functional suppression.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu L, Ma CA, Zhao Y, Jain A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "20959462", "url": "https://glygen.org/publication/PubMed/20959462" } ] }, { "title": "Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ramakrishna S, Suresh B, Lee EJ, Lee HJ, Ahn WS, Baek KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21239494", "url": "https://glygen.org/publication/PubMed/21239494" } ] }, { "title": "A new role of NUAK1: directly phosphorylating p53 and regulating cell proliferation.", "journal": "Oncogene", "date": "2011", "authors": "Hou X, Liu JE, Liu W, Liu CY, Liu ZY, Sun ZY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "21317932", "url": "https://glygen.org/publication/PubMed/21317932" } ] }, { "title": "USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase beta.", "journal": "Molecular cell", "date": "2011", "authors": "Parsons JL, Dianova II, Khoronenkova SV, Edelmann MJ, Kessler BM, Dianov GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21362556", "url": "https://glygen.org/publication/PubMed/21362556" } ] }, { "title": "Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Chen M, Gutierrez GJ, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21571647", "url": "https://glygen.org/publication/PubMed/21571647" } ] }, { "title": "Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.", "journal": "Molecular cell", "date": "2011", "authors": "Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21596315", "url": "https://glygen.org/publication/PubMed/21596315" } ] }, { "title": "Modeling a new water channel that allows SET9 to dimethylate p53.", "journal": "PloS one", "date": "2011", "authors": "Bai Q, Shen Y, Yao X, Wang F, Du Y, Wang Q, Jin N, Hai J, Hu T, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "21625555", "url": "https://glygen.org/publication/PubMed/21625555" } ] }, { "title": "USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Scortegagna M, Subtil T, Qi J, Kim H, Zhao W, Gu W, Kluger H, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21659512", "url": "https://glygen.org/publication/PubMed/21659512" } ] }, { "title": "Heterodimerization of Mdm2 and Mdm4 is critical for regulating p53 activity during embryogenesis but dispensable for p53 and Mdm2 stability.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Pant V, Xiong S, Iwakuma T, Quintas-Cardama A, Lozano G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "21730132", "url": "https://glygen.org/publication/PubMed/21730132" } ] }, { "title": "The p53 inhibitors MDM2/MDMX complex is required for control of p53 activity in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Huang L, Yan Z, Liao X, Li Y, Yang J, Wang ZG, Zuo Y, Kawai H, Shadfan M, Ganapathy S, Yuan ZM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "21730163", "url": "https://glygen.org/publication/PubMed/21730163" } ] }, { "title": "The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mei Y, Hahn AA, Hu S, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21849505", "url": "https://glygen.org/publication/PubMed/21849505" } ] }, { "title": "Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.", "journal": "Cell", "date": "2011", "authors": "Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21962518", "url": "https://glygen.org/publication/PubMed/21962518" } ] }, { "title": "Regulation of MDM2 E3 ligase activity by phosphorylation after DNA damage.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Cheng Q, Cross B, Li B, Chen L, Li Z, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "21986495", "url": "https://glygen.org/publication/PubMed/21986495" } ] }, { "title": "Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.", "journal": "Oncogene", "date": "2012", "authors": "Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22020331", "url": "https://glygen.org/publication/PubMed/22020331" } ] }, { "title": "Ubiquitin-specific protease 4 (USP4) targets TRAF2 and TRAF6 for deubiquitination and inhibits TNFalpha-induced cancer cell migration.", "journal": "The Biochemical journal", "date": "2012", "authors": "Xiao N, Li H, Luo J, Wang R, Chen H, Chen J, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22029577", "url": "https://glygen.org/publication/PubMed/22029577" } ] }, { "title": "Regulation of p53 stability and function by the deubiquitinating enzyme USP42.", "journal": "The EMBO journal", "date": "2011", "authors": "Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22085928", "url": "https://glygen.org/publication/PubMed/22085928" } ] }, { "title": "Abnormal MDMX degradation in tumor cells due to ARF deficiency.", "journal": "Oncogene", "date": "2012", "authors": "Li X, Gilkes D, Li B, Cheng Q, Pernazza D, Lawrence H, Lawrence N, Chen J", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "22120712", "url": "https://glygen.org/publication/PubMed/22120712" } ] }, { "title": "Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Altun M, Zhao B, Velasco K, Liu H, Hassink G, Paschke J, Pereira T, Lindsten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22128162", "url": "https://glygen.org/publication/PubMed/22128162" } ] }, { "title": "Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.", "journal": "PloS one", "date": "2011", "authors": "Zhang YH, Zhou CJ, Zhou ZR, Song AX, Hu HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22216260", "url": "https://glygen.org/publication/PubMed/22216260" } ] }, { "title": "PCGF homologs, CBX proteins, and RYBP define functionally distinct PRC1 family complexes.", "journal": "Molecular cell", "date": "2012", "authors": "Gao Z, Zhang J, Bonasio R, Strino F, Sawai A, Parisi F, Kluger Y, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22325352", "url": "https://glygen.org/publication/PubMed/22325352" } ] }, { "title": "Regulation of p14ARF expression by miR-24: a potential mechanism compromising the p53 response during retinoblastoma development.", "journal": "BMC cancer", "date": "2012", "authors": "To KH, Pajovic S, Gallie BL, Theriault BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22336108", "url": "https://glygen.org/publication/PubMed/22336108" } ] }, { "title": "The p53 cofactor Strap exhibits an unexpected TPR motif and oligonucleotide-binding (OB)-fold structure.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Adams CJ, Pike AC, Maniam S, Sharpe TD, Coutts AS, Knapp S, La Thangue NB, Bullock AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760" } ], "reference": [ { "type": "PubMed", "id": "22362889", "url": "https://glygen.org/publication/PubMed/22362889" } ] }, { "title": "The mitochondrial pathway and reactive oxygen species are critical contributors to interferon-alpha/beta-mediated apoptosis in Ubp43-deficient hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Yim HY, Yang Y, Lim JS, Lee MS, Zhang DE, Kim KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22683641", "url": "https://glygen.org/publication/PubMed/22683641" } ] }, { "title": "HIPK2 kinase activity depends on cis-autophosphorylation of its activation loop.", "journal": "Journal of molecular cell biology", "date": "2013", "authors": "Saul VV, de la Vega L, Milanovic M, Kruger M, Braun T, Fritz-Wolf K, Becker K, Schmitz ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "23000554", "url": "https://glygen.org/publication/PubMed/23000554" } ] }, { "title": "Casein kinase 1alpha regulates an MDMX intramolecular interaction to stimulate p53 binding.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Wu S, Chen L, Becker A, Schonbrunn E, Chen J", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "23028042", "url": "https://glygen.org/publication/PubMed/23028042" } ] }, { "title": "The deubiquitinating protein USP24 interacts with DDB2 and regulates DDB2 stability.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Zhang L, Lubin A, Chen H, Sun Z, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23159851", "url": "https://glygen.org/publication/PubMed/23159851" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Zhang J, Chen C, Hou X, Gao Y, Lin F, Yang J, Gao Z, Pan L, Tao L, Wen C, Yao Z, Tsun A, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23395819", "url": "https://glygen.org/publication/PubMed/23395819" } ] }, { "title": "HIPK2 catalytic activity and subcellular localization are regulated by activation-loop Y354 autophosphorylation.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Siepi F, Gatti V, Camerini S, Crescenzi M, Soddu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "23485397", "url": "https://glygen.org/publication/PubMed/23485397" } ] }, { "title": "USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.", "journal": "Nature", "date": "2013", "authors": "Li J, D'Angiolella V, Seeley ES, Kim S, Kobayashi T, Fu W, Campos EI, Pagano M, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23486064", "url": "https://glygen.org/publication/PubMed/23486064" } ] }, { "title": "HIPK1 drives p53 activation to limit colorectal cancer cell growth.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2013", "authors": "Rey C, Soubeyran I, Mahouche I, Pedeboscq S, Bessede A, Ichas F, De Giorgi F, Lartigue L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "23676219", "url": "https://glygen.org/publication/PubMed/23676219" } ] }, { "title": "USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.", "journal": "Genes & development", "date": "2013", "authors": "Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23824326", "url": "https://glygen.org/publication/PubMed/23824326" } ] }, { "title": "USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Liu X, Li H, Zhong B, Blonska M, Gorjestani S, Yan M, Tian Q, Zhang DE, Lin X, Dong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23825189", "url": "https://glygen.org/publication/PubMed/23825189" } ] }, { "title": "Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Burska UL, Harle VJ, Coffey K, Darby S, Ramsey H, O'Neill D, Logan IR, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24056413", "url": "https://glygen.org/publication/PubMed/24056413" } ] }, { "title": "Autophosphorylation and Pin1 binding coordinate DNA damage-induced HIPK2 activation and cell death.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bitomsky N, Conrad E, Moritz C, Polonio-Vallon T, Sombroek D, Schultheiss K, Glas C, Greiner V, Herbel C, Mantovani F, del Sal G, Peri F, Hofmann TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "24145406", "url": "https://glygen.org/publication/PubMed/24145406" } ] }, { "title": "AMP-activated protein kinase induces p53 by phosphorylating MDMX and inhibiting its activity.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "He G, Zhang YW, Lee JH, Zeng SX, Wang YV, Luo Z, Dong XC, Viollet B, Wahl GM, Lu H", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "24190973", "url": "https://glygen.org/publication/PubMed/24190973" } ] }, { "title": "Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.", "journal": "PloS one", "date": "2013", "authors": "Zhong H, Wang D, Fang L, Zhang H, Luo R, Shang M, Ouyang C, Ouyang H, Chen H, Xiao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24260525", "url": "https://glygen.org/publication/PubMed/24260525" } ] }, { "title": "USP21 negatively regulates antiviral response by acting as a RIG-I deubiquitinase.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Fan Y, Mao R, Yu Y, Liu S, Shi Z, Cheng J, Zhang H, An L, Zhao Y, Xu X, Chen Z, Kogiso M, Zhang D, Zhang H, Zhang P, Jung JU, Li X, Xu G, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24493797", "url": "https://glygen.org/publication/PubMed/24493797" } ] }, { "title": "AMPK couples p73 with p53 in cell fate decision.", "journal": "Cell death and differentiation", "date": "2014", "authors": "Adamovich Y, Adler J, Meltser V, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "24874608", "url": "https://glygen.org/publication/PubMed/24874608" } ] }, { "title": "The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.", "journal": "Nature", "date": "2014", "authors": "Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24896179", "url": "https://glygen.org/publication/PubMed/24896179" } ] }, { "title": "Deubiquitination and stabilization of IL-33 by USP21.", "journal": "International journal of clinical and experimental pathology", "date": "2014", "authors": "Tao L, Chen C, Song H, Piccioni M, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25197364", "url": "https://glygen.org/publication/PubMed/25197364" } ] }, { "title": "The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Zhang Z, Yang H, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25305019", "url": "https://glygen.org/publication/PubMed/25305019" } ] }, { "title": "The deubiquitinating enzyme USP24 is a regulator of the UV damage response.", "journal": "Cell reports", "date": "2015", "authors": "Zhang L, Nemzow L, Chen H, Lubin A, Rong X, Sun Z, Harris TK, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25578727", "url": "https://glygen.org/publication/PubMed/25578727" } ] }, { "title": "Structural basis of how stress-induced MDMX phosphorylation activates p53.", "journal": "Oncogene", "date": "2016-04-14", "authors": "Chen X, Gohain N, Zhan C, Lu W-Y, Pazgier M, Lu W", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "26148237", "url": "https://glygen.org/publication/PubMed/26148237" } ] }, { "title": "Human epidermal growth factor receptor 4 (Her4) Suppresses p53 Protein via Targeting the MDMX-MDM2 Protein Complex: IMPLICATION OF A NOVEL MDMX SER-314 PHOSPHOSITE.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Gerarduzzi C, de Polo A, Liu XS, El Kharbili M, Little JB, Yuan ZM", "evidence": [ { "database": "iPTMnet", "id": "O15151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15151" } ], "reference": [ { "type": "PubMed", "id": "27777309", "url": "https://glygen.org/publication/PubMed/27777309" } ] }, { "title": "Germline mutation of MDM4, a major p53 regulator, in a familial syndrome of defective telomere maintenance.", "journal": "Science advances", "date": "2020", "authors": "Toufektchan E, Lejour V, Durand R, Giri N, Draskovic I, Bardot B, Laplante P, Jaber S, Alter BP, Londono-Vallejo JA, Savage SA, Toledo F", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "reference": [ { "type": "PubMed", "id": "32300648", "url": "https://glygen.org/publication/PubMed/32300648" } ] }, { "title": "Reduced murine double minute 2 and 4 protein, but not messenger RNA, expression is associated with more severe disease in myelodysplastic syndromes and acute myeloblastic leukaemia.", "journal": "British journal of haematology", "date": "2023-04", "authors": "Salomao Norman, Maslah Nabih, Giulianelli Anouk, Drevon Louis, Aguinaga Lorea, Gu Xiaolian, Cassinat Bruno, Giraudier Stephane, Fenaux Pierre, Fahraeus Robin", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" } ], "reference": [ { "type": "PubMed", "id": "36546586", "url": "https://glygen.org/publication/PubMed/36546586" } ] }, { "title": "Review: MDMX plays a central role in leukemic transformation and may be a promising target for leukemia prevention strategies.", "journal": "Experimental hematology", "date": "2023-04-20", "authors": "Ueda Koki", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" } ], "reference": [ { "type": "PubMed", "id": "37086813", "url": "https://glygen.org/publication/PubMed/37086813" } ] }, { "title": "LINC01094 accelerates the metastasis of hepatocellular carcinoma via the miR-26b-3p/MDM4 axis.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2023-06-30", "authors": "Mao Yingmin, Hu Zhe, Zeng Yunjian, Zhou Yuqi, Shi Zili", "evidence": [ { "database": "RefSeq", "id": "NP_001265447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001265447" } ], "reference": [ { "type": "PubMed", "id": "37605571", "url": "https://glygen.org/publication/PubMed/37605571" } ] }, { "title": "Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Raingeaud J, Gupta S, Rogers JS, Dickens M, Han J, Ulevitch RJ, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7535770", "url": "https://glygen.org/publication/PubMed/7535770" } ] }, { "title": "Metabolism of the polyubiquitin degradation signal: structure, mechanism, and role of isopeptidase T.", "journal": "Biochemistry", "date": "1995", "authors": "Wilkinson KD, Tashayev VL, O'Connor LB, Larsen CN, Kasperek E, Pickart CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "7578059", "url": "https://glygen.org/publication/PubMed/7578059" } ] }, { "title": "ERF: an ETS domain protein with strong transcriptional repressor activity, can suppress ets-associated tumorigenesis and is regulated by phosphorylation during cell cycle and mitogenic stimulation.", "journal": "The EMBO journal", "date": "1995", "authors": "Sgouras DN, Athanasiou MA, Beal GJ Jr, Fisher RJ, Blair DG, Mavrothalassitis GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "7588608", "url": "https://glygen.org/publication/PubMed/7588608" } ] }, { "title": "The Mos/MAP kinase pathway stabilizes c-Fos by phosphorylation and augments its transforming activity in NIH 3T3 cells.", "journal": "The EMBO journal", "date": "1995", "authors": "Okazaki K, Sagata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ] }, { "title": "Mapping of the p53 and mdm-2 interaction domains.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Chen J, Marechal V, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "7686617", "url": "https://glygen.org/publication/PubMed/7686617" } ] }, { "title": "Identification of p53 target genes through immune selection of genomic DNA: the cyclin G gene contains two distinct p53 binding sites.", "journal": "Oncogene", "date": "1995", "authors": "Zauberman A, Lupo A, Oren M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "7784084", "url": "https://glygen.org/publication/PubMed/7784084" } ] }, { "title": "Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA.", "journal": "Nature", "date": "1995", "authors": "Glover JN, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7816143", "url": "https://glygen.org/publication/PubMed/7816143" } ] }, { "title": "Lack of cyclin D-Cdk complexes in Rb-negative cells correlates with high levels of p16INK4/MTS1 tumour suppressor gene product.", "journal": "The EMBO journal", "date": "1995", "authors": "Parry D, Bates S, Mann DJ, Peters G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7859739", "url": "https://glygen.org/publication/PubMed/7859739" } ] }, { "title": "Cyclin G is a transcriptional target of the p53 tumor suppressor protein.", "journal": "The EMBO journal", "date": "1994", "authors": "Okamoto K, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "7957050", "url": "https://glygen.org/publication/PubMed/7957050" } ] }, { "title": "Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.", "journal": "Genes & development", "date": "1994", "authors": "Guan KL, Jenkins CW, Li Y, Nichols MA, Wu X, O'Keefe CL, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8001816", "url": "https://glygen.org/publication/PubMed/8001816" } ] }, { "title": "p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.", "journal": "Nature", "date": "1994", "authors": "Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8078588", "url": "https://glygen.org/publication/PubMed/8078588" } ] }, { "title": "A new regulatory motif in cell-cycle control causing specific inhibition of cyclin D/CDK4.", "journal": "Nature", "date": "1993", "authors": "Serrano M, Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8259215", "url": "https://glygen.org/publication/PubMed/8259215" } ] }, { "title": "The p53-mdm-2 autoregulatory feedback loop.", "journal": "Genes & development", "date": "1993", "authors": "Wu X, Bayle JH, Olson D, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "8319905", "url": "https://glygen.org/publication/PubMed/8319905" } ] }, { "title": "Oncoprotein MDM2 conceals the activation domain of tumour suppressor p53.", "journal": "Nature", "date": "1993", "authors": "Oliner JD, Pietenpol JA, Thiagalingam S, Gyuris J, Kinzler KW, Vogelstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "8479525", "url": "https://glygen.org/publication/PubMed/8479525" } ] }, { "title": "Ras-mediated phosphorylation of a conserved threonine residue enhances the transactivation activities of c-Ets1 and c-Ets2.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Yang BS, Hauser CA, Henkel G, Colman MS, Van Beveren C, Stacey KJ, Hume DA, Maki RA, Ostrowski MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "8552081", "url": "https://glygen.org/publication/PubMed/8552081" } ] }, { "title": "MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Raingeaud J, Whitmarsh AJ, Barrett T, Derijard B, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622669", "url": "https://glygen.org/publication/PubMed/8622669" } ] }, { "title": "3pK, a new mitogen-activated protein kinase-activated protein kinase located in the small cell lung cancer tumor suppressor gene region.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Sithanandam G, Latif F, Duh FM, Bernal R, Smola U, Li H, Kuzmin I, Wixler V, Geil L, Shrestha S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622688", "url": "https://glygen.org/publication/PubMed/8622688" } ] }, { "title": "Identification of mitogen-activated protein (MAP) kinase-activated protein kinase-3, a novel substrate of CSBP p38 MAP kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "McLaughlin MM, Kumar S, McDonnell PC, Van Horn S, Lee JC, Livi GP, Young PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8626550", "url": "https://glygen.org/publication/PubMed/8626550" } ] }, { "title": "Isolation and characterization of p19INK4d, a p16-related inhibitor specific to CDK6 and CDK4.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Guan KL, Jenkins CW, Li Y, O'Keefe CL, Noh S, Wu X, Zariwala M, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8741839", "url": "https://glygen.org/publication/PubMed/8741839" } ] }, { "title": "A comparison of the substrate specificity of MAPKAP kinase-2 and MAPKAP kinase-3 and their activation by cytokines and cellular stress.", "journal": "FEBS letters", "date": "1996", "authors": "Clifton AD, Young PR, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8774846", "url": "https://glygen.org/publication/PubMed/8774846" } ] }, { "title": "Identification of novel phosphorylation sites required for activation of MAPKAP kinase-2.", "journal": "The EMBO journal", "date": "1995", "authors": "Ben-Levy R, Leighton IA, Doza YN, Attwood P, Morrice N, Marshall CJ, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8846784", "url": "https://glygen.org/publication/PubMed/8846784" } ] }, { "title": "p53-dependent association between cyclin G and the B' subunit of protein phosphatase 2A.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Okamoto K, Kamibayashi C, Serrano M, Prives C, Mumby MC, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "8887688", "url": "https://glygen.org/publication/PubMed/8887688" } ] }, { "title": "Structure and chromosomal assignment of the human cyclin G gene.", "journal": "Genomics", "date": "1996", "authors": "Endo Y, Fujita T, Tamura K, Tsuruga H, Nojima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804757", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757" } ], "reference": [ { "type": "PubMed", "id": "8954786", "url": "https://glygen.org/publication/PubMed/8954786" } ] }, { "title": "Induction of apoptosis by ASK1, a mammalian MAPKKK that activates SAPK/JNK and p38 signaling pathways.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Ichijo H, Nishida E, Irie K, ten Dijke P, Saitoh M, Moriguchi T, Takagi M, Matsumoto K, Miyazono K, Gotoh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8974401", "url": "https://glygen.org/publication/PubMed/8974401" } ] }, { "title": "Regulatory mechanisms involved in activator-protein-1 (AP-1)-mediated activation of glutathione-S-transferase gene expression by chemical agents.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Ainbinder E, Bergelson S, Pinkus R, Daniel V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9030721", "url": "https://glygen.org/publication/PubMed/9030721" } ] }, { "title": "Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Deacon K, Blank JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9162092", "url": "https://glygen.org/publication/PubMed/9162092" } ] }, { "title": "A novel mechanism of JNK1 activation. Nuclear translocation and activation of JNK1 during ischemia and reperfusion.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizukami Y, Yoshioka K, Morimoto S, Yoshida Ki", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9195981", "url": "https://glygen.org/publication/PubMed/9195981" } ] }, { "title": "Isolation and identification of the human homolog of a new p53-binding protein, Mdmx.", "journal": "Genomics", "date": "1997", "authors": "Shvarts A, Bazuine M, Dekker P, Ramos YF, Steegenga WT, Merckx G, van Ham RC, van der Houven van Oordt W, van der Eb AJ, Jochemsen AG", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "reference": [ { "type": "PubMed", "id": "9226370", "url": "https://glygen.org/publication/PubMed/9226370" } ] }, { "title": "ARF promotes MDM2 degradation and stabilizes p53: ARF-INK4a locus deletion impairs both the Rb and p53 tumor suppression pathways.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, Xiong Y, Yarbrough WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9529249", "url": "https://glygen.org/publication/PubMed/9529249" } ] }, { "title": "Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1.", "journal": "The EMBO journal", "date": "1998", "authors": "Saitoh M, Nishitoh H, Fujii M, Takeda K, Tobiume K, Sawada Y, Kawabata M, Miyazono K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9564042", "url": "https://glygen.org/publication/PubMed/9564042" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "Nuclear export of the stress-activated protein kinase p38 mediated by its substrate MAPKAP kinase-2.", "journal": "Current biology : CB", "date": "1998", "authors": "Ben-Levy R, Hooper S, Wilson R, Paterson HF, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9768359", "url": "https://glygen.org/publication/PubMed/9768359" } ] }, { "title": "Mdm2 association with p53 targets its ubiquitination.", "journal": "Oncogene", "date": "1998", "authors": "Fuchs SY, Adler V, Buschmann T, Wu X, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9824166", "url": "https://glygen.org/publication/PubMed/9824166" } ] }, { "title": "A role for ATR in the DNA damage-induced phosphorylation of p53.", "journal": "Genes & development", "date": "1999", "authors": "Tibbetts RS, Brumbaugh KM, Williams JM, Sarkaria JN, Cliby WA, Shieh SY, Taya Y, Prives C, Abraham RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756" } ], "reference": [ { "type": "PubMed", "id": "9925639", "url": "https://glygen.org/publication/PubMed/9925639" } ] } ], "pathway": [ { "id": "hsa:4194", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4194", "resource": "KEGG Pathway" }, { "id": "R-HSA-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-HSA-2559585", "name": "Oncogene Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585", "resource": "Reactome", "description": "Oncogene Induced Senescence" }, { "id": "R-HSA-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-HSA-6804756", "name": "Regulation of TP53 Activity through Phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804756", "resource": "Reactome", "description": "Regulation of TP53 Activity through Phosphorylation" }, { "id": "R-HSA-6804757", "name": "Regulation of TP53 Degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804757", "resource": "Reactome", "description": "Regulation of TP53 Degradation" }, { "id": "R-HSA-6804760", "name": "Regulation of TP53 Activity through Methylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804760", "resource": "Reactome", "description": "Regulation of TP53 Activity through Methylation" }, { "id": "R-HSA-69541", "name": "Stabilization of p53", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69541", "resource": "Reactome", "description": "Stabilization of p53" } ], "orthologs": [ { "uniprot_canonical_ac": "O35618-1", "protein_name": "Protein Mdm4", "gene_name": "Mdm4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTSHSTSAQCSASDSACRISSEQISQVRPKLQLLKILHAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVTSASINTDAAQTLALAQDHTMDFPSQDRLKHGATEYSNPRKRTEEEDTHTLPTSRHKCRDSRADEDLIEHLSQDETSRLDLDFEEWDVAGLPWWFLGNLRNNCIPKSNGSTDLQTNQDIGTAIVSDTTDDLWFLNETVSEQLGVGIKVEAANSEQTSEVGKTSNKKTVEVGKDDDLEDSRSLSDDTDVELTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSNITAIPEKKDNEGIDVPDCRRTISAPVVRPKDGYLKEEKPRFDPCNSVGFLDLAHSSESQEIISSAREQTDIFSEQKAETESMEDFQNVLKPCSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACKKEIQLVIKVFIA", "length": 489 }, "evidence": [ { "id": "45924219", "url": "http://www.informatics.jax.org/homology/45924219", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5XIN1-1", "protein_name": "Protein Mdm4", "gene_name": "Mdm4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTSHSTSAQCSASDSACRISSEQINQQVRPKLQLLKILQAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHLVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVTSASVNTDAAQTLALAQDHTMDIPSQDRLKHGATECSNPRKRTEEDDTHTLPTSRRKCRDSRADEDLIEHLSQDETSRLDLDFEEWDVAGLPWWFLGNLRNNYIPRSNGSTDLQTNQDIGTAIVSDTTDDLWFLNETVSEQLGVGVKVEAANCEQPSEVGRTRDKKMVEGGKDDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSNITAIPEKKDNEGIDVPDCRRTISAPVVRPKDGYLKEEKPRFDPCNSVEFLDLAHGSESQEIISSTREQTDIFSEQKTETESMEDFQNVLKPCSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACKKEIQLVIKVFIA", "length": 490 }, "evidence": [ { "id": "45924219", "url": "http://www.informatics.jax.org/homology/45924219", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "transcription repressor complex", "id": "GO:0017053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017053", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "regulation of cell cycle", "id": "GO:0051726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051726", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "heart valve development", "id": "GO:0003170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003170", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "endocardial cushion morphogenesis", "id": "GO:0003203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003203", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "ventricular septum development", "id": "GO:0003281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003281", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "atrioventricular valve morphogenesis", "id": "GO:0003181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003181", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "negative regulation of protein catabolic process", "id": "GO:0042177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042177", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "atrial septum development", "id": "GO:0003283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003283", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "DNA damage response, signal transduction by p53 class mediator", "id": "GO:0030330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030330", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "protein-containing complex assembly", "id": "GO:0065003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0065003", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 209, "end_pos": 211, "annotation": "n_glycosylation_sequon" }, { "start_pos": 215, "end_pos": 217, "annotation": "n_glycosylation_sequon" }, { "start_pos": 242, "end_pos": 244, "annotation": "n_glycosylation_sequon" }, { "start_pos": 416, "end_pos": 418, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated. Phosphorylation at Ser-367 promotes interaction with YWHAG and subsequent ubiquitination and degradation. Phosphorylation at Ser-342 also induces ubiquitination and degradation but to a lower extent.", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "PubMed", "id": "16163388", "url": "https://glygen.org/publication/PubMed/16163388" }, { "database": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" }, { "database": "PubMed", "id": "16511572", "url": "https://glygen.org/publication/PubMed/16511572" } ] }, { "annotation": "Ubiquitinated and degraded by MDM2. Deubiquitination by USP2 on the other hand stabilizes the MDM4 protein.", "evidence": [ { "database": "UniProtKB", "id": "O15151", "url": "https://www.uniprot.org/uniprot/O15151" }, { "database": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 96, 99, 119, 161, 289, 314, 342, 365, 367, 391, 403 ], "sequon_annotation_sites": [ { "start_pos": 209, "end_pos": 211 }, { "start_pos": 215, "end_pos": 217 }, { "start_pos": 242, "end_pos": 244 }, { "start_pos": 416, "end_pos": 418 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 234 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }