{ "uniprot_canonical_ac": "O14964-1", "uniprot_ac": "O14964", "uniprot_id": "HGS_HUMAN", "mass": { "chemical_mass": 86192.0, "monoisotopic_mass": 86192.0 }, "refseq": { "ac": "NP_004703", "name": "hepatocyte growth factor-regulated tyrosine kinase substrate", "summary": "The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these proteins for lysosome-dependent degradation. [provided by RefSeq, Dec 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703" }, "gene_names": [ { "name": "HGS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14964", "id": "O14964" }, { "name": "HGS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703", "id": "NP_004703" }, { "name": "HRS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703", "id": "NP_004703" }, { "name": "HRS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14964", "id": "O14964" }, { "name": "hCG_1987560", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14964", "id": "O14964" } ], "protein_names": [ { "name": "Hepatocyte growth factor-regulated tyrosine kinase substrate", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14964" }, { "name": "Hrs", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14964" }, { "name": "Protein pp110", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14964" }, { "name": "hepatocyte growth factor-regulated tyrosine kinase substrate", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703", "id": "NP_004703" }, { "name": "human growth factor-regulated tyrosine kinase substrate; protein pp110", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703", "id": "NP_004703" } ], "function": [ { "annotation": "Epstein-Barr Virus LMP1 Promotes Syntenin-1- and Hrs-Induced Extracellular Vesicle Formation for Its Own Secretion To Increase Cell Proliferation and Migration. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004703", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703" }, { "database": "PubMed", "id": "32546618", "url": "https://glygen.org/publication/PubMed/32546618" } ] }, { "annotation": "HRS Regulates Small Extracellular Vesicle PD-L1 Secretion and Is Associated with Anti-PD-1 Treatment Efficacy.", "evidence": [ { "database": "RefSeq", "id": "NP_004703", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703" }, { "database": "PubMed", "id": "36484721", "url": "https://glygen.org/publication/PubMed/36484721" } ] }, { "annotation": "Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. May contribute to the efficient recruitment of SMADs to the activin receptor complex. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation.", "evidence": [ { "database": "UniProtKB", "id": "A0A7I2V3Z1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3Z1#function" }, { "database": "UniProtKB", "id": "PIRNR036956", "url": "https://www.uniprot.org/uniprot/PIRNR036956#function" }, { "database": "UniProtKB", "id": "A0A7I2V3J3", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J3#function" }, { "database": "UniProtKB", "id": "A0A7I2V3I8", "url": "https://www.uniprot.org/uniprot/A0A7I2V3I8#function" }, { "database": "UniProtKB", "id": "A0A7I2V5A2", "url": "https://www.uniprot.org/uniprot/A0A7I2V5A2#function" }, { "database": "UniProtKB", "id": "A0A7I2V2K2", "url": "https://www.uniprot.org/uniprot/A0A7I2V2K2#function" }, { "database": "UniProtKB", "id": "A0A7I2V3F9", "url": "https://www.uniprot.org/uniprot/A0A7I2V3F9#function" }, { "database": "UniProtKB", "id": "A0A7I2V2D8", "url": "https://www.uniprot.org/uniprot/A0A7I2V2D8#function" }, { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964#function" }, { "database": "UniProtKB", "id": "A0A7I2V2R9", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R9#function" }, { "database": "UniProtKB", "id": "A0A7I2V5A3", "url": "https://www.uniprot.org/uniprot/A0A7I2V5A3#function" }, { "database": "UniProtKB", "id": "A0A7I2V307", "url": "https://www.uniprot.org/uniprot/A0A7I2V307#function" }, { "database": "UniProtKB", "id": "A0A7I2V2W5", "url": "https://www.uniprot.org/uniprot/A0A7I2V2W5#function" }, { "database": "UniProtKB", "id": "A0A7I2V6E0", "url": "https://www.uniprot.org/uniprot/A0A7I2V6E0#function" }, { "database": "UniProtKB", "id": "A0A7I2V637", "url": "https://www.uniprot.org/uniprot/A0A7I2V637#function" } ] }, { "annotation": "The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these proteins for lysosome-dependent degradation. [provided by RefSeq, Dec 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_004703", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs200261729", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200261729" }, { "id": "rs200261729", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200261729" }, { "id": "rs200261729", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200261729" }, { "id": "rs200261729", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200261729" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 297, "end_pos": 297, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAS->NAS); o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "81693946", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S297", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1156766861", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1156766861" }, { "id": "rs1156766861", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1156766861#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 123, "end_pos": 123, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEP->NES).", "chr_id": "17", "chr_pos": "81688779", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761223362", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761223362" }, { "id": "rs761223362", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761223362" }, { "id": "rs761223362", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761223362" }, { "id": "rs761223362", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761223362#frequency_tab" }, { "id": "rs761223362", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761223362" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 297, "end_pos": 297, "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "81693919", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S297", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs748310683", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748310683" }, { "id": "rs748310683", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748310683" }, { "id": "rs748310683", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748310683#frequency_tab" }, { "id": "rs748310683", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748310683" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 297, "end_pos": 297, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "17", "chr_pos": "81693947", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S297", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752721915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752721915#frequency_tab" }, { "id": "rs752721915", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752721915" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 299, "end_pos": 299, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "81694822", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S299", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368956382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368956382" }, { "id": "rs368956382", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368956382" }, { "id": "rs368956382", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368956382#frequency_tab" }, { "id": "rs368956382", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368956382" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 300, "end_pos": 300, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "81693955", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S300", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753695876", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753695876" }, { "id": "rs753695876", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753695876" }, { "id": "rs753695876", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753695876#frequency_tab" }, { "id": "rs753695876", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753695876" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 305, "end_pos": 305, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "81694819", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S305", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757034358", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757034358" }, { "id": "rs757034358", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757034358" }, { "id": "rs757034358", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757034358" }, { "id": "rs757034358", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757034358#frequency_tab" }, { "id": "rs757034358", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757034358" }, { "id": "rs752721915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752721915#frequency_tab" }, { "id": "rs752721915", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752721915" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 306, "end_pos": 306, "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "81693892", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S306", "keywords": [ "ebi", "somatic", "germline" ] }, { "evidence": [ { "id": "rs200261729", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200261729" }, { "id": "rs200261729", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200261729" }, { "id": "rs200261729", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200261729" }, { "id": "rs200261729", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200261729" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 306, "end_pos": 306, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "81693946", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S306", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748310683", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748310683" }, { "id": "rs748310683", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748310683" }, { "id": "rs748310683", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748310683#frequency_tab" }, { "id": "rs748310683", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748310683" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 306, "end_pos": 306, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "17", "chr_pos": "81693947", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S306", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368956382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368956382" }, { "id": "rs368956382", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368956382" }, { "id": "rs368956382", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368956382#frequency_tab" }, { "id": "rs368956382", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368956382" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 309, "end_pos": 309, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "81693955", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S309", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368956382", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368956382" }, { "id": "rs368956382", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368956382" }, { "id": "rs368956382", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368956382#frequency_tab" }, { "id": "rs368956382", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368956382" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 315, "end_pos": 315, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "81693955", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S315", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761223362", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761223362" }, { "id": "rs761223362", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761223362" }, { "id": "rs761223362", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761223362" }, { "id": "rs761223362", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761223362#frequency_tab" }, { "id": "rs761223362", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761223362" }, { "id": "rs752721915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752721915" }, { "id": "rs752721915", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752721915#frequency_tab" }, { "id": "rs752721915", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752721915" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 315, "end_pos": 315, "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "17", "chr_pos": "81693919", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S315", "keywords": [ "ebi", "somatic", "germline" ] }, { "evidence": [ { "id": "rs1204769539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1204769539" }, { "id": "rs1204769539", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1204769539" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 423, "end_pos": 423, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRM->NRT).", "chr_id": "17", "chr_pos": "81695874", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M423", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1327545344", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1327545344" }, { "id": "rs1327545344", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1327545344" }, { "id": "24293293", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24293293" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 449, "end_pos": 449, "sequence_org": "M", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGM->NGT).", "chr_id": "17", "chr_pos": "81695952", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M449", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1464903049", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1464903049" }, { "id": "rs1464903049", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1464903049#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 56, "end_pos": 56, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDK->NDT).", "chr_id": "17", "chr_pos": "81696522", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1238298006", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1238298006" }, { "id": "rs1238298006", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1238298006" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 5, "end_pos": 5, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGT->NGT).", "chr_id": "17", "chr_pos": "81684080", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S5", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1182277373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1182277373" }, { "id": "rs1182277373", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1182277373#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 655, "end_pos": 655, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TAS->NAS).", "chr_id": "17", "chr_pos": "81700548", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T655", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs868028906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868028906" }, { "id": "rs868028906", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs868028906" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 675, "end_pos": 675, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVA->NVT).", "chr_id": "17", "chr_pos": "81700728", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A675", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1024240487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1024240487" }, { "id": "rs1024240487", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1024240487#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 699, "end_pos": 699, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SQS->NQS).", "chr_id": "17", "chr_pos": "81700720", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S699", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs966141298", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs966141298" }, { "id": "rs966141298", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs966141298#frequency_tab" }, { "id": "rs1275220823", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1275220823" }, { "id": "rs1275220823", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1275220823" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 715, "end_pos": 715, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLM->NLT).", "chr_id": "17", "chr_pos": "81701052", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M715", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762698008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762698008" }, { "id": "rs762698008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762698008" }, { "id": "rs762698008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762698008" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 722, "end_pos": 722, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "17", "chr_pos": "81701072", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D722", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 266, "end_pos": 266, "sequence_org": "A", "sequence_mut": "Q", "comment": "Strongly reduced ubiquitin-binding. Reduced degradation of ubiquitinated EGFR.", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "PubMed", "id": "16462748", "url": "https://glygen.org/publication/PubMed/16462748" } ] }, { "start_pos": 268, "end_pos": 268, "sequence_org": "A", "sequence_mut": "Q", "comment": "Strongly reduced ubiquitin-binding. Reduced degradation of ubiquitinated EGFR.", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "PubMed", "id": "16462748", "url": "https://glygen.org/publication/PubMed/16462748" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "90.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "92.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "96.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "89.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "90.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "96.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "90.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "90.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14964", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14964" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "common_name": "Human" } ], "gene": [ { "name": "HGS", "url": "https://www.uniprot.org/uniprot/O14964", "locus": { "chromosome": "17", "start_pos": 81703138, "end_pos": 81683326, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185359", "url": "https://www.ensembl.org/id/ENSG00000185359" } ] } } ], "crossref": [ { "id": "ENSG00000185359", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185359", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03569", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03569", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd15720", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15720", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21387", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21387", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "HGS", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HGS", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9146", "url": "https://www.ncbi.nlm.nih.gov/gene/9146", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4897", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4897", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14964", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14964*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000306", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000306", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003903", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003903", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008942", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008942", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011011", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011011", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017073", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017073", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017455", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017455", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024641", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024641", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9146", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9146", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604375", "url": "http://www.omim.org/entry/604375", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14964", "url": "https://www.nextprot.org/entry/NX_O14964", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14964", "url": "https://oglcnac.org/atlas/detail/O14964", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DQQCSAK", "url": "https://omabrowser.org/oma/group/DQQCSAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "922060at2759", "url": "http://www.orthodb.org/?query=922060at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46275", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46275", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46275:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46275:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2D3G", "url": "https://www.rcsb.org/structure/2D3G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3F1I", "url": "https://www.rcsb.org/structure/3F1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OBQ", "url": "https://www.rcsb.org/structure/3OBQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZYQ", "url": "https://www.rcsb.org/structure/3ZYQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AVX", "url": "https://www.rcsb.org/structure/4AVX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00790", "url": "http://pfam.xfam.org/family/PF00790", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01363", "url": "http://pfam.xfam.org/family/PF01363", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12210", "url": "http://pfam.xfam.org/family/PF12210", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14964", "url": "https://pharos.nih.gov/targets/O14964", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14964", "url": "http://purl.obolibrary.org/obo/PR_O14964", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8875360", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875360", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9635644", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9635644", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9636383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004703", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7I2V2D8", "url": "https://www.uniprot.org/uniprot/A0A7I2V2D8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2D8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2D8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2K1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2K1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2K1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2K1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2K2", "url": "https://www.uniprot.org/uniprot/A0A7I2V2K2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2K2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2K2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2M1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2M1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2M1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2M1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2M4", "url": "https://www.uniprot.org/uniprot/A0A7I2V2M4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2M4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2M4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2R9", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2R9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2W5", "url": "https://www.uniprot.org/uniprot/A0A7I2V2W5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2W5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2W5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V307", "url": "https://www.uniprot.org/uniprot/A0A7I2V307", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V307-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V307-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V310", "url": "https://www.uniprot.org/uniprot/A0A7I2V310", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V310-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V310-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V319", "url": "https://www.uniprot.org/uniprot/A0A7I2V319", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V319-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V319-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V331", "url": "https://www.uniprot.org/uniprot/A0A7I2V331", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V331-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V331-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V363", "url": "https://www.uniprot.org/uniprot/A0A7I2V363", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V363-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V363-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3A5", "url": "https://www.uniprot.org/uniprot/A0A7I2V3A5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3A5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3A5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3C3", "url": "https://www.uniprot.org/uniprot/A0A7I2V3C3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3C3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3C3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3E9", "url": "https://www.uniprot.org/uniprot/A0A7I2V3E9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3E9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3E9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3F9", "url": "https://www.uniprot.org/uniprot/A0A7I2V3F9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3F9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3F9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3I8", "url": "https://www.uniprot.org/uniprot/A0A7I2V3I8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3I8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3I8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J3", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3L0", "url": "https://www.uniprot.org/uniprot/A0A7I2V3L0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3L0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3L0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3N6", "url": "https://www.uniprot.org/uniprot/A0A7I2V3N6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3N6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3N6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3Q7", "url": "https://www.uniprot.org/uniprot/A0A7I2V3Q7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3Q7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3Q7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3Z1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3Z1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3Z1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3Z1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V468", "url": "https://www.uniprot.org/uniprot/A0A7I2V468", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V468-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V468-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4J7", "url": "https://www.uniprot.org/uniprot/A0A7I2V4J7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4J7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4J7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4M9", "url": "https://www.uniprot.org/uniprot/A0A7I2V4M9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4M9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4M9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4X6", "url": "https://www.uniprot.org/uniprot/A0A7I2V4X6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4X6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4X6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4Z5", "url": "https://www.uniprot.org/uniprot/A0A7I2V4Z5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4Z5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4Z5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V558", "url": "https://www.uniprot.org/uniprot/A0A7I2V558", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V558-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V558-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V569", "url": "https://www.uniprot.org/uniprot/A0A7I2V569", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V569-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V569-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5A2", "url": "https://www.uniprot.org/uniprot/A0A7I2V5A2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5A2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5A2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5A3", "url": "https://www.uniprot.org/uniprot/A0A7I2V5A3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5A3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5A3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5B7", "url": "https://www.uniprot.org/uniprot/A0A7I2V5B7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5B7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5B7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5C4", "url": "https://www.uniprot.org/uniprot/A0A7I2V5C4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5C4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5C4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5D6", "url": "https://www.uniprot.org/uniprot/A0A7I2V5D6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5D6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5D6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5E5", "url": "https://www.uniprot.org/uniprot/A0A7I2V5E5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5E5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5E5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5E7", "url": "https://www.uniprot.org/uniprot/A0A7I2V5E7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5E7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5E7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5L9", "url": "https://www.uniprot.org/uniprot/A0A7I2V5L9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5L9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5L9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5N3", "url": "https://www.uniprot.org/uniprot/A0A7I2V5N3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5N3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5N3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5V1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5V1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5V1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5V1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5W6", "url": "https://www.uniprot.org/uniprot/A0A7I2V5W6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5W6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5W6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5X2", "url": "https://www.uniprot.org/uniprot/A0A7I2V5X2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5X2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5X2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V605", "url": "https://www.uniprot.org/uniprot/A0A7I2V605", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V605-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V605-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V611", "url": "https://www.uniprot.org/uniprot/A0A7I2V611", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V611-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V611-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V616", "url": "https://www.uniprot.org/uniprot/A0A7I2V616", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V616-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V616-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V628", "url": "https://www.uniprot.org/uniprot/A0A7I2V628", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V628-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V628-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V637", "url": "https://www.uniprot.org/uniprot/A0A7I2V637", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V637-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V637-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V674", "url": "https://www.uniprot.org/uniprot/A0A7I2V674", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V674-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V674-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V6E0", "url": "https://www.uniprot.org/uniprot/A0A7I2V6E0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V6E0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V6E0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQD1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQD1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQD1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQD1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQH7", "url": "https://www.uniprot.org/uniprot/A0A7I2YQH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQH7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQH7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQM4", "url": "https://www.uniprot.org/uniprot/A0A7I2YQM4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQM4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQM4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQM9", "url": "https://www.uniprot.org/uniprot/A0A7I2YQM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQM9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQM9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQP0", "url": "https://www.uniprot.org/uniprot/A0A7I2YQP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQP0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQP0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQS8", "url": "https://www.uniprot.org/uniprot/A0A7I2YQS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQS8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQU5", "url": "https://www.uniprot.org/uniprot/A0A7I2YQU5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQU5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQU5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQY0", "url": "https://www.uniprot.org/uniprot/A0A7I2YQY0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQY0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQY0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L165", "url": "https://www.uniprot.org/uniprot/I3L165", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L165-1", "url": "https://www.uniprot.org/uniprot/I3L165-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1E3", "url": "https://www.uniprot.org/uniprot/I3L1E3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1E3-1", "url": "https://www.uniprot.org/uniprot/I3L1E3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1F1", "url": "https://www.uniprot.org/uniprot/I3L1F1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1F1-1", "url": "https://www.uniprot.org/uniprot/I3L1F1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1P5", "url": "https://www.uniprot.org/uniprot/I3L1P5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1P5-1", "url": "https://www.uniprot.org/uniprot/I3L1P5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2H4", "url": "https://www.uniprot.org/uniprot/I3L2H4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2H4-1", "url": "https://www.uniprot.org/uniprot/I3L2H4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L326", "url": "https://www.uniprot.org/uniprot/I3L326", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L326-1", "url": "https://www.uniprot.org/uniprot/I3L326-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L346", "url": "https://www.uniprot.org/uniprot/I3L346", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L346-1", "url": "https://www.uniprot.org/uniprot/I3L346-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14964-1", "url": "https://www.uniprot.org/uniprot/O14964-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14964-2", "url": "https://www.uniprot.org/uniprot/O14964-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 777, "header": "sp|O14964-1|HGS_HUMAN Isoform 1 of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V2D8-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 767, "header": "tr|A0A7I2V2D8-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677243.1", "url": "https://www.ensembl.org/id/ENST00000677243.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502851.1", "url": "https://www.ensembl.org/id/ENSP00000502851.1" } ] } }, { "isoform_ac": "A0A7I2V2K1-1", "url": "", "sequence": { "sequence": "NSSAPLAEDIDPEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVE", "length": 50, "header": "tr|A0A7I2V2K1-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81695067, "end_pos": 81694815, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678406.1", "url": "https://www.ensembl.org/id/ENST00000678406.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502956.1", "url": "https://www.ensembl.org/id/ENSP00000502956.1" } ] } }, { "isoform_ac": "A0A7I2V2K2-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNLMTTLPSQDASLPPQQPYIAGQQPMYQQGETHTRGPFSADRTRTQVSGQIRASASVDRKNREFT", "length": 737, "header": "tr|A0A7I2V2K2-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701351, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679336.1", "url": "https://www.ensembl.org/id/ENST00000679336.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502961.1", "url": "https://www.ensembl.org/id/ENSP00000502961.1" } ] } }, { "isoform_ac": "A0A7I2V2M1-1", "url": "", "sequence": { "sequence": "XHVFPEFKESPRLGGR", "length": 16, "header": "tr|A0A7I2V2M1-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81690694, "end_pos": 81690182, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677818.1", "url": "https://www.ensembl.org/id/ENST00000677818.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502990.1", "url": "https://www.ensembl.org/id/ENSP00000502990.1" } ] } }, { "isoform_ac": "A0A7I2V2M4-1", "url": "", "sequence": { "sequence": "NSSAPLAEDIDPENPLPETDSQPIPPSGGPFSE", "length": 33, "header": "tr|A0A7I2V2M4-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81695223, "end_pos": 81694815, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678926.1", "url": "https://www.ensembl.org/id/ENST00000678926.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502989.1", "url": "https://www.ensembl.org/id/ENSP00000502989.1" } ] } }, { "isoform_ac": "A0A7I2V2R9-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 768, "header": "tr|A0A7I2V2R9-1|A0A7I2V2R9_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676462.1", "url": "https://www.ensembl.org/id/ENST00000676462.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503043.1", "url": "https://www.ensembl.org/id/ENSP00000503043.1" } ] } }, { "isoform_ac": "A0A7I2V2W5-1", "url": "", "sequence": { "sequence": "MMTDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 768, "header": "tr|A0A7I2V2W5-1|A0A7I2V2W5_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81685060, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676729.1", "url": "https://www.ensembl.org/id/ENST00000676729.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503138.1", "url": "https://www.ensembl.org/id/ENSP00000503138.1" } ] } }, { "isoform_ac": "A0A7I2V307-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNSIPCAHRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 783, "header": "tr|A0A7I2V307-1|A0A7I2V307_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677484.1", "url": "https://www.ensembl.org/id/ENST00000677484.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503188.1", "url": "https://www.ensembl.org/id/ENSP00000503188.1" } ] } }, { "isoform_ac": "A0A7I2V310-1", "url": "", "sequence": { "sequence": "MESVVKNCGQTVHDEVANKQTMEELKDLLK", "length": 30, "header": "tr|A0A7I2V310-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81687095, "end_pos": 81687006, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677209.1", "url": "https://www.ensembl.org/id/ENST00000677209.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503175.1", "url": "https://www.ensembl.org/id/ENSP00000503175.1" } ] } }, { "isoform_ac": "A0A7I2V319-1", "url": "", "sequence": { "sequence": "EYLEVQRQLAIQRLQEQEKERQMRLEQQKQTLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAA", "length": 89, "header": "tr|A0A7I2V319-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696997, "end_pos": 81696607, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677728.1", "url": "https://www.ensembl.org/id/ENST00000677728.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503213.1", "url": "https://www.ensembl.org/id/ENSP00000503213.1" } ] } }, { "isoform_ac": "A0A7I2V331-1", "url": "", "sequence": { "sequence": "NPLPETDSQPIPPSGGPFSEFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERR", "length": 89, "header": "tr|A0A7I2V331-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81695998, "end_pos": 81695164, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678981.1", "url": "https://www.ensembl.org/id/ENST00000678981.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503275.1", "url": "https://www.ensembl.org/id/ENSP00000503275.1" } ] } }, { "isoform_ac": "A0A7I2V363-1", "url": "", "sequence": { "sequence": "NPLPETDSQPIPPSGGPFSENPALPAATVPQWRV", "length": 34, "header": "tr|A0A7I2V363-1|A0A7I2V363_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=4 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81695808, "end_pos": 81695164, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678142.1", "url": "https://www.ensembl.org/id/ENST00000678142.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503319.1", "url": "https://www.ensembl.org/id/ENSP00000503319.1" } ] } }, { "isoform_ac": "A0A7I2V3A5-1", "url": "", "sequence": { "sequence": "NLMTTLPSQDASLPPQQPYIAGQQPMYQQWGLSRTSAHRGRRIPEAPSQQTERGHKSQGRYAHPQV", "length": 66, "header": "tr|A0A7I2V3A5-1|A0A7I2V3A5_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=4 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701325, "end_pos": 81701045, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679340.1", "url": "https://www.ensembl.org/id/ENST00000679340.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503389.1", "url": "https://www.ensembl.org/id/ENSP00000503389.1" } ] } }, { "isoform_ac": "A0A7I2V3C3-1", "url": "", "sequence": { "sequence": "RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVELKDLLSGASTSPLPGLSPALSRGTRRRLWLRTSTLSSHGISTGTTGRRSRRRLARAPRHLRPCP", "length": 97, "header": "tr|A0A7I2V3C3-1|A0A7I2V3C3_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81695008, "end_pos": 81693870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677390.1", "url": "https://www.ensembl.org/id/ENST00000677390.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503349.1", "url": "https://www.ensembl.org/id/ENSP00000503349.1" } ] } }, { "isoform_ac": "A0A7I2V3E9-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDRFCIRERRCGQSWSCPPRGASCWRQQ", "length": 39, "header": "tr|A0A7I2V3E9-1|A0A7I2V3E9_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81685050, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679170.1", "url": "https://www.ensembl.org/id/ENST00000679170.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503359.1", "url": "https://www.ensembl.org/id/ENSP00000503359.1" } ] } }, { "isoform_ac": "A0A7I2V3F9-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPEKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 765, "header": "tr|A0A7I2V3F9-1|A0A7I2V3F9_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677109.1", "url": "https://www.ensembl.org/id/ENST00000677109.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503405.1", "url": "https://www.ensembl.org/id/ENSP00000503405.1" } ] } }, { "isoform_ac": "A0A7I2V3I8-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 761, "header": "tr|A0A7I2V3I8-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679191.1", "url": "https://www.ensembl.org/id/ENST00000679191.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503211.1", "url": "https://www.ensembl.org/id/ENSP00000503211.1" } ] } }, { "isoform_ac": "A0A7I2V3J3-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQGETHTRGPFSADRTRTQVSGQIRASASVDRKNREFT", "length": 777, "header": "tr|A0A7I2V3J3-1|A0A7I2V3J3_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701351, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678196.1", "url": "https://www.ensembl.org/id/ENST00000678196.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503545.1", "url": "https://www.ensembl.org/id/ENSP00000503545.1" } ] } }, { "isoform_ac": "A0A7I2V3L0-1", "url": "", "sequence": { "sequence": "XKAEGKATSTTELPPEYLTSPLSQQSQNSSAPLAEDIDPE", "length": 40, "header": "tr|A0A7I2V3L0-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81694853, "end_pos": 81693503, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678748.1", "url": "https://www.ensembl.org/id/ENST00000678748.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503483.1", "url": "https://www.ensembl.org/id/ENSP00000503483.1" } ] } }, { "isoform_ac": "A0A7I2V3N6-1", "url": "", "sequence": { "sequence": "NPLPETDSQPIPPSGGPFSECTMRGCRTSWHRSAMPGGR", "length": 39, "header": "tr|A0A7I2V3N6-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696413, "end_pos": 81695164, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678428.1", "url": "https://www.ensembl.org/id/ENST00000678428.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503616.1", "url": "https://www.ensembl.org/id/ENSP00000503616.1" } ] } }, { "isoform_ac": "A0A7I2V3Q7-1", "url": "", "sequence": { "sequence": "LPPKRDETALQEEEELQLALALSQSEAEEKERLKSTYTSYPKAEPMPSASSAPPASSLYSSPV", "length": 63, "header": "tr|A0A7I2V3Q7-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81693965, "end_pos": 81693654, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678478.1", "url": "https://www.ensembl.org/id/ENST00000678478.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503600.1", "url": "https://www.ensembl.org/id/ENSP00000503600.1" } ] } }, { "isoform_ac": "A0A7I2V3Z1-1", "url": "", "sequence": { "sequence": "MESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 690, "header": "tr|A0A7I2V3Z1-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81687006, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677161.1", "url": "https://www.ensembl.org/id/ENST00000677161.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503695.1", "url": "https://www.ensembl.org/id/ENSP00000503695.1" } ] } }, { "isoform_ac": "A0A7I2V468-1", "url": "", "sequence": { "sequence": "XPSMPTPTAGYQ", "length": 12, "header": "tr|A0A7I2V468-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81700600, "end_pos": 81700467, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678565.1", "url": "https://www.ensembl.org/id/ENST00000678565.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503803.1", "url": "https://www.ensembl.org/id/ENSP00000503803.1" } ] } }, { "isoform_ac": "A0A7I2V4J7-1", "url": "", "sequence": { "sequence": "XYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKSTWRCRGSWPSSACRSRRRSGRCGWSSRSRRSRCARRCPPSPCPTPSSRPCPQPEVCSTSPRDQPASPAPSALPARWRAPQCTACT", "length": 143, "header": "tr|A0A7I2V4J7-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696942, "end_pos": 81696357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677188.1", "url": "https://www.ensembl.org/id/ENST00000677188.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503993.1", "url": "https://www.ensembl.org/id/ENSP00000503993.1" } ] } }, { "isoform_ac": "A0A7I2V4M9-1", "url": "", "sequence": { "sequence": "RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVLARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVE", "length": 80, "header": "tr|A0A7I2V4M9-1|A0A7I2V4M9_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81695067, "end_pos": 81693870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679146.1", "url": "https://www.ensembl.org/id/ENST00000679146.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504113.1", "url": "https://www.ensembl.org/id/ENSP00000504113.1" } ] } }, { "isoform_ac": "A0A7I2V4X6-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERRPPPAACTLHL", "length": 167, "header": "tr|A0A7I2V4X6-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81693965, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679275.1", "url": "https://www.ensembl.org/id/ENST00000679275.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504270.1", "url": "https://www.ensembl.org/id/ENSP00000504270.1" } ] } }, { "isoform_ac": "A0A7I2V4Z5-1", "url": "", "sequence": { "sequence": "XKAEGKATSTTELPPEYLTSPLSQQSQRDETALQEEEELQLALALSQSEAEEKERL", "length": 56, "header": "tr|A0A7I2V4Z5-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81693752, "end_pos": 81693503, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676879.1", "url": "https://www.ensembl.org/id/ENST00000676879.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504244.1", "url": "https://www.ensembl.org/id/ENSP00000504244.1" } ] } }, { "isoform_ac": "A0A7I2V558-1", "url": "", "sequence": { "sequence": "LPPKRDETALQEEEELQLALALSQSEAEEKERLNSSAPLAEDIDPE", "length": 46, "header": "tr|A0A7I2V558-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81694853, "end_pos": 81693654, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678680.1", "url": "https://www.ensembl.org/id/ENST00000678680.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504409.1", "url": "https://www.ensembl.org/id/ENSP00000504409.1" } ] } }, { "isoform_ac": "A0A7I2V569-1", "url": "", "sequence": { "sequence": "XPSMVSAYMYPAGATGAQAAPQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQ", "length": 57, "header": "tr|A0A7I2V569-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81700814, "end_pos": 81700467, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677706.1", "url": "https://www.ensembl.org/id/ENST00000677706.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504348.1", "url": "https://www.ensembl.org/id/ENSP00000504348.1" } ] } }, { "isoform_ac": "A0A7I2V5A2-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 757, "header": "tr|A0A7I2V5A2-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678096.1", "url": "https://www.ensembl.org/id/ENST00000678096.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504478.1", "url": "https://www.ensembl.org/id/ENSP00000504478.1" } ] } }, { "isoform_ac": "A0A7I2V5A3-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQAMLTSGVTLHTVHLKRLVSNCRRPASLSSTAGSVPSLRVRGGLHPKPTSLVLSLLQSLS", "length": 800, "header": "tr|A0A7I2V5A3-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701800, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677044.1", "url": "https://www.ensembl.org/id/ENST00000677044.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504151.1", "url": "https://www.ensembl.org/id/ENSP00000504151.1" } ] } }, { "isoform_ac": "A0A7I2V5B7-1", "url": "", "sequence": { "sequence": "XYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQ", "length": 88, "header": "tr|A0A7I2V5B7-1|A0A7I2V5B7_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696747, "end_pos": 81696357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678667.1", "url": "https://www.ensembl.org/id/ENST00000678667.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504194.1", "url": "https://www.ensembl.org/id/ENSP00000504194.1" } ] } }, { "isoform_ac": "A0A7I2V5C4-1", "url": "", "sequence": { "sequence": "LQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAAET", "length": 60, "header": "tr|A0A7I2V5C4-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81699746, "end_pos": 81696824, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679036.1", "url": "https://www.ensembl.org/id/ENST00000679036.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504505.1", "url": "https://www.ensembl.org/id/ENSP00000504505.1" } ] } }, { "isoform_ac": "A0A7I2V5D6-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGPRLGGR", "length": 145, "header": "tr|A0A7I2V5D6-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81690693, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676478.1", "url": "https://www.ensembl.org/id/ENST00000676478.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504482.1", "url": "https://www.ensembl.org/id/ENSP00000504482.1" } ] } }, { "isoform_ac": "A0A7I2V5E5-1", "url": "", "sequence": { "sequence": "NLMTTLPSQDASLPPQQPYIAGQQPMYQQGETHTRGPFSADRTRTQVSGQIRASASVDRKNREFT", "length": 65, "header": "tr|A0A7I2V5E5-1|A0A7I2V5E5_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=4 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701351, "end_pos": 81701045, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677466.1", "url": "https://www.ensembl.org/id/ENST00000677466.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504390.1", "url": "https://www.ensembl.org/id/ENSP00000504390.1" } ] } }, { "isoform_ac": "A0A7I2V5E7-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQ", "length": 41, "header": "tr|A0A7I2V5E7-1|A0A7I2V5E7_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81685690, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677012.1", "url": "https://www.ensembl.org/id/ENST00000677012.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504241.1", "url": "https://www.ensembl.org/id/ENSP00000504241.1" } ] } }, { "isoform_ac": "A0A7I2V5L9-1", "url": "", "sequence": { "sequence": "XYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQTVQMRAQMPAFPLPYAQ", "length": 75, "header": "tr|A0A7I2V5L9-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696747, "end_pos": 81696357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678055.1", "url": "https://www.ensembl.org/id/ENST00000678055.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504559.1", "url": "https://www.ensembl.org/id/ENSP00000504559.1" } ] } }, { "isoform_ac": "A0A7I2V5N3-1", "url": "", "sequence": { "sequence": "HHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRFGKLRSEAMPSSGHPIQASHVR", "length": 64, "header": "tr|A0A7I2V5N3-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81692451, "end_pos": 81691447, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677872.1", "url": "https://www.ensembl.org/id/ENST00000677872.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504691.1", "url": "https://www.ensembl.org/id/ENSP00000504691.1" } ] } }, { "isoform_ac": "A0A7I2V5V1-1", "url": "", "sequence": { "sequence": "NVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQGYSLTSDVFSQQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 117, "header": "tr|A0A7I2V5V1-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81700695, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678607.1", "url": "https://www.ensembl.org/id/ENST00000678607.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504713.1", "url": "https://www.ensembl.org/id/ENSP00000504713.1" } ] } }, { "isoform_ac": "A0A7I2V5W6-1", "url": "", "sequence": { "sequence": "HHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRTSHPSQPCPVMGRCPESSFSFL", "length": 64, "header": "tr|A0A7I2V5W6-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81692489, "end_pos": 81691447, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677463.1", "url": "https://www.ensembl.org/id/ENST00000677463.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504743.1", "url": "https://www.ensembl.org/id/ENSP00000504743.1" } ] } }, { "isoform_ac": "A0A7I2V5X2-1", "url": "", "sequence": { "sequence": "HHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNSCPPRGTRRPCRRRRSCSWPWRCHSQRRRRRRG", "length": 74, "header": "tr|A0A7I2V5X2-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81693752, "end_pos": 81691447, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679168.1", "url": "https://www.ensembl.org/id/ENST00000679168.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504810.1", "url": "https://www.ensembl.org/id/ENSP00000504810.1" } ] } }, { "isoform_ac": "A0A7I2V605-1", "url": "", "sequence": { "sequence": "EYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAA", "length": 103, "header": "tr|A0A7I2V605-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696997, "end_pos": 81696607, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678176.1", "url": "https://www.ensembl.org/id/ENST00000678176.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504798.1", "url": "https://www.ensembl.org/id/ENSP00000504798.1" } ] } }, { "isoform_ac": "A0A7I2V611-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALE", "length": 66, "header": "tr|A0A7I2V611-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81686387, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676721.1", "url": "https://www.ensembl.org/id/ENST00000676721.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504783.1", "url": "https://www.ensembl.org/id/ENSP00000504783.1" } ] } }, { "isoform_ac": "A0A7I2V616-1", "url": "", "sequence": { "sequence": "EYLEQQKQTVQMRAQMPAFPLPYAQ", "length": 25, "header": "tr|A0A7I2V616-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696747, "end_pos": 81696607, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677511.1", "url": "https://www.ensembl.org/id/ENST00000677511.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504732.1", "url": "https://www.ensembl.org/id/ENSP00000504732.1" } ] } }, { "isoform_ac": "A0A7I2V628-1", "url": "", "sequence": { "sequence": "RQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEEFKESDAMFAAER", "length": 54, "header": "tr|A0A7I2V628-1|A0A7I2V628_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81690234, "end_pos": 81688704, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676898.1", "url": "https://www.ensembl.org/id/ENST00000676898.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504738.1", "url": "https://www.ensembl.org/id/ENSP00000504738.1" } ] } }, { "isoform_ac": "A0A7I2V637-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEEGPCPDHWPNPSLPGHLQVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 795, "header": "tr|A0A7I2V637-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678866.1", "url": "https://www.ensembl.org/id/ENST00000678866.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504854.1", "url": "https://www.ensembl.org/id/ENSP00000504854.1" } ] } }, { "isoform_ac": "A0A7I2V674-1", "url": "", "sequence": { "sequence": "RQVEVNVRNKILYLIQAWAHAFRNEPKYKGTSFQNSKRAMPCLLPREPQTGWTLRNATAAGCSSG", "length": 65, "header": "tr|A0A7I2V674-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81690728, "end_pos": 81688704, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678893.1", "url": "https://www.ensembl.org/id/ENST00000678893.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504821.1", "url": "https://www.ensembl.org/id/ENSP00000504821.1" } ] } }, { "isoform_ac": "A0A7I2V6E0-1", "url": "", "sequence": { "sequence": "MESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 710, "header": "tr|A0A7I2V6E0-1|A0A7I2V6E0_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81687006, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678105.1", "url": "https://www.ensembl.org/id/ENST00000678105.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504789.1", "url": "https://www.ensembl.org/id/ENSP00000504789.1" } ] } }, { "isoform_ac": "A0A7I2YQD1-1", "url": "", "sequence": { "sequence": "DWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEE", "length": 458, "header": "tr|A0A7I2YQD1-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696466, "end_pos": 81685637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678846.1", "url": "https://www.ensembl.org/id/ENST00000678846.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503372.1", "url": "https://www.ensembl.org/id/ENSP00000503372.1" } ] } }, { "isoform_ac": "A0A7I2YQH7-1", "url": "", "sequence": { "sequence": "LQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAAESRCHPGWSAVP", "length": 70, "header": "tr|A0A7I2YQH7-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81697900, "end_pos": 81696824, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678896.1", "url": "https://www.ensembl.org/id/ENST00000678896.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503714.1", "url": "https://www.ensembl.org/id/ENSP00000503714.1" } ] } }, { "isoform_ac": "A0A7I2YQM4-1", "url": "", "sequence": { "sequence": "XPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQPYNMQ", "length": 50, "header": "tr|A0A7I2YQM4-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81700814, "end_pos": 81700467, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678550.1", "url": "https://www.ensembl.org/id/ENST00000678550.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504052.1", "url": "https://www.ensembl.org/id/ENSP00000504052.1" } ] } }, { "isoform_ac": "A0A7I2YQM9-1", "url": "", "sequence": { "sequence": "XPSMNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQ", "length": 44, "header": "tr|A0A7I2YQM9-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81700814, "end_pos": 81700467, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676665.1", "url": "https://www.ensembl.org/id/ENST00000676665.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504079.1", "url": "https://www.ensembl.org/id/ENSP00000504079.1" } ] } }, { "isoform_ac": "A0A7I2YQP0-1", "url": "", "sequence": { "sequence": "RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVMPFSPQNSSAPLAEDIDPE", "length": 51, "header": "tr|A0A7I2YQP0-1|A0A7I2YQP0_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81694853, "end_pos": 81693870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677132.1", "url": "https://www.ensembl.org/id/ENST00000677132.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504147.1", "url": "https://www.ensembl.org/id/ENSP00000504147.1" } ] } }, { "isoform_ac": "A0A7I2YQS8-1", "url": "", "sequence": { "sequence": "RQKSTYTSYPKAEPMPSASSAPPASSLYSSPNSSAPLAEDIDPE", "length": 44, "header": "tr|A0A7I2YQS8-1|A0A7I2YQS8_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81694853, "end_pos": 81693870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676963.1", "url": "https://www.ensembl.org/id/ENST00000676963.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504434.1", "url": "https://www.ensembl.org/id/ENSP00000504434.1" } ] } }, { "isoform_ac": "A0A7I2YQU5-1", "url": "", "sequence": { "sequence": "XYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQVSTWRCRGSWPSSACRSRRRSGRCGWSSRSRRSRCARRCPPSPCPTPSSRPCPQPEVCSTSPRDQPASPAPSALPARWRAPQCTACT", "length": 145, "header": "tr|A0A7I2YQU5-1|A0A7I2YQU5_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696942, "end_pos": 81696357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676704.1", "url": "https://www.ensembl.org/id/ENST00000676704.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504565.1", "url": "https://www.ensembl.org/id/ENSP00000504565.1" } ] } }, { "isoform_ac": "A0A7I2YQY0-1", "url": "", "sequence": { "sequence": "RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVVSGPWAGAPSPGRQ", "length": 46, "header": "tr|A0A7I2YQY0-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81694007, "end_pos": 81693870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678907.1", "url": "https://www.ensembl.org/id/ENST00000678907.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504806.1", "url": "https://www.ensembl.org/id/ENSP00000504806.1" } ] } }, { "isoform_ac": "I3L165-1", "url": "", "sequence": { "sequence": "MESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVE", "length": 71, "header": "tr|I3L165-1|I3L165_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81688826, "end_pos": 81687006, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000577012.1", "url": "https://www.ensembl.org/id/ENST00000577012.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000458603.1", "url": "https://www.ensembl.org/id/ENSP00000458603.1" } ] } }, { "isoform_ac": "I3L1E3-1", "url": "", "sequence": { "sequence": "RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSESINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMP", "length": 292, "header": "tr|I3L1E3-1|I3L1E3_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696985, "end_pos": 81693870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000571237.1", "url": "https://www.ensembl.org/id/ENST00000571237.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000458775.1", "url": "https://www.ensembl.org/id/ENSP00000458775.1" } ] } }, { "isoform_ac": "I3L1F1-1", "url": "", "sequence": { "sequence": "NLMTTLPSQDASLPPQQPYIAGQQPMYQWHPLAVPPSSSPPWPSNRRHRGRRHRAARPSSFHSTDPGHAHVRSNTTYSSPETPRL", "length": 85, "header": "tr|I3L1F1-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=2 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701679, "end_pos": 81701045, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000573320.2", "url": "https://www.ensembl.org/id/ENST00000573320.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000458789.2", "url": "https://www.ensembl.org/id/ENSP00000458789.2" } ] } }, { "isoform_ac": "I3L1P5-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRRRCPRHGASAQGQPVYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQ", "length": 536, "header": "tr|I3L1P5-1|I3L1P5_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=2 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81696529, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000572392.2", "url": "https://www.ensembl.org/id/ENST00000572392.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000458987.2", "url": "https://www.ensembl.org/id/ENSP00000458987.2" } ] } }, { "isoform_ac": "I3L2H4-1", "url": "", "sequence": { "sequence": "XKATSQLLLETDWESILQICDLIRQGDTHKICCEFHQEESQRQEPTRRLVCPGGHGICGKELWPDSS", "length": 67, "header": "tr|I3L2H4-1|I3L2H4_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=2 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81687044, "end_pos": 81685605, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000571518.6", "url": "https://www.ensembl.org/id/ENST00000571518.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000459685.2", "url": "https://www.ensembl.org/id/ENSP00000459685.2" } ] } }, { "isoform_ac": "I3L326-1", "url": "", "sequence": { "sequence": "NVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNIIS", "length": 41, "header": "tr|I3L326-1|HGS_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=2 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701051, "end_pos": 81700695, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000575078.6", "url": "https://www.ensembl.org/id/ENST00000575078.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000460130.2", "url": "https://www.ensembl.org/id/ENSP00000460130.2" } ] } }, { "isoform_ac": "I3L346-1", "url": "", "sequence": { "sequence": "WGLSRTSAHRGRRIPEAPSQQTERGHKSQGRYAHPQV", "length": 37, "header": "tr|I3L346-1|I3L346_HUMAN Computationally mapped isoform of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=4 SV=2 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701325, "end_pos": 81701215, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677663.1", "url": "https://www.ensembl.org/id/ENST00000677663.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503376.1", "url": "https://www.ensembl.org/id/ENSP00000503376.1" } ] } }, { "isoform_ac": "O14964-1", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 777, "header": "sp|O14964-1|HGS_HUMAN Isoform 1 of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": { "chromosome": "17", "start_pos": 81701615, "end_pos": 81684067, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000329138.9", "url": "https://www.ensembl.org/id/ENST00000329138.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000331201.4", "url": "https://www.ensembl.org/id/ENSP00000331201.4" } ] } }, { "isoform_ac": "O14964-2", "url": "", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD", "length": 690, "header": "sp|O14964-2|HGS_HUMAN Isoform 2 of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1 CANONICAL=O14964-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 297, "start_aa": "Ser", "end_pos": 297, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser297", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 299, "start_aa": "Ser", "end_pos": 299, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser299", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 300, "start_aa": "Ser", "end_pos": 300, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser300", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 305, "start_aa": "Ser", "end_pos": 305, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser305", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 306, "start_aa": "Ser", "end_pos": 306, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser306", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 309, "start_aa": "Ser", "end_pos": 309, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser309", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 310, "start_aa": "Ser", "end_pos": 310, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser310", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 315, "start_aa": "Ser", "end_pos": 315, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser315", "evidence": [ { "id": "O14964", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "O14964", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14964" } ] } ], "phosphorylation": [ { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "phospho.ELM", "id": "O14964", "url": "http://phospho.elm.eu.org/byAccession/O14964.html" } ], "site_lbl": "Tyr132" }, { "start_pos": 198, "end_pos": 198, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser198" }, { "start_pos": 216, "end_pos": 216, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" }, { "database": "phospho.ELM", "id": "O14964", "url": "http://phospho.elm.eu.org/byAccession/O14964.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr216" }, { "start_pos": 240, "end_pos": 240, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser240" }, { "start_pos": 308, "end_pos": 308, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "16212419", "url": "https://glygen.org/publication/PubMed/16212419" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "phospho.ELM", "id": "O14964", "url": "http://phospho.elm.eu.org/byAccession/O14964.html" } ], "site_lbl": "Tyr308" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O14964", "url": "http://phospho.elm.eu.org/byAccession/O14964.html" } ], "site_lbl": "Ser310" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "12953068", "url": "https://glygen.org/publication/PubMed/12953068" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "phospho.ELM", "id": "O14964", "url": "http://phospho.elm.eu.org/byAccession/O14964.html" } ], "site_lbl": "Tyr329" }, { "start_pos": 329, "end_pos": 329, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "12953068", "url": "https://glygen.org/publication/PubMed/12953068" }, { "database": "PubMed", "id": "17101784", "url": "https://glygen.org/publication/PubMed/17101784" } ], "site_lbl": "Tyr329" }, { "start_pos": 334, "end_pos": 334, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "12953068", "url": "https://glygen.org/publication/PubMed/12953068" } ], "site_lbl": "Tyr334" }, { "start_pos": 334, "end_pos": 334, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "11687594", "url": "https://glygen.org/publication/PubMed/11687594" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "phospho.ELM", "id": "O14964", "url": "http://phospho.elm.eu.org/byAccession/O14964.html" }, { "database": "PubMed", "id": "12953068", "url": "https://glygen.org/publication/PubMed/12953068" }, { "database": "PubMed", "id": "17101784", "url": "https://glygen.org/publication/PubMed/17101784" } ], "site_lbl": "Tyr334" }, { "start_pos": 345, "end_pos": 345, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ], "site_lbl": "Ser345" }, { "start_pos": 567, "end_pos": 567, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr567" }, { "start_pos": 594, "end_pos": 594, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser594" }, { "start_pos": 625, "end_pos": 625, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "32387766", "url": "" } ], "site_lbl": "Thr625" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The beta2-adrenergic receptor/betaarrestin complex recruits the clathrin adaptor AP-2 during endocytosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Laporte SA, Oakley RH, Zhang J, Holt JA, Ferguson SS, Caron MG, Barak LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10097102", "url": "https://glygen.org/publication/PubMed/10097102" } ] }, { "title": "Functional organization of clathrin in coats: combining electron cryomicroscopy and X-ray crystallography.", "journal": "Molecular cell", "date": "1999", "authors": "Musacchio A, Smith CJ, Roseman AM, Harrison SC, Kirchhausen T, Pearse BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "10394364", "url": "https://glygen.org/publication/PubMed/10394364" } ] }, { "title": "Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Tebar F, Bohlander SK, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10436022", "url": "https://glygen.org/publication/PubMed/10436022" } ] }, { "title": "Characterization of a fourth adaptor-related protein complex.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Hirst J, Bright NA, Rous B, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "10436028", "url": "https://glygen.org/publication/PubMed/10436028" } ] }, { "title": "Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases.", "journal": "Genomics", "date": "1999", "authors": "Baker RT, Wang XW, Woollatt E, White JA, Sutherland GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10444327", "url": "https://glygen.org/publication/PubMed/10444327" } ] }, { "title": "The tyrosine kinase negative regulator c-Cbl as a RING-type, E2-dependent ubiquitin-protein ligase.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Joazeiro CA, Wing SS, Huang H, Leverson JD, Hunter T, Liu YC", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "10514377", "url": "https://glygen.org/publication/PubMed/10514377" } ] }, { "title": "Essential role of phosphoinositide metabolism in synaptic vesicle recycling.", "journal": "Cell", "date": "1999", "authors": "Cremona O, Di Paolo G, Wenk MR, Luthi A, Kim WT, Takei K, Daniell L, Nemoto Y, Shears SB, Flavell RA, McCormick DA, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10535736", "url": "https://glygen.org/publication/PubMed/10535736" } ] }, { "title": "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10542231", "url": "https://glygen.org/publication/PubMed/10542231" } ] }, { "title": "Spatial control of coated-pit dynamics in living cells.", "journal": "Nature cell biology", "date": "1999", "authors": "Gaidarov I, Santini F, Warren RA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559856", "url": "https://glygen.org/publication/PubMed/10559856" } ] }, { "title": "Functional partnership between amphiphysin and dynamin in clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "1999", "authors": "Takei K, Slepnev VI, Haucke V, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559861", "url": "https://glygen.org/publication/PubMed/10559861" } ] }, { "title": "Phosphatidylinositol-3-OH kinases are Rab5 effectors.", "journal": "Nature cell biology", "date": "1999", "authors": "Christoforidis S, Miaczynska M, Ashman K, Wilm M, Zhao L, Yip SC, Waterfield MD, Backer JM, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559924", "url": "https://glygen.org/publication/PubMed/10559924" } ] }, { "title": "The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rosenthal JA, Chen H, Slepnev VI, Pellegrini L, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10567358", "url": "https://glygen.org/publication/PubMed/10567358" } ] }, { "title": "The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Doria M, Salcini AE, Colombo E, Parslow TG, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10613896", "url": "https://glygen.org/publication/PubMed/10613896" } ] }, { "title": "Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10625686", "url": "https://glygen.org/publication/PubMed/10625686" } ] }, { "title": "Mapping of Eps15 domains involved in its targeting to clathrin-coated pits.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Benmerah A, Poupon V, Cerf-Bensussan N, Dautry-Varsat A", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "10652316", "url": "https://glygen.org/publication/PubMed/10652316" } ] }, { "title": "The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Domin J, Gaidarov I, Smith ME, Keen JH, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" } ] }, { "title": "Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.", "journal": "The Biochemical journal", "date": "2000", "authors": "Oleinikov AV, Zhao J, Makker SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10769163", "url": "https://glygen.org/publication/PubMed/10769163" } ] }, { "title": "The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor-regulated tyrosine kinase substrate.", "journal": "Hum. Mol. Genet.", "date": "2000", "authors": "Scoles DR, Huynh DP, Chen MS, Burke SP, Gutmann DH, Pulst SM", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "10861283", "url": "https://glygen.org/publication/PubMed/10861283" } ] }, { "title": "Tyrosine phosphorylation of Eps15 is required for ligand-regulated, but not constitutive, endocytosis.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Confalonieri S, Salcini AE, Puri C, Tacchetti C, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "10953014", "url": "https://glygen.org/publication/PubMed/10953014" } ] }, { "title": "A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kato M, Miyazawa K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10982817", "url": "https://glygen.org/publication/PubMed/10982817" } ] }, { "title": "The hPLIC proteins may provide a link between the ubiquitination machinery and the proteasome.", "journal": "Molecular cell", "date": "2000", "authors": "Kleijnen MF, Shih AH, Zhou P, Kumar S, Soccio RE, Kedersha NL, Gill G, Howley PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10983987", "url": "https://glygen.org/publication/PubMed/10983987" } ] }, { "title": "Multiple C-terminal motifs of the 46-kDa mannose 6-phosphate receptor tail contribute to efficient binding of medium chains of AP-2 and AP-3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Storch S, Braulke T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11071885", "url": "https://glygen.org/publication/PubMed/11071885" } ] }, { "title": "Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Mah AL, Perry G, Smith MA, Monteiro MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11076969", "url": "https://glygen.org/publication/PubMed/11076969" } ] }, { "title": "InIB-dependent internalization of Listeria is mediated by the Met receptor tyrosine kinase.", "journal": "Cell", "date": "2000", "authors": "Shen Y, Naujokas M, Park M, Ireton K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875360", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875360" } ], "reference": [ { "type": "PubMed", "id": "11081636", "url": "https://glygen.org/publication/PubMed/11081636" } ] }, { "title": "All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.", "journal": "Journal of cell science", "date": "2000", "authors": "Modregger J, Ritter B, Witter B, Paulsson M, Plomann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11082044", "url": "https://glygen.org/publication/PubMed/11082044" } ] }, { "title": "Signal-binding specificity of the mu4 subunit of the adaptor protein complex AP-4.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Aguilar RC, Boehm M, Gorshkova I, Crouch RJ, Tomita K, Saito T, Ohno H, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11139587", "url": "https://glygen.org/publication/PubMed/11139587" } ] }, { "title": "Clathrin uncoating: Auxilin comes to life.", "journal": "Current biology : CB", "date": "2001", "authors": "Lemmon SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11231140", "url": "https://glygen.org/publication/PubMed/11231140" } ] }, { "title": "The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.", "journal": "Molecular cell", "date": "2001", "authors": "Gaidarov I, Smith ME, Domin J, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "title": "Disabled-2 colocalizes with the LDLR in clathrin-coated pits and interacts with AP-2.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Morris SM, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11247302", "url": "https://glygen.org/publication/PubMed/11247302" } ] }, { "title": "Hepatitis B virus large envelope protein interacts with gamma2-adaptin, a clathrin adaptor-related protein.", "journal": "Journal of virology", "date": "2001", "authors": "Hartmann-Stuhler C, Prange R", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11333915", "url": "https://glygen.org/publication/PubMed/11333915" } ] }, { "title": "Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.", "journal": "EMBO reports", "date": "2001", "authors": "Walther K, Krauss M, Diril MK, Lemke S, Ricotta D, Honing S, Kaiser S, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11454741", "url": "https://glygen.org/publication/PubMed/11454741" } ] }, { "title": "Wrch-1, a novel member of the Rho gene family that is regulated by Wnt-1.", "journal": "Genes & development", "date": "2001", "authors": "Tao W, Pennica D, Xu L, Kalejta RF, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "11459829", "url": "https://glygen.org/publication/PubMed/11459829" } ] }, { "title": "Multiple interactions of auxilin 1 with clathrin and the AP-2 adaptor complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Scheele U, Kalthoff C, Ungewickell E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11470803", "url": "https://glygen.org/publication/PubMed/11470803" } ] }, { "title": "Phosphorylation of threonine 156 of the mu2 subunit of the AP2 complex is essential for endocytosis in vitro and in vivo.", "journal": "Current biology : CB", "date": "2001", "authors": "Olusanya O, Andrews PD, Swedlow JR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11516654", "url": "https://glygen.org/publication/PubMed/11516654" } ] }, { "title": "HIP1 functions in clathrin-mediated endocytosis through binding to clathrin and adaptor protein 2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Metzler M, Legendre-Guillemin V, Gan L, Chopra V, Kwok A, McPherson PS, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11517213", "url": "https://glygen.org/publication/PubMed/11517213" } ] }, { "title": "The huntingtin interacting protein HIP1 is a clathrin and alpha-adaptin-binding protein involved in receptor-mediated endocytosis.", "journal": "Human molecular genetics", "date": "2001", "authors": "Waelter S, Scherzinger E, Hasenbank R, Nordhoff E, Lurz R, Goehler H, Gauss C, Sathasivam K, Bates GP, Lehrach H, Wanker EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11532990", "url": "https://glygen.org/publication/PubMed/11532990" } ] }, { "title": "Mammalian cells express two VPS4 proteins both of which are involved in intracellular protein trafficking.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Scheuring S, Rohricht RA, Schoning-Burkhardt B, Beyer A, Muller S, Abts HF, Kohrer K", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "11563910", "url": "https://glygen.org/publication/PubMed/11563910" } ] }, { "title": "A novel active site-directed probe specific for deubiquitylating enzymes reveals proteasome association of USP14.", "journal": "The EMBO journal", "date": "2001", "authors": "Borodovsky A, Kessler BM, Casagrande R, Overkleeft HS, Wilkinson KD, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11566882", "url": "https://glygen.org/publication/PubMed/11566882" } ] }, { "title": "Clathrin- and AP-2-binding sites in HIP1 uncover a general assembly role for endocytic accessory proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mishra SK, Agostinelli NR, Brett TJ, Mizukami I, Ross TS, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11577110", "url": "https://glygen.org/publication/PubMed/11577110" } ] }, { "title": "Regulation of receptor fate by ubiquitination of activated beta 2-adrenergic receptor and beta-arrestin.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Shenoy SK, McDonald PH, Kohout TA, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11588219", "url": "https://glygen.org/publication/PubMed/11588219" } ] }, { "title": "Generation of high curvature membranes mediated by direct endophilin bilayer interactions.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Farsad K, Ringstad N, Takei K, Floyd SR, Rose K, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11604418", "url": "https://glygen.org/publication/PubMed/11604418" } ] }, { "title": "Tyrosine phosphorylation mapping of the epidermal growth factor receptor signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Steen H, Kuster B, Fernandez M, Pandey A, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "11687594", "url": "https://glygen.org/publication/PubMed/11687594" } ] }, { "title": "GGAs: roles of the different domains and comparison with AP-1 and clathrin.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Hirst J, Lindsay MR, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11694590", "url": "https://glygen.org/publication/PubMed/11694590" } ] }, { "title": "Mutation of the c-Cbl TKB domain binding site on the Met receptor tyrosine kinase converts it into a transforming protein.", "journal": "Molecular cell", "date": "2001", "authors": "Peschard P, Fournier TM, Lamorte L, Naujokas MA, Band H, Langdon WY, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "11741535", "url": "https://glygen.org/publication/PubMed/11741535" } ] }, { "title": "A mutant EGF-receptor defective in ubiquitylation and endocytosis unveils a role for Grb2 in negative signaling.", "journal": "The EMBO journal", "date": "2002", "authors": "Waterman H, Katz M, Rubin C, Shtiegman K, Lavi S, Elson A, Jovin T, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "11823423", "url": "https://glygen.org/publication/PubMed/11823423" } ] }, { "title": "Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ricotta D, Conner SD, Schmid SL, von Figura K, Honing S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877457", "url": "https://glygen.org/publication/PubMed/11877457" } ] }, { "title": "Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Conner SD, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877461", "url": "https://glygen.org/publication/PubMed/11877461" } ] }, { "title": "HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Legendre-Guillemin V, Metzler M, Charbonneau M, Gan L, Chopra V, Philie J, Hayden MR, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11889126", "url": "https://glygen.org/publication/PubMed/11889126" } ] }, { "title": "Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors.", "journal": "Nature", "date": "2002", "authors": "Soubeyran P, Kowanetz K, Szymkiewicz I, Langdon WY, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "11894095", "url": "https://glygen.org/publication/PubMed/11894095" } ] }, { "title": "The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met.", "journal": "Nature", "date": "2002", "authors": "Petrelli A, Gilestro GF, Lanzardo S, Comoglio PM, Migone N, Giordano S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "11894096", "url": "https://glygen.org/publication/PubMed/11894096" } ] }, { "title": "A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins.", "journal": "Nature", "date": "2002", "authors": "Polo S, Sigismund S, Faretta M, Guidi M, Capua MR, Bossi G, Chen H, De Camilli P, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11919637", "url": "https://glygen.org/publication/PubMed/11919637" } ] }, { "title": "Deubiquitination of p53 by HAUSP is an important pathway for p53 stabilization.", "journal": "Nature", "date": "2002", "authors": "Li M, Chen D, Shiloh A, Luo J, Nikolaev AY, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11923872", "url": "https://glygen.org/publication/PubMed/11923872" } ] }, { "title": "Dual roles for the Dab2 adaptor protein in embryonic development and kidney transport.", "journal": "The EMBO journal", "date": "2002", "authors": "Morris SM, Tallquist MD, Rock CO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11927540", "url": "https://glygen.org/publication/PubMed/11927540" } ] }, { "title": "Epsins and Vps27p/Hrs contain ubiquitin-binding domains that function in receptor endocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Shih SC, Katzmann DJ, Schnell JD, Sutanto M, Emr SD, Hicke L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11988742", "url": "https://glygen.org/publication/PubMed/11988742" } ] }, { "title": "Regulated transport of the glucose transporter GLUT4.", "journal": "Nature reviews. Molecular cell biology", "date": "2002", "authors": "Bryant NJ, Govers R, James DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11994746", "url": "https://glygen.org/publication/PubMed/11994746" } ] }, { "title": "Accessory protein recruitment motifs in clathrin-mediated endocytosis.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Brett TJ, Traub LM, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12057195", "url": "https://glygen.org/publication/PubMed/12057195" } ] }, { "title": "A ubiquitin-interacting motif (UIM) is essential for Eps15 and Eps15R ubiquitination.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Klapisz E, Sorokina I, Lemeer S, Pijnenburg M, Verkleij AJ, van Bergen en Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12072436", "url": "https://glygen.org/publication/PubMed/12072436" } ] }, { "title": "Molecular architecture and functional model of the endocytic AP2 complex.", "journal": "Cell", "date": "2002", "authors": "Collins BM, McCoy AJ, Kent HM, Evans PR, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12086608", "url": "https://glygen.org/publication/PubMed/12086608" } ] }, { "title": "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12213833", "url": "https://glygen.org/publication/PubMed/12213833" } ] }, { "title": "Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Haglund K, Shimokawa N, Szymkiewicz I, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12218189", "url": "https://glygen.org/publication/PubMed/12218189" } ] }, { "title": "ARH is a modular adaptor protein that interacts with the LDL receptor, clathrin, and AP-2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "He G, Gupta S, Yi M, Michaely P, Hobbs HH, Cohen JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12221107", "url": "https://glygen.org/publication/PubMed/12221107" } ] }, { "title": "Sprouty2 attenuates epidermal growth factor receptor ubiquitylation and endocytosis, and consequently enhances Ras/ERK signalling.", "journal": "The EMBO journal", "date": "2002", "authors": "Wong ES, Fong CW, Lim J, Yusoff P, Low BC, Langdon WY, Guy GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12234920", "url": "https://glygen.org/publication/PubMed/12234920" } ] }, { "title": "Disabled-2 exhibits the properties of a cargo-selective endocytic clathrin adaptor.", "journal": "The EMBO journal", "date": "2002", "authors": "Mishra SK, Keyel PA, Hawryluk MJ, Agostinelli NR, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12234931", "url": "https://glygen.org/publication/PubMed/12234931" } ] }, { "title": "c-Cbl is involved in Met signaling in B cells and mediates hepatocyte growth factor-induced receptor ubiquitination.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Taher TE, Tjin EP, Beuling EA, Borst J, Spaargaren M, Pals ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12244174", "url": "https://glygen.org/publication/PubMed/12244174" } ] }, { "title": "Transforming growth factor-beta receptors interact with AP2 by direct binding to beta2 subunit.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Yao D, Ehrlich M, Henis YI, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12429842", "url": "https://glygen.org/publication/PubMed/12429842" } ] }, { "title": "ARF6-GTP recruits Nm23-H1 to facilitate dynamin-mediated endocytosis during adherens junctions disassembly.", "journal": "Nature cell biology", "date": "2002", "authors": "Palacios F, Schweitzer JK, Boshans RL, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12447393", "url": "https://glygen.org/publication/PubMed/12447393" } ] }, { "title": "The autosomal recessive hypercholesterolemia (ARH) protein interfaces directly with the clathrin-coat machinery.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Mishra SK, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12451172", "url": "https://glygen.org/publication/PubMed/12451172" } ] }, { "title": "Phosphorylation of key serine residues is required for internalization of the complement 5a (C5a) anaphylatoxin receptor via a beta-arrestin, dynamin, and clathrin-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braun L, Christophe T, Boulay F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12464600", "url": "https://glygen.org/publication/PubMed/12464600" } ] }, { "title": "Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Palka HL, Park M, Tonks NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12475979", "url": "https://glygen.org/publication/PubMed/12475979" } ] }, { "title": "STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Bache KG, Raiborg C, Mehlum A, Stenmark H", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12551915", "url": "https://glygen.org/publication/PubMed/12551915" } ] }, { "title": "Sprouty fine-tunes EGF signaling through interlinked positive and negative feedback loops.", "journal": "Current biology : CB", "date": "2003", "authors": "Rubin C, Litvak V, Medvedovsky H, Zwang Y, Lev S, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12593795", "url": "https://glygen.org/publication/PubMed/12593795" } ] }, { "title": "hSpry2 is targeted to the ubiquitin-dependent proteasome pathway by c-Cbl.", "journal": "Current biology : CB", "date": "2003", "authors": "Hall AB, Jura N, DaSilva J, Jang YJ, Gong D, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "12593796", "url": "https://glygen.org/publication/PubMed/12593796" } ] }, { "title": "Endosomal dynamics of Met determine signaling output.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Hammond DE, Carter S, McCullough J, Urbe S, Vande Woude G, Clague MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12686592", "url": "https://glygen.org/publication/PubMed/12686592" } ] }, { "title": "Multiple monoubiquitination of RTKs is sufficient for their endocytosis and degradation.", "journal": "Nature cell biology", "date": "2003", "authors": "Haglund K, Sigismund S, Polo S, Szymkiewicz I, Di Fiore PP, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12717448", "url": "https://glygen.org/publication/PubMed/12717448" } ] }, { "title": "ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12847086", "url": "https://glygen.org/publication/PubMed/12847086" } ] }, { "title": "HIV Gag mimics the Tsg101-recruiting activity of the human Hrs protein.", "journal": "J. Cell Biol.", "date": "2003", "authors": "Pornillos Owen, Higginson Daniel S, Stray Kirsten M, Fisher Robert D, Garrus Jennifer E, Payne Marielle, He Gong-Ping, Wang Hubert E, Morham Scott G, Sundquist Wesley I", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "12900394", "url": "https://glygen.org/publication/PubMed/12900394" } ] }, { "title": "CYLD is a deubiquitinating enzyme that negatively regulates NF-kappaB activation by TNFR family members.", "journal": "Nature", "date": "2003", "authors": "Trompouki E, Hatzivassiliou E, Tsichritzis T, Farmer H, Ashworth A, Mosialos G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917689", "url": "https://glygen.org/publication/PubMed/12917689" } ] }, { "title": "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination.", "journal": "Nature", "date": "2003", "authors": "Kovalenko A, Chable-Bessia C, Cantarella G, Israel A, Wallach D, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917691", "url": "https://glygen.org/publication/PubMed/12917691" } ] }, { "title": "Xenopus autosomal recessive hypercholesterolemia protein couples lipoprotein receptors with the AP-2 complex in oocytes and embryos and is required for vitellogenesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhou Y, Zhang J, King ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12944396", "url": "https://glygen.org/publication/PubMed/12944396" } ] }, { "title": "Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12952949", "url": "https://glygen.org/publication/PubMed/12952949" } ] }, { "title": "The UIM domain of Hrs couples receptor sorting to vesicle formation.", "journal": "Journal of cell science", "date": "2003", "authors": "Urbe S, Sachse M, Row PE, Preisinger C, Barr FA, Strous G, Klumperman J, Clague MJ", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "12953068", "url": "https://glygen.org/publication/PubMed/12953068" } ] }, { "title": "Dishevelled 2 recruits beta-arrestin 2 to mediate Wnt5A-stimulated endocytosis of Frizzled 4.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Chen W, ten Berge D, Brown J, Ahn S, Hu LA, Miller WE, Caron MG, Barak LS, Nusse R, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12958364", "url": "https://glygen.org/publication/PubMed/12958364" } ] }, { "title": "Characterization of the signal for rapid internalization of the bovine mannose 6-phosphate/insulin-like growth factor-II receptor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Jadot M, Canfield WM, Gregory W, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1317852", "url": "https://glygen.org/publication/PubMed/1317852" } ] }, { "title": "Activated Cdc42 sequesters c-Cbl and prevents EGF receptor degradation.", "journal": "Cell", "date": "2003", "authors": "Wu WJ, Tu S, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "14505571", "url": "https://glygen.org/publication/PubMed/14505571" } ] }, { "title": "Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.", "journal": "EMBO reports", "date": "2003", "authors": "Ritter B, Philie J, Girard M, Tung EC, Blondeau F, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14555962", "url": "https://glygen.org/publication/PubMed/14555962" } ] }, { "title": "Clathrin promotes incorporation of cargo into coated pits by activation of the AP2 adaptor micro2 kinase.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Jackson AP, Flett A, Smythe C, Hufton L, Wettey FR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14581451", "url": "https://glygen.org/publication/PubMed/14581451" } ] }, { "title": "The E3 ubiquitin ligase AIP4 mediates ubiquitination and sorting of the G protein-coupled receptor CXCR4.", "journal": "Developmental cell", "date": "2003", "authors": "Marchese A, Raiborg C, Santini F, Keen JH, Stenmark H, Benovic JL", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "14602072", "url": "https://glygen.org/publication/PubMed/14602072" } ] }, { "title": "AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Conner SD, Schroter T, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14617351", "url": "https://glygen.org/publication/PubMed/14617351" } ] }, { "title": "Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating.", "journal": "Neuron", "date": "2003", "authors": "Verstreken P, Koh TW, Schulze KL, Zhai RG, Hiesinger PR, Zhou Y, Mehta SQ, Cao Y, Roos J, Bellen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622578", "url": "https://glygen.org/publication/PubMed/14622578" } ] }, { "title": "Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin.", "journal": "Neuron", "date": "2003", "authors": "Schuske KR, Richmond JE, Matthies DS, Davis WS, Runz S, Rube DA, van der Bliek AM, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622579", "url": "https://glygen.org/publication/PubMed/14622579" } ] }, { "title": "Hrs function: viruses provide the clue.", "journal": "Trends in cell biology", "date": "2003", "authors": "Clague MJ, Urbe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "14624836", "url": "https://glygen.org/publication/PubMed/14624836" } ] }, { "title": "Two isoforms of otubain 1 regulate T cell anergy via GRAIL.", "journal": "Nature immunology", "date": "2004", "authors": "Soares L, Seroogy C, Skrenta H, Anandasabapathy N, Lovelace P, Chung CD, Engleman E, Fathman CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "14661020", "url": "https://glygen.org/publication/PubMed/14661020" } ] }, { "title": "The ubiquitin-related protein PLIC-1 regulates heterotrimeric G protein function through association with Gbetagamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "N'Diaye EN, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14662753", "url": "https://glygen.org/publication/PubMed/14662753" } ] }, { "title": "Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Walther K, Diril MK, Jung N, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14726597", "url": "https://glygen.org/publication/PubMed/14726597" } ] }, { "title": "Analysis of clathrin-mediated endocytosis of epidermal growth factor receptor by RNA interference.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Huang F, Khvorova A, Marshall W, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "14985334", "url": "https://glygen.org/publication/PubMed/14985334" } ] }, { "title": "Role of protein ubiquitylation in regulating endocytosis of receptor tyrosine kinases.", "journal": "Oncogene", "date": "2004", "authors": "Marmor MD, Yarden Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15021893", "url": "https://glygen.org/publication/PubMed/15021893" } ] }, { "title": "A dynamic role of HAUSP in the p53-Mdm2 pathway.", "journal": "Molecular cell", "date": "2004", "authors": "Li M, Brooks CL, Kon N, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15053880", "url": "https://glygen.org/publication/PubMed/15053880" } ] }, { "title": "ATPase-deficient hVPS4 impairs formation of internal endosomal vesicles and stabilizes bilayered clathrin coats on endosomal vacuoles.", "journal": "Journal of cell science", "date": "2004", "authors": "Sachse M, Strous GJ, Klumperman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "15075231", "url": "https://glygen.org/publication/PubMed/15075231" } ] }, { "title": "Regulation of ubiquitin protein ligase activity in c-Cbl by phosphorylation-induced conformational change and constitutive activation by tyrosine to glutamate point mutations.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kassenbrock CK, Anderson SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15117950", "url": "https://glygen.org/publication/PubMed/15117950" } ] }, { "title": "A conserved DpYR motif in the juxtamembrane domain of the Met receptor family forms an atypical c-Cbl/Cbl-b tyrosine kinase binding domain binding site required for suppression of oncogenic activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Peschard P, Ishiyama N, Lin T, Lipkowitz S, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "15123609", "url": "https://glygen.org/publication/PubMed/15123609" } ] }, { "title": "The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin.", "journal": "Biochimie", "date": "2004", "authors": "Gallagher H, Oleinikov AV, Fenske C, Newman DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15134832", "url": "https://glygen.org/publication/PubMed/15134832" } ] }, { "title": "The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Stuchell MD, Garrus JE, Muller B, Stray KM, Ghaffarian S, McKinnon R, Krausslich HG, Morham SG, Sundquist WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "15218037", "url": "https://glygen.org/publication/PubMed/15218037" } ] }, { "title": "A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kamioka Y, Fukuhara S, Sawa H, Nagashima K, Masuda M, Matsuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15252009", "url": "https://glygen.org/publication/PubMed/15252009" } ] }, { "title": "Dap160/intersectin scaffolds the periactive zone to achieve high-fidelity endocytosis and normal synaptic growth.", "journal": "Neuron", "date": "2004", "authors": "Marie B, Sweeney ST, Poskanzer KE, Roos J, Kelly RB, Davis GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15260957", "url": "https://glygen.org/publication/PubMed/15260957" } ] }, { "title": "Nucleoside diphosphate kinase of Mycobacterium tuberculosis acts as GTPase-activating protein for Rho-GTPases.", "journal": "FEBS letters", "date": "2004", "authors": "Chopra P, Koduri H, Singh R, Koul A, Ghildiyal M, Sharma K, Tyagi AK, Singh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9636383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383" } ], "reference": [ { "type": "PubMed", "id": "15280044", "url": "https://glygen.org/publication/PubMed/15280044" } ] }, { "title": "The stimulatory action of amphiphysin on dynamin function is dependent on lipid bilayer curvature.", "journal": "The EMBO journal", "date": "2004", "authors": "Yoshida Y, Kinuta M, Abe T, Liang S, Araki K, Cremona O, Di Paolo G, Moriyama Y, Yasuda T, De Camilli P, Takei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15318165", "url": "https://glygen.org/publication/PubMed/15318165" } ] }, { "title": "Endocytosis by random initiation and stabilization of clathrin-coated pits.", "journal": "Cell", "date": "2004", "authors": "Ehrlich M, Boll W, Van Oijen A, Hariharan R, Chandran K, Nibert ML, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15339664", "url": "https://glygen.org/publication/PubMed/15339664" } ] }, { "title": "Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects.", "journal": "Experimental cell research", "date": "2004", "authors": "Saras J, Wollberg P, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "15350535", "url": "https://glygen.org/publication/PubMed/15350535" } ] }, { "title": "A novel di-leucine motif and a tyrosine-based motif independently mediate lysosomal targeting and endocytosis of CD3 chains.", "journal": "Cell", "date": "1992", "authors": "Letourneur F, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1535555", "url": "https://glygen.org/publication/PubMed/1535555" } ] }, { "title": "Ubiquitin ligase activity of c-Cbl guides the epidermal growth factor receptor into clathrin-coated pits by two distinct modes of Eps15 recruitment.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "de Melker AA, van der Horst G, Borst J", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15465819", "url": "https://glygen.org/publication/PubMed/15465819" } ] }, { "title": "Adaptors for clathrin coats: structure and function.", "journal": "Annual review of cell and developmental biology", "date": "2004", "authors": "Owen DJ, Collins BM, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15473838", "url": "https://glygen.org/publication/PubMed/15473838" } ] }, { "title": "Direct interaction of Cbl with pTyr 1045 of the EGF receptor (EGFR) is required to sort the EGFR to lysosomes for degradation.", "journal": "Experimental cell research", "date": "2004", "authors": "Grovdal LM, Stang E, Sorkin A, Madshus IH", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15475003", "url": "https://glygen.org/publication/PubMed/15475003" } ] }, { "title": "Molecular model for a complete clathrin lattice from electron cryomicroscopy.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Sliz P, Grigorieff N, Harrison SC, Kirchhausen T, Walz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502812", "url": "https://glygen.org/publication/PubMed/15502812" } ] }, { "title": "Structure of an auxilin-bound clathrin coat and its implications for the mechanism of uncoating.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Grigorieff N, Walz T, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502813", "url": "https://glygen.org/publication/PubMed/15502813" } ] }, { "title": "Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Eastman SW, Martin-Serrano J, Chung W, Zang T, Bieniasz PD", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "15509564", "url": "https://glygen.org/publication/PubMed/15509564" } ] }, { "title": "Atypical mechanism of regulation of the Wrch-1 Rho family small GTPase.", "journal": "Current biology : CB", "date": "2004", "authors": "Shutes A, Berzat AC, Cox AD, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "15556869", "url": "https://glygen.org/publication/PubMed/15556869" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "BAR domains and membrane curvature: bringing your curves to the BAR.", "journal": "Biochemical Society symposium", "date": "2005", "authors": "Gallop JL, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15649145", "url": "https://glygen.org/publication/PubMed/15649145" } ] }, { "title": "Different G protein-coupled receptor kinases govern G protein and beta-arrestin-mediated signaling of V2 vasopressin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Ren XR, Reiter E, Ahn S, Kim J, Chen W, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15671180", "url": "https://glygen.org/publication/PubMed/15671180" } ] }, { "title": "Clathrin-independent endocytosis of ubiquitinated cargos.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Sigismund S, Woelk T, Puri C, Maspero E, Tacchetti C, Transidico P, Di Fiore PP, Polo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15701692", "url": "https://glygen.org/publication/PubMed/15701692" } ] }, { "title": "SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Soulet F, Yarar D, Leonard M, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15703209", "url": "https://glygen.org/publication/PubMed/15703209" } ] }, { "title": "Functional dissection of an AP-2 beta2 appendage-binding sequence within the autosomal recessive hypercholesterolemia protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Mishra SK, Keyel PA, Edeling MA, Dupin AL, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15728179", "url": "https://glygen.org/publication/PubMed/15728179" } ] }, { "title": "CART: an Hrs/actinin-4/BERP/myosin V protein complex required for efficient receptor recycling.", "journal": "Mol. Biol. Cell", "date": "2005", "authors": "Yan Q, Sun W, Kujala P, Lotfi Y, Vida TA, Bean AJ", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "15772161", "url": "https://glygen.org/publication/PubMed/15772161" } ] }, { "title": "The small G-protein Arf6GTP recruits the AP-2 adaptor complex to membranes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Paleotti O, Macia E, Luton F, Klein S, Partisani M, Chardin P, Kirchhausen T, Franco M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15802264", "url": "https://glygen.org/publication/PubMed/15802264" } ] }, { "title": "Growth factors induce differential phosphorylation profiles of the Hrs-STAM complex: a common node in signalling networks with signal-specific properties.", "journal": "The Biochemical journal", "date": "2005", "authors": "Row PE, Clague MJ, Urbe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "15828871", "url": "https://glygen.org/publication/PubMed/15828871" } ] }, { "title": "Caenorhabditis elegans RME-6 is a novel regulator of RAB-5 at the clathrin-coated pit.", "journal": "Nature cell biology", "date": "2005", "authors": "Sato M, Sato K, Fonarev P, Huang CJ, Liou W, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15895077", "url": "https://glygen.org/publication/PubMed/15895077" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.", "journal": "Molecular cell", "date": "2005", "authors": "Honing S, Ricotta D, Krauss M, Spate K, Spolaore B, Motley A, Robinson M, Robinson C, Haucke V, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15916959", "url": "https://glygen.org/publication/PubMed/15916959" } ] }, { "title": "Loss of HAUSP-mediated deubiquitination contributes to DNA damage-induced destabilization of Hdmx and Hdm2.", "journal": "Molecular cell", "date": "2005", "authors": "Meulmeester E, Maurice MM, Boutell C, Teunisse AF, Ovaa H, Abraham TE, Dirks RW, Jochemsen AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15916963", "url": "https://glygen.org/publication/PubMed/15916963" } ] }, { "title": "Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.", "journal": "EMBO reports", "date": "2005", "authors": "Haglund K, Schmidt MHH, Wong ES, Guy GR, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "15962011", "url": "https://glygen.org/publication/PubMed/15962011" } ] }, { "title": "An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Shin HW, Hayashi M, Christoforidis S, Lacas-Gervais S, Hoepfner S, Wenk MR, Modregger J, Uttenweiler-Joseph S, Wilm M, Nystuen A, Frankel WN, Solimena M, De Camilli P, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16103228", "url": "https://glygen.org/publication/PubMed/16103228" } ] }, { "title": "Listeria hijacks the clathrin-dependent endocytic machinery to invade mammalian cells.", "journal": "Nature cell biology", "date": "2005", "authors": "Veiga E, Cossart P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "16113677", "url": "https://glygen.org/publication/PubMed/16113677" } ] }, { "title": "Depletion of GAK/auxilin 2 inhibits receptor-mediated endocytosis and recruitment of both clathrin and clathrin adaptors.", "journal": "Journal of cell science", "date": "2005", "authors": "Lee DW, Zhao X, Zhang F, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "16155256", "url": "https://glygen.org/publication/PubMed/16155256" } ] }, { "title": "Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.", "journal": "J. Cell Sci.", "date": "2005", "authors": "Regan-Klapisz E, Sorokina I, Voortman J, de Keizer P, Roovers RC, Verheesen P, Urbe S, Fallon L, Fon EA, Verkleij A, Benmerah A, van Bergen en Henegouwen PM", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16159959", "url": "https://glygen.org/publication/PubMed/16159959" } ] }, { "title": "Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC).", "journal": "Journal of proteome research", "date": "2005", "authors": "Amanchy R, Kalume DE, Iwahori A, Zhong J, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "16212419", "url": "https://glygen.org/publication/PubMed/16212419" } ] }, { "title": "Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.", "journal": "Cellular signalling", "date": "2006", "authors": "Tzimas C, Michailidou G, Arsenakis M, Kieff E, Mosialos G, Hatzivassiliou EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16214042", "url": "https://glygen.org/publication/PubMed/16214042" } ] }, { "title": "Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gaidarov I, Zhao Y, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "title": "Met/Hepatocyte growth factor receptor ubiquitination suppresses transformation and is required for Hrs phosphorylation.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Abella JV, Peschard P, Naujokas MA, Lin T, Saucier C, Urbe S, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "16227611", "url": "https://glygen.org/publication/PubMed/16227611" } ] }, { "title": "Dynamin and the actin cytoskeleton cooperatively regulate plasma membrane invagination by BAR and F-BAR proteins.", "journal": "Developmental cell", "date": "2005", "authors": "Itoh T, Erdmann KS, Roux A, Habermann B, Werner H, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16326391", "url": "https://glygen.org/publication/PubMed/16326391" } ] }, { "title": "Degradation of endocytosed epidermal growth factor and virally ubiquitinated major histocompatibility complex class I is independent of mammalian ESCRTII.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bowers K, Piper SC, Edeling MA, Gray SR, Owen DJ, Lehner PJ, Luzio JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "16371348", "url": "https://glygen.org/publication/PubMed/16371348" } ] }, { "title": "Cbl escapes Cdc42-mediated inhibition by downregulation of the adaptor molecule betaPix.", "journal": "Oncogene", "date": "2006", "authors": "Schmidt MHH, Husnjak K, Szymkiewicz I, Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "16407834", "url": "https://glygen.org/publication/PubMed/16407834" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "Stonin 2 is an AP-2-dependent endocytic sorting adaptor for synaptotagmin internalization and recycling.", "journal": "Developmental cell", "date": "2006", "authors": "Diril MK, Wienisch M, Jung N, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16459302", "url": "https://glygen.org/publication/PubMed/16459302" } ] }, { "title": "The structural basis of arrestin-mediated regulation of G-protein-coupled receptors.", "journal": "Pharmacology & therapeutics", "date": "2006", "authors": "Gurevich VV, Gurevich EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16460808", "url": "https://glygen.org/publication/PubMed/16460808" } ] }, { "title": "Double-sided ubiquitin binding of Hrs-UIM in endosomal protein sorting.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Hirano S, Kawasaki M, Ura H, Kato R, Raiborg C, Stenmark H, Wakatsuki S", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "16462748", "url": "https://glygen.org/publication/PubMed/16462748" } ] }, { "title": "A common phosphotyrosine signature for the Bcr-Abl kinase.", "journal": "Blood", "date": "2006", "authors": "Goss VL, Lee KA, Moritz A, Nardone J, Spek EJ, MacNeill J, Rush J, Comb MJ, Polakiewicz RD", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" } ] }, { "title": "Molecular switches involving the AP-2 beta2 appendage regulate endocytic cargo selection and clathrin coat assembly.", "journal": "Developmental cell", "date": "2006", "authors": "Edeling MA, Mishra SK, Keyel PA, Steinhauser AL, Collins BM, Roth R, Heuser JE, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16516836", "url": "https://glygen.org/publication/PubMed/16516836" } ] }, { "title": "Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bairstow SF, Ling K, Su X, Firestone AJ, Carbonara C, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16707488", "url": "https://glygen.org/publication/PubMed/16707488" } ] }, { "title": "Endocytosis of the glucose transporter GLUT8 is mediated by interaction of a dileucine motif with the beta2-adaptin subunit of the AP-2 adaptor complex.", "journal": "Journal of cell science", "date": "2006", "authors": "Schmidt U, Briese S, Leicht K, Schurmann A, Joost HG, Al-Hasani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16723738", "url": "https://glygen.org/publication/PubMed/16723738" } ] }, { "title": "A burst of auxilin recruitment determines the onset of clathrin-coated vesicle uncoating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Massol RH, Boll W, Griffin AM, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16798879", "url": "https://glygen.org/publication/PubMed/16798879" } ] }, { "title": "Gamma-adaptin, a novel ubiquitin-interacting adaptor, and Nedd4 ubiquitin ligase control hepatitis B virus maturation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Rost M, Mann S, Lambert C, Doring T, Thome N, Prange R", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "16867982", "url": "https://glygen.org/publication/PubMed/16867982" } ] }, { "title": "Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Krauss M, Kukhtina V, Pechstein A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16880396", "url": "https://glygen.org/publication/PubMed/16880396" } ] }, { "title": "A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response.", "journal": "Cell", "date": "2006", "authors": "Zhang D, Zaugg K, Mak TW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16901786", "url": "https://glygen.org/publication/PubMed/16901786" } ] }, { "title": "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.", "journal": "PLoS biology", "date": "2006", "authors": "Schmid EM, Ford MG, Burtey A, Praefcke GJ, Peak-Chew SY, Mills IG, Benmerah A, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16903783", "url": "https://glygen.org/publication/PubMed/16903783" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nat. Biotechnol.", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "I3L1P5", "url": "https://www.uniprot.org/uniprot/I3L1P5" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "FOXO4 transcriptional activity is regulated by monoubiquitination and USP7/HAUSP.", "journal": "Nature cell biology", "date": "2006", "authors": "van der Horst A, de Vries-Smits AM, Brenkman AB, van Triest MH, van den Broek N, Colland F, Maurice MM, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16964248", "url": "https://glygen.org/publication/PubMed/16964248" } ] }, { "title": "Human ESCRT-II complex and its role in human immunodeficiency virus type 1 release.", "journal": "Journal of virology", "date": "2006", "authors": "Langelier C, von Schwedler UK, Fisher RD, De Domenico I, White PL, Hill CP, Kaplan J, Ward D, Sundquist WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "16973552", "url": "https://glygen.org/publication/PubMed/16973552" } ] }, { "title": "Effects of HER2 overexpression on cell signaling networks governing proliferation and migration.", "journal": "Molecular systems biology", "date": "2006", "authors": "Wolf-Yadlin A, Kumar N, Zhang Y, Hautaniemi S, Zaman M, Kim HD, Grantcharova V, Lauffenburger DA, White FM", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" } ] }, { "title": "Cargo regulates clathrin-coated pit dynamics.", "journal": "Cell", "date": "2006", "authors": "Puthenveedu MA, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17018281", "url": "https://glygen.org/publication/PubMed/17018281" } ] }, { "title": "Phosphoinositides in cell regulation and membrane dynamics.", "journal": "Nature", "date": "2006", "authors": "Di Paolo G, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17035995", "url": "https://glygen.org/publication/PubMed/17035995" } ] }, { "title": "Epidermal growth factor receptor fate is controlled by Hrs tyrosine phosphorylation sites that regulate Hrs degradation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Stern KA, Visser Smit GD, Place TL, Winistorfer S, Piper RC, Lill NL", "evidence": [ { "database": "iPTMnet", "id": "O14964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964" } ], "reference": [ { "type": "PubMed", "id": "17101784", "url": "https://glygen.org/publication/PubMed/17101784" } ] }, { "title": "Comparative proteomics of clathrin-coated vesicles.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Borner GH, Harbour M, Hester S, Lilley KS, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "17116749", "url": "https://glygen.org/publication/PubMed/17116749" } ] }, { "title": "Two synaptojanin 1 isoforms are recruited to clathrin-coated pits at different stages.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Perera RM, Zoncu R, Lucast L, De Camilli P, Toomre D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17158794", "url": "https://glygen.org/publication/PubMed/17158794" } ] }, { "title": "LRIG1 is a novel negative regulator of the Met receptor and opposes Met and Her2 synergy.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Shattuck DL, Miller JK, Laederich M, Funes M, Petersen H, Carraway KL 3rd, Sweeney C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "17178829", "url": "https://glygen.org/publication/PubMed/17178829" } ] }, { "title": "Downregulation of CD4 by human immunodeficiency virus type 1 Nef is dependent on clathrin and involves direct interaction of Nef with the AP2 clathrin adaptor.", "journal": "Journal of virology", "date": "2007", "authors": "Chaudhuri R, Lindwasser OW, Smith WJ, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17267500", "url": "https://glygen.org/publication/PubMed/17267500" } ] }, { "title": "The deubiquitinating enzyme USP2a regulates the p53 pathway by targeting Mdm2.", "journal": "The EMBO journal", "date": "2007", "authors": "Stevenson LF, Sparks A, Allende-Vega N, Xirodimas DP, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17290220", "url": "https://glygen.org/publication/PubMed/17290220" } ] }, { "title": "The gamma/sigma1 and alpha/sigma2 hemicomplexes of clathrin adaptors AP-1 and AP-2 harbor the dileucine recognition site.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Doray B, Lee I, Knisely J, Bu G, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17360967", "url": "https://glygen.org/publication/PubMed/17360967" } ] }, { "title": "Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.", "journal": "Nature", "date": "2007", "authors": "Stegmeier F, Rape M, Draviam VM, Nalepa G, Sowa ME, Ang XL, McDonald ER 3rd, Li MZ, Hannon GJ, Sorger PK, Kirschner MW, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17443180", "url": "https://glygen.org/publication/PubMed/17443180" } ] }, { "title": "Src-dependent phosphorylation of beta2-adaptin dissociates the beta-arrestin-AP-2 complex.", "journal": "Journal of cell science", "date": "2007", "authors": "Fessart D, Simaan M, Zimmerman B, Comeau J, Hamdan FF, Wiseman PW, Bouvier M, Laporte SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17456551", "url": "https://glygen.org/publication/PubMed/17456551" } ] }, { "title": "A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Henderson DM, Conner SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17494869", "url": "https://glygen.org/publication/PubMed/17494869" } ] }, { "title": "The atypical Rho family GTPase Wrch-1 regulates focal adhesion formation and cell migration.", "journal": "Journal of cell science", "date": "2007", "authors": "Chuang YY, Valster A, Coniglio SJ, Backer JM, Symons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "17504809", "url": "https://glygen.org/publication/PubMed/17504809" } ] }, { "title": "Curved EFC/F-BAR-domain dimers are joined end to end into a filament for membrane invagination in endocytosis.", "journal": "Cell", "date": "2007", "authors": "Shimada A, Niwa H, Tsujita K, Suetsugu S, Nitta K, Hanawa-Suetsugu K, Akasaka R, Nishino Y, Toyama M, Chen L, Liu ZJ, Wang BC, Yamamoto M, Terada T, Miyazawa A, Tanaka A, Sugano S, Shirouzu M, Nagayama K, Takenawa T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17512409", "url": "https://glygen.org/publication/PubMed/17512409" } ] }, { "title": "Clathrin-dependent entry of severe acute respiratory syndrome coronavirus into target cells expressing ACE2 with the cytoplasmic tail deleted.", "journal": "Journal of virology", "date": "2007", "authors": "Inoue Y, Tanaka N, Tanaka Y, Inoue S, Morita K, Zhuang M, Hattori T, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17522231", "url": "https://glygen.org/publication/PubMed/17522231" } ] }, { "title": "Structure and analysis of FCHo2 F-BAR domain: a dimerizing and membrane recruitment module that effects membrane curvature.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Henne WM, Kent HM, Ford MG, Hegde BG, Daumke O, Butler PJ, Mittal R, Langen R, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17540576", "url": "https://glygen.org/publication/PubMed/17540576" } ] }, { "title": "SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.", "journal": "Developmental cell", "date": "2007", "authors": "Yarar D, Waterman-Storer CM, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17609109", "url": "https://glygen.org/publication/PubMed/17609109" } ] }, { "title": "Lipoamide dehydrogenase mediates retention of coronin-1 on BCG vacuoles, leading to arrest in phagosome maturation.", "journal": "Journal of cell science", "date": "2007", "authors": "Deghmane AE, Soualhine H, Bach H, Sendide K, Itoh S, Tam A, Noubir S, Talal A, Lo R, Toyoshima S, Av-Gay Y, Hmama Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9636383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383" } ], "reference": [ { "type": "PubMed", "id": "17652161", "url": "https://glygen.org/publication/PubMed/17652161" } ] }, { "title": "Structure of the human receptor tyrosine kinase met in complex with the Listeria invasion protein InlB.", "journal": "Cell", "date": "2007", "authors": "Niemann HH, Jager V, Butler PJ, van den Heuvel J, Schmidt S, Ferraris D, Gherardi E, Heinz DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875360", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875360" } ], "reference": [ { "type": "PubMed", "id": "17662939", "url": "https://glygen.org/publication/PubMed/17662939" } ] }, { "title": "Sorting nexin 9 interacts with dynamin 1 and N-WASP and coordinates synaptic vesicle endocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shin N, Lee S, Ahn N, Kim SA, Ahn SG, YongPark Z, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17681954", "url": "https://glygen.org/publication/PubMed/17681954" } ] }, { "title": "Integrating molecular and network biology to decode endocytosis.", "journal": "Nature", "date": "2007", "authors": "Schmid EM, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17713526", "url": "https://glygen.org/publication/PubMed/17713526" } ] }, { "title": "The NECAP PHear domain increases clathrin accessory protein binding potential.", "journal": "The EMBO journal", "date": "2007", "authors": "Ritter B, Denisov AY, Philie J, Allaire PD, Legendre-Guillemin V, Zylbergold P, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17762867", "url": "https://glygen.org/publication/PubMed/17762867" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "Fbw7 and Usp28 regulate myc protein stability in response to DNA damage.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Popov N, Herold S, Llamazares M, Schulein C, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17873522", "url": "https://glygen.org/publication/PubMed/17873522" } ] }, { "title": "A motif in the clathrin heavy chain required for the Hsc70/auxilin uncoating reaction.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rapoport I, Boll W, Yu A, Bocking T, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17978091", "url": "https://glygen.org/publication/PubMed/17978091" } ] }, { "title": "Human USP3 is a chromatin modifier required for S phase progression and genome stability.", "journal": "Current biology : CB", "date": "2007", "authors": "Nicassio F, Corrado N, Vissers JH, Areces LB, Bergink S, Marteijn JA, Geverts B, Houtsmuller AB, Vermeulen W, Di Fiore PP, Citterio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17980597", "url": "https://glygen.org/publication/PubMed/17980597" } ] }, { "title": "Regulation of early wave of germ cell apoptosis and spermatogenesis by deubiquitinating enzyme CYLD.", "journal": "Developmental cell", "date": "2007", "authors": "Wright A, Reiley WW, Chang M, Jin W, Lee AJ, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17981138", "url": "https://glygen.org/publication/PubMed/17981138" } ] }, { "title": "A diacidic motif in human immunodeficiency virus type 1 Nef is a novel determinant of binding to AP-2.", "journal": "Journal of virology", "date": "2008", "authors": "Lindwasser OW, Smith WJ, Chaudhuri R, Yang P, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18032517", "url": "https://glygen.org/publication/PubMed/18032517" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "The dual phosphatase activity of synaptojanin1 is required for both efficient synaptic vesicle endocytosis and reavailability at nerve terminals.", "journal": "Neuron", "date": "2007", "authors": "Mani M, Lee SY, Lucast L, Cremona O, Di Paolo G, De Camilli P, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18093523", "url": "https://glygen.org/publication/PubMed/18093523" } ] }, { "title": "Molecular basis of synaptic vesicle cargo recognition by the endocytic sorting adaptor stonin 2.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Jung N, Wienisch M, Gu M, Rand JB, Muller SL, Krause G, Jorgensen EM, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18166656", "url": "https://glygen.org/publication/PubMed/18166656" } ] }, { "title": "Deubiquitylation of histone H2A activates transcriptional initiation via trans-histone cross-talk with H3K4 di- and trimethylation.", "journal": "Genes & development", "date": "2008", "authors": "Nakagawa T, Kajitani T, Togo S, Masuko N, Ohdan H, Hishikawa Y, Koji T, Matsuyama T, Ikura T, Muramatsu M, Ito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18172164", "url": "https://glygen.org/publication/PubMed/18172164" } ] }, { "title": "The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "N'Diaye EN, Hanyaloglu AC, Kajihara KK, Puthenveedu MA, Wu P, von Zastrow M, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18199683", "url": "https://glygen.org/publication/PubMed/18199683" } ] }, { "title": "SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.", "journal": "Journal of cell science", "date": "2008", "authors": "Shin N, Ahn N, Chang-Ileto B, Park J, Takei K, Ahn SG, Kim SA, Di Paolo G, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18388313", "url": "https://glygen.org/publication/PubMed/18388313" } ] }, { "title": "Regulation of IkappaB kinase-related kinases and antiviral responses by tumor suppressor CYLD.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhang M, Wu X, Lee AJ, Jin W, Chang M, Wright A, Imaizumi T, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18467330", "url": "https://glygen.org/publication/PubMed/18467330" } ] }, { "title": "Mycobacterium tuberculosis virulence is mediated by PtpA dephosphorylation of human vacuolar protein sorting 33B.", "journal": "Cell host & microbe", "date": "2008", "authors": "Bach H, Papavinasasundaram KG, Wong D, Hmama Z, Av-Gay Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9636383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383" } ], "reference": [ { "type": "PubMed", "id": "18474358", "url": "https://glygen.org/publication/PubMed/18474358" } ] }, { "title": "Interaction of phosphoinositide cycle intermediates with the plasma membrane-associated clathrin assembly protein AP-2.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Beck KA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "1847920", "url": "https://glygen.org/publication/PubMed/1847920" } ] }, { "title": "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18632802", "url": "https://glygen.org/publication/PubMed/18632802" } ] }, { "title": "The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.", "journal": "EMBO reports", "date": "2008", "authors": "Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18636086", "url": "https://glygen.org/publication/PubMed/18636086" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Hypertonia-associated protein Trak1 is a novel regulator of endosome-to-lysosome trafficking.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Webber E, Li L, Chin LS", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "18675823", "url": "https://glygen.org/publication/PubMed/18675823" } ] }, { "title": "Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb.", "journal": "Cell", "date": "2008", "authors": "Pryor PR, Jackson L, Gray SR, Edeling MA, Thompson A, Sanderson CM, Evans PR, Owen DJ, Luzio JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18775314", "url": "https://glygen.org/publication/PubMed/18775314" } ] }, { "title": "Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wilbur JD, Chen CY, Manalo V, Hwang PK, Fletterick RJ, Brodsky FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18790740", "url": "https://glygen.org/publication/PubMed/18790740" } ] }, { "title": "Role of HRB in clathrin-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chaineau M, Danglot L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18819912", "url": "https://glygen.org/publication/PubMed/18819912" } ] }, { "title": "Regulation of the Met receptor-tyrosine kinase by the protein-tyrosine phosphatase 1B and T-cell phosphatase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sangwan V, Paliouras GN, Abella JV, Dube N, Monast A, Tremblay ML, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "18819921", "url": "https://glygen.org/publication/PubMed/18819921" } ] }, { "title": "Coordinated regulation of AP2 uncoating from clathrin-coated vesicles by rab5 and hRME-6.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Semerdjieva S, Shortt B, Maxwell E, Singh S, Fonarev P, Hansen J, Schiavo G, Grant BD, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18981233", "url": "https://glygen.org/publication/PubMed/18981233" } ] }, { "title": "DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.", "journal": "Nature", "date": "2008", "authors": "Ley TJ, Mardis ER, Ding L, Fulton B, McLellan MD, Chen K, Dooling D, Dunford-Shore BH, McGrath S, Hickenbotham M, Cook L, Abbott R, Larson DE, Koboldt DC, Pohl C, Smith S, Hawkins A, Abbott S, Locke D, Hillier LW, Miner T, Fulton L, Magrini V, Wylie T, Glasscock J, Conyers J, Sander N, Shi X, Osborne JR, Minx P, Gordon D, Chinwalla A, Zhao Y, Ries RE, Payton JE, Westervelt P, Tomasson MH, Watson M, Baty J, Ivanovich J, Heath S, Shannon WD, Nagarajan R, Walter MJ, Link DC, Graubert TA, DiPersio JF, Wilson RK", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "18987736", "url": "https://glygen.org/publication/PubMed/18987736" } ] }, { "title": "USP19 deubiquitinating enzyme supports cell proliferation by stabilizing KPC1, a ubiquitin ligase for p27Kip1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Lu Y, Adegoke OA, Nepveu A, Nakayama KI, Bedard N, Cheng D, Peng J, Wing SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19015242", "url": "https://glygen.org/publication/PubMed/19015242" } ] }, { "title": "Proteomic analysis reveals Hrs ubiquitin-interacting motif-mediated ubiquitin signaling in multiple cellular processes.", "journal": "The FEBS journal", "date": "2009", "authors": "Pridgeon JW, Webber EA, Sha D, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019" } ], "reference": [ { "type": "PubMed", "id": "19019082", "url": "https://glygen.org/publication/PubMed/19019082" } ] }, { "title": "Epsin 1 is involved in recruitment of ubiquitinated EGF receptors into clathrin-coated pits.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2009", "authors": "Kazazic M, Bertelsen V, Pedersen KW, Vuong TT, Grandal MV, Rodland MS, Traub LM, Stang E, Madshus IH", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "19054389", "url": "https://glygen.org/publication/PubMed/19054389" } ] }, { "title": "The transforming Rho family GTPase Wrch-1 disrupts epithelial cell tight junctions and epithelial morphogenesis.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Brady DC, Alan JK, Madigan JP, Fanning AS, Cox AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "19064640", "url": "https://glygen.org/publication/PubMed/19064640" } ] }, { "title": "SNX9 - a prelude to vesicle release.", "journal": "Journal of cell science", "date": "2009", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19092055", "url": "https://glygen.org/publication/PubMed/19092055" } ] }, { "title": "Distinct recruitment of Eps15 via Its coiled-coil domain is required for efficient down-regulation of the met receptor tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Parachoniak CA, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "19109251", "url": "https://glygen.org/publication/PubMed/19109251" } ] }, { "title": "FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.", "journal": "Cell", "date": "2009", "authors": "Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19135894", "url": "https://glygen.org/publication/PubMed/19135894" } ] }, { "title": "A structural explanation for the binding of endocytic dileucine motifs by the AP2 complex.", "journal": "Nature", "date": "2008", "authors": "Kelly BT, McCoy AJ, Spate K, Miller SE, Evans PR, Honing S, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19140243", "url": "https://glygen.org/publication/PubMed/19140243" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "Hybrid structural model of the complete human ESCRT-0 complex.", "journal": "Structure", "date": "2009", "authors": "Ren Xuefeng, Kloer Daniel P, Kim Young C, Ghirlando Rodolfo, Saidi Layla F, Hummer Gerhard, Hurley James H", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "19278655", "url": "https://glygen.org/publication/PubMed/19278655" } ] }, { "title": "Clathrin regulates the association of PIPKIgamma661 with the AP-2 adaptor beta2 appendage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Thieman JR, Mishra SK, Ling K, Doray B, Anderson RA, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19287005", "url": "https://glygen.org/publication/PubMed/19287005" } ] }, { "title": "Membrane insertion of the FYVE domain is modulated by pH.", "journal": "Proteins", "date": "2009", "authors": "He J, Vora M, Haney RM, Filonov GS, Musselman CA, Burd CG, Kutateladze AG, Verkhusha VV, Stahelin RV, Kutateladze TG", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "19296456", "url": "https://glygen.org/publication/PubMed/19296456" } ] }, { "title": "Cargo and dynamin regulate clathrin-coated pit maturation.", "journal": "PLoS biology", "date": "2009", "authors": "Loerke D, Mettlen M, Yarar D, Jaqaman K, Jaqaman H, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19296720", "url": "https://glygen.org/publication/PubMed/19296720" } ] }, { "title": "Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shenoy SK, Modi AS, Shukla AK, Xiao K, Berthouze M, Ahn S, Wilkinson KD, Miller WE, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19363159", "url": "https://glygen.org/publication/PubMed/19363159" } ] }, { "title": "The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bomberger JM, Barnaby RL, Stanton BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19398555", "url": "https://glygen.org/publication/PubMed/19398555" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.", "journal": "The EMBO journal", "date": "2009", "authors": "Berthouze M, Venkataramanan V, Li Y, Shenoy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19424180", "url": "https://glygen.org/publication/PubMed/19424180" } ] }, { "title": "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Mettlen M, Stoeber M, Loerke D, Antonescu CN, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19458185", "url": "https://glygen.org/publication/PubMed/19458185" } ] }, { "title": "RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.", "journal": "Cell", "date": "2009", "authors": "Espinosa EJ, Calero M, Sridevi K, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019" } ], "reference": [ { "type": "PubMed", "id": "19490898", "url": "https://glygen.org/publication/PubMed/19490898" } ] }, { "title": "A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.", "journal": "The EMBO journal", "date": "2009", "authors": "Mao Y, Balkin DM, Zoncu R, Erdmann KS, Tomasini L, Hu F, Jin MM, Hodsdon ME, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19536138", "url": "https://glygen.org/publication/PubMed/19536138" } ] }, { "title": "Mutation in the AP4M1 gene provides a model for neuroaxonal injury in cerebral palsy.", "journal": "American journal of human genetics", "date": "2009", "authors": "Verkerk AJ, Schot R, Dumee B, Schellekens K, Swagemakers S, Bertoli-Avella AM, Lequin MH, Dudink J, Govaert P, van Zwol AL, Hirst J, Wessels MW, Catsman-Berrevoets C, Verheijen FW, de Graaff E, de Coo IF, Kros JM, Willemsen R, Willems PJ, van der Spek PJ, Mancini GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "19559397", "url": "https://glygen.org/publication/PubMed/19559397" } ] }, { "title": "Molecular circuitry of endocytosis at nerve terminals.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Dittman J, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19575674", "url": "https://glygen.org/publication/PubMed/19575674" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "The clavesin family, neuron-specific lipid- and clathrin-binding Sec14 proteins regulating lysosomal morphology.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Katoh Y, Ritter B, Gaffry T, Blondeau F, Honing S, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "19651769", "url": "https://glygen.org/publication/PubMed/19651769" } ] }, { "title": "NPXY, a sequence often found in cytoplasmic tails, is required for coated pit-mediated internalization of the low density lipoprotein receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Chen WJ, Goldstein JL, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1968060", "url": "https://glygen.org/publication/PubMed/1968060" } ] }, { "title": "Tickets to ride: selecting cargo for clathrin-regulated internalization.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19696796", "url": "https://glygen.org/publication/PubMed/19696796" } ] }, { "title": "Endocytosis and signalling: intertwining molecular networks.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Sorkin A, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19696798", "url": "https://glygen.org/publication/PubMed/19696798" } ] }, { "title": "Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.", "journal": "The EMBO journal", "date": "2009", "authors": "Reider A, Barker SL, Mishra SK, Im YJ, Maldonado-Baez L, Hurley JH, Traub LM, Wendland B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19713939", "url": "https://glygen.org/publication/PubMed/19713939" } ] }, { "title": "Stonins--specialized adaptors for synaptic vesicle recycling and beyond?", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Maritzen T, Podufall J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19732400", "url": "https://glygen.org/publication/PubMed/19732400" } ] }, { "title": "Early-arriving Syp1p and Ede1p function in endocytic site placement and formation in budding yeast.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Stimpson HE, Toret CP, Cheng AT, Pauly BS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19776351", "url": "https://glygen.org/publication/PubMed/19776351" } ] }, { "title": "Distinct dynamics of endocytic clathrin-coated pits and coated plaques.", "journal": "PLoS biology", "date": "2009", "authors": "Saffarian S, Cocucci E, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19809571", "url": "https://glygen.org/publication/PubMed/19809571" } ] }, { "title": "Eps15: a multifunctional adaptor protein regulating intracellular trafficking.", "journal": "Cell communication and signaling : CCS", "date": "2009", "authors": "van Bergen En Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "19814798", "url": "https://glygen.org/publication/PubMed/19814798" } ] }, { "title": "MdmX is a substrate for the deubiquitinating enzyme USP2a.", "journal": "Oncogene", "date": "2010", "authors": "Allende-Vega N, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" } ] }, { "title": "Arrestin development: emerging roles for beta-arrestins in developmental signaling pathways.", "journal": "Developmental cell", "date": "2009", "authors": "Kovacs JJ, Hara MR, Davenport CL, Kim J, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19853559", "url": "https://glygen.org/publication/PubMed/19853559" } ] }, { "title": "USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha.", "journal": "Cellular signalling", "date": "2010", "authors": "Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19874889", "url": "https://glygen.org/publication/PubMed/19874889" } ] }, { "title": "Ligand-mediated dimerization of the Met receptor tyrosine kinase by the bacterial invasion protein InlB.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Ferraris DM, Gherardi E, Di Y, Heinz DW, Niemann HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875360", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875360" } ], "reference": [ { "type": "PubMed", "id": "19900460", "url": "https://glygen.org/publication/PubMed/19900460" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19910467", "url": "https://glygen.org/publication/PubMed/19910467" } ] }, { "title": "Structure of clathrin coat with bound Hsc70 and auxilin: mechanism of Hsc70-facilitated disassembly.", "journal": "The EMBO journal", "date": "2010", "authors": "Xing Y, Bocking T, Wolf M, Grigorieff N, Kirchhausen T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20033059", "url": "https://glygen.org/publication/PubMed/20033059" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Coordinated actions of actin and BAR proteins upstream of dynamin at endocytic clathrin-coated pits.", "journal": "Developmental cell", "date": "2009", "authors": "Ferguson SM, Raimondi A, Paradise S, Shen H, Mesaki K, Ferguson A, Destaing O, Ko G, Takasaki J, Cremona O, O' Toole E, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20059951", "url": "https://glygen.org/publication/PubMed/20059951" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O14964-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14964-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "USP10 regulates p53 localization and stability by deubiquitinating p53.", "journal": "Cell", "date": "2010", "authors": "Yuan J, Luo K, Zhang L, Cheville JC, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20096447", "url": "https://glygen.org/publication/PubMed/20096447" } ] }, { "title": "Mycobacterial nucleoside diphosphate kinase blocks phagosome maturation in murine RAW 264.7 macrophages.", "journal": "PloS one", "date": "2010", "authors": "Sun J, Wang X, Lau A, Liao TY, Bucci C, Hmama Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9636383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383" } ], "reference": [ { "type": "PubMed", "id": "20098737", "url": "https://glygen.org/publication/PubMed/20098737" } ] }, { "title": "ArfGAP1 interacts with coat proteins through tryptophan-based motifs.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Rawet M, Levi-Tal S, Szafer-Glusman E, Parnis A, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20211604", "url": "https://glygen.org/publication/PubMed/20211604" } ] }, { "title": "Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.", "journal": "Nature cell biology", "date": "2010", "authors": "Pereg Y, Liu BY, O'Rourke KM, Sagolla M, Dey A, Komuves L, French DM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20228808", "url": "https://glygen.org/publication/PubMed/20228808" } ] }, { "title": "Sorting of the Alzheimer's disease amyloid precursor protein mediated by the AP-4 complex.", "journal": "Developmental cell", "date": "2010", "authors": "Burgos PV, Mardones GA, Rojas AL, daSilva LL, Prabhu Y, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "20230749", "url": "https://glygen.org/publication/PubMed/20230749" } ] }, { "title": "Cargo- and adaptor-specific mechanisms regulate clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mettlen M, Loerke D, Yarar D, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20231386", "url": "https://glygen.org/publication/PubMed/20231386" } ] }, { "title": "Alpha-AP-2 directs myosin VI-dependent endocytosis of cystic fibrosis transmembrane conductance regulator chloride channels in the intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Collaco A, Jakab R, Hegan P, Mooseker M, Ameen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20351096", "url": "https://glygen.org/publication/PubMed/20351096" } ] }, { "title": "The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.", "journal": "Cell research", "date": "2010", "authors": "Chen R, Zhang L, Zhong B, Tan B, Liu Y, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20368735", "url": "https://glygen.org/publication/PubMed/20368735" } ] }, { "title": "G domain dimerization controls dynamin's assembly-stimulated GTPase activity.", "journal": "Nature", "date": "2010", "authors": "Chappie JS, Acharya S, Leonard M, Schmid SL, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20428113", "url": "https://glygen.org/publication/PubMed/20428113" } ] }, { "title": "FCHo proteins are nucleators of clathrin-mediated endocytosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Henne WM, Boucrot E, Meinecke M, Evergren E, Vallis Y, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20448150", "url": "https://glygen.org/publication/PubMed/20448150" } ] }, { "title": "The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Dirac AM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20501646", "url": "https://glygen.org/publication/PubMed/20501646" } ] }, { "title": "Regulation of the Rho family small GTPase Wrch-1/RhoU by C-terminal tyrosine phosphorylation requires Src.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Alan JK, Berzat AC, Dewar BJ, Graves LM, Cox AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "20547754", "url": "https://glygen.org/publication/PubMed/20547754" } ] }, { "title": "gamma2-Adaptin is functioning in the late endosomal sorting pathway and interacts with ESCRT-I and -III subunits.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Doring T, Gotthardt K, Stieler J, Prange R", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "20708039", "url": "https://glygen.org/publication/PubMed/20708039" } ] }, { "title": "Structure of the PTEN-like region of auxilin, a detector of clathrin-coated vesicle budding.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Guan R, Dai H, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20826345", "url": "https://glygen.org/publication/PubMed/20826345" } ] }, { "title": "Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Dergai O, Novokhatska O, Dergai M, Skrypkina I, Tsyba L, Moreau J, Rynditch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20946875", "url": "https://glygen.org/publication/PubMed/20946875" } ] }, { "title": "Crystallographic and functional analysis of the ESCRT-I /HIV-1 Gag PTAP interaction.", "journal": "Structure", "date": "2010", "authors": "Im Young Jun, Kuo Lillian, Ren Xuefeng, Burgos Patricia V, Zhao Xue Zhi, Liu Fa, Burke Terrence R, Bonifacino Juan S, Freed Eric O, Hurley James H", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "21070952", "url": "https://glygen.org/publication/PubMed/21070952" } ] }, { "title": "CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.", "journal": "The EMBO journal", "date": "2011", "authors": "Granata A, Koo SJ, Haucke V, Schiavo G, Warner TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21102408", "url": "https://glygen.org/publication/PubMed/21102408" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Local clustering of transferrin receptors promotes clathrin-coated pit initiation.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Liu AP, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21187331", "url": "https://glygen.org/publication/PubMed/21187331" } ] }, { "title": "Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ramakrishna S, Suresh B, Lee EJ, Lee HJ, Ahn WS, Baek KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21239494", "url": "https://glygen.org/publication/PubMed/21239494" } ] }, { "title": "Single-molecule analysis of a molecular disassemblase reveals the mechanism of Hsc70-driven clathrin uncoating.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Bocking T, Aguet F, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21278753", "url": "https://glygen.org/publication/PubMed/21278753" } ] }, { "title": "Synaptojanin 1-mediated PI(4,5)P2 hydrolysis is modulated by membrane curvature and facilitates membrane fission.", "journal": "Developmental cell", "date": "2011", "authors": "Chang-Ileto B, Frere SG, Chan RB, Voronov SV, Roux A, Di Paolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21316588", "url": "https://glygen.org/publication/PubMed/21316588" } ] }, { "title": "USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase beta.", "journal": "Molecular cell", "date": "2011", "authors": "Parsons JL, Dianova II, Khoronenkova SV, Edelmann MJ, Kessler BM, Dianov GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21362556", "url": "https://glygen.org/publication/PubMed/21362556" } ] }, { "title": "Activation of multiple proto-oncogenic tyrosine kinases in breast cancer via loss of the PTPN12 phosphatase.", "journal": "Cell", "date": "2011", "authors": "Sun T, Aceto N, Meerbrey KL, Kessler JD, Zhou C, Migliaccio I, Nguyen DX, Pavlova NN, Botero M, Huang J, Bernardi RJ, Schmitt E, Hu G, Li MZ, Dephoure N, Gygi SP, Rao M, Creighton CJ, Hilsenbeck SG, Shaw CA, Muzny D, Gibbs RA, Wheeler DA, Osborne CK, Schiff R, Bentires-Alj M, Elledge SJ, Westbrook TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "21376233", "url": "https://glygen.org/publication/PubMed/21376233" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "A sequential mechanism for clathrin cage disassembly by 70-kDa heat-shock cognate protein (Hsc70) and auxilin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rothnie A, Clarke AR, Kuzmic P, Cameron A, Smith CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21482805", "url": "https://glygen.org/publication/PubMed/21482805" } ] }, { "title": "ARFGAP1 promotes AP-2-dependent endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Bai M, Gad H, Turacchio G, Cocucci E, Yang JS, Li J, Beznoussenko GV, Nie Z, Luo R, Fu L, Collawn JF, Kirchhausen T, Luini A, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21499258", "url": "https://glygen.org/publication/PubMed/21499258" } ] }, { "title": "GRB2 couples RhoU to epidermal growth factor receptor signaling and cell migration.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Zhang JS, Koenig A, Young C, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "21508312", "url": "https://glygen.org/publication/PubMed/21508312" } ] }, { "title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Naji L, Pacholsky D, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "21565175", "url": "https://glygen.org/publication/PubMed/21565175" } ] }, { "title": "Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Chen M, Gutierrez GJ, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21571647", "url": "https://glygen.org/publication/PubMed/21571647" } ] }, { "title": "Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.", "journal": "Molecular cell", "date": "2011", "authors": "Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21596315", "url": "https://glygen.org/publication/PubMed/21596315" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates clathrin-coated pit initiation, stabilization, and size.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Antonescu CN, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21613550", "url": "https://glygen.org/publication/PubMed/21613550" } ] }, { "title": "Adaptor protein complex 4 deficiency causes severe autosomal-recessive intellectual disability, progressive spastic paraplegia, shy character, and short stature.", "journal": "American journal of human genetics", "date": "2011", "authors": "Abou Jamra R, Philippe O, Raas-Rothschild A, Eck SH, Graf E, Buchert R, Borck G, Ekici A, Brockschmidt FF, Nothen MM, Munnich A, Strom TM, Reis A, Colleaux L", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "21620353", "url": "https://glygen.org/publication/PubMed/21620353" } ] }, { "title": "USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Scortegagna M, Subtil T, Qi J, Kim H, Zhao W, Gu W, Kluger H, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21659512", "url": "https://glygen.org/publication/PubMed/21659512" } ] }, { "title": "UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting.", "journal": "Current biology : CB", "date": "2011", "authors": "Stefani F, Zhang L, Taylor S, Donovan J, Rollinson S, Doyotte A, Brownhill K, Bennion J, Pickering-Brown S, Woodman P", "evidence": [ { "database": "Reactome", "id": "R-HSA-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729" } ], "reference": [ { "type": "PubMed", "id": "21757351", "url": "https://glygen.org/publication/PubMed/21757351" } ] }, { "title": "Molecular mechanism and physiological functions of clathrin-mediated endocytosis.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21779028", "url": "https://glygen.org/publication/PubMed/21779028" } ] }, { "title": "Actin dynamics counteract membrane tension during clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Boulant S, Kural C, Zeeh JC, Ubelmann F, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21841790", "url": "https://glygen.org/publication/PubMed/21841790" } ] }, { "title": "The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mei Y, Hahn AA, Hu S, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21849505", "url": "https://glygen.org/publication/PubMed/21849505" } ] }, { "title": "Hotspots organize clathrin-mediated endocytosis by efficient recruitment and retention of nucleating resources.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Nunez D, Antonescu C, Mettlen M, Liu A, Schmid SL, Loerke D, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21883765", "url": "https://glygen.org/publication/PubMed/21883765" } ] }, { "title": "Crystal structure of nucleotide-free dynamin.", "journal": "Nature", "date": "2011", "authors": "Faelber K, Posor Y, Gao S, Held M, Roske Y, Schulze D, Haucke V, Noe F, Daumke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927000", "url": "https://glygen.org/publication/PubMed/21927000" } ] }, { "title": "The crystal structure of dynamin.", "journal": "Nature", "date": "2011", "authors": "Ford MG, Jenni S, Nunnari J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927001", "url": "https://glygen.org/publication/PubMed/21927001" } ] }, { "title": "A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.", "journal": "Cell", "date": "2011", "authors": "Chappie JS, Mears JA, Fang S, Leonard M, Schmid SL, Milligan RA, Hinshaw JE, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21962517", "url": "https://glygen.org/publication/PubMed/21962517" } ] }, { "title": "Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.", "journal": "Cell", "date": "2011", "authors": "Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21962518", "url": "https://glygen.org/publication/PubMed/21962518" } ] }, { "title": "Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Biochemical journal", "date": "2012", "authors": "Fu L, Rab A, Tang LP, Rowe SM, Bebok Z, Collawn JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21995445", "url": "https://glygen.org/publication/PubMed/21995445" } ] }, { "title": "Ubiquitin-specific protease 4 (USP4) targets TRAF2 and TRAF6 for deubiquitination and inhibits TNFalpha-induced cancer cell migration.", "journal": "The Biochemical journal", "date": "2012", "authors": "Xiao N, Li H, Luo J, Wang R, Chen H, Chen J, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22029577", "url": "https://glygen.org/publication/PubMed/22029577" } ] }, { "title": "Regulation of p53 stability and function by the deubiquitinating enzyme USP42.", "journal": "The EMBO journal", "date": "2011", "authors": "Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22085928", "url": "https://glygen.org/publication/PubMed/22085928" } ] }, { "title": "Recruitment of endophilin to clathrin-coated pit necks is required for efficient vesicle uncoating after fission.", "journal": "Neuron", "date": "2011", "authors": "Milosevic I, Giovedi S, Lou X, Raimondi A, Collesi C, Shen H, Paradise S, O'Toole E, Ferguson S, Cremona O, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22099461", "url": "https://glygen.org/publication/PubMed/22099461" } ] }, { "title": "The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.", "journal": "Cell", "date": "2011", "authors": "Miller SE, Sahlender DA, Graham SC, Honing S, Robinson MS, Peden AA, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22118466", "url": "https://glygen.org/publication/PubMed/22118466" } ] }, { "title": "Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Altun M, Zhao B, Velasco K, Liu H, Hassink G, Paschke J, Pereira T, Lindsten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22128162", "url": "https://glygen.org/publication/PubMed/22128162" } ] }, { "title": "Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.", "journal": "PloS one", "date": "2011", "authors": "Zhang YH, Zhou CJ, Zhou ZR, Song AX, Hu HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22216260", "url": "https://glygen.org/publication/PubMed/22216260" } ] }, { "title": "Dynamin, a membrane-remodelling GTPase.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Ferguson SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22233676", "url": "https://glygen.org/publication/PubMed/22233676" } ] }, { "title": "RhoBTB3 interacts with the 5-HT7a receptor and inhibits its proteasomal degradation.", "journal": "Cellular signalling", "date": "2012", "authors": "Matthys A, Van Craenenbroeck K, Lintermans B, Haegeman G, Vanhoenacker P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019" } ], "reference": [ { "type": "PubMed", "id": "22245496", "url": "https://glygen.org/publication/PubMed/22245496" } ] }, { "title": "The role of ubiquitylation in receptor endocytosis and endosomal sorting.", "journal": "Journal of cell science", "date": "2012", "authors": "Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22357968", "url": "https://glygen.org/publication/PubMed/22357968" } ] }, { "title": "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.", "journal": "Nature cell biology", "date": "2012", "authors": "Umasankar PK, Sanker S, Thieman JR, Chakraborty S, Wendland B, Tsang M, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22484487", "url": "https://glygen.org/publication/PubMed/22484487" } ] }, { "title": "A feedback loop between dynamin and actin recruitment during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2012", "authors": "Taylor MJ, Lampe M, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22505844", "url": "https://glygen.org/publication/PubMed/22505844" } ] }, { "title": "Transferrin receptor internalization sequence YXRF implicates a tight turn as the structural recognition motif for endocytosis.", "journal": "Cell", "date": "1990", "authors": "Collawn JF, Stangel M, Kuhn LA, Esekogwu V, Jing SQ, Trowbridge IS, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2257624", "url": "https://glygen.org/publication/PubMed/2257624" } ] }, { "title": "Discovery of O-GlcNAc-modified proteins in published large-scale proteome data.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Hahne H, Gholami AM, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "database": "O-GlcNAc Atlas", "id": "O14964", "url": "https://oglcnac.org/atlas/detail/O14964" } ], "reference": [ { "type": "PubMed", "id": "22661428", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "title": "MUF1/leucine-rich repeat containing 41 (LRRC41), a substrate of RhoBTB-dependent cullin 3 ubiquitin ligase complexes, is a predominantly nuclear dimeric protein.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Schenkova K, Lutz J, Kopp M, Ramos S, Rivero F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019" } ], "reference": [ { "type": "PubMed", "id": "22709582", "url": "https://glygen.org/publication/PubMed/22709582" } ] }, { "title": "BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Moravec R, Conger KK, D'Souza R, Allison AB, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22815487", "url": "https://glygen.org/publication/PubMed/22815487" } ] }, { "title": "The first five seconds in the life of a clathrin-coated pit.", "journal": "Cell", "date": "2012", "authors": "Cocucci E, Aguet F, Boulant S, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22863004", "url": "https://glygen.org/publication/PubMed/22863004" } ] }, { "title": "The epsin protein family: coordinators of endocytosis and signaling.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Sen A, Madhivanan K, Mukherjee D, Aguilar RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22942912", "url": "https://glygen.org/publication/PubMed/22942912" } ] }, { "title": "The deubiquitinating protein USP24 interacts with DDB2 and regulates DDB2 stability.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Zhang L, Lubin A, Chen H, Sun Z, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23159851", "url": "https://glygen.org/publication/PubMed/23159851" } ] }, { "title": "Charcot-Marie-Tooth disease-linked protein SIMPLE functions with the ESCRT machinery in endosomal trafficking.", "journal": "J. Cell Biol.", "date": "2012", "authors": "Lee SM, Chin LS, Li L", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "23166352", "url": "https://glygen.org/publication/PubMed/23166352" } ] }, { "title": "Cbl-independent degradation of Met: ways to avoid agonism of bivalent Met-targeting antibody.", "journal": "Oncogene", "date": "2014", "authors": "Lee JM, Kim B, Lee SB, Jeong Y, Oh YM, Song YJ, Jung S, Choi J, Lee S, Cheong KH, Kim DU, Park HW, Han YK, Kim GW, Choi H, Song PH, Kim KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "23208509", "url": "https://glygen.org/publication/PubMed/23208509" } ] }, { "title": "Distinct roles for beta-arrestin2 and arrestin-domain-containing proteins in beta2 adrenergic receptor trafficking.", "journal": "EMBO Rep.", "date": "2013", "authors": "Han SO, Kommaddi RP, Shenoy SK", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "23208550", "url": "https://glygen.org/publication/PubMed/23208550" } ] }, { "title": "Mammalian alpha arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with beta arrestins.", "journal": "PLoS ONE", "date": "2012", "authors": "Shea FF, Rowell JL, Li Y, Chang TH, Alvarez CE", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "23236378", "url": "https://glygen.org/publication/PubMed/23236378" } ] }, { "title": "Cooperative recruitment of dynamin and BIN/amphiphysin/Rvs (BAR) domain-containing proteins leads to GTP-dependent membrane scission.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Meinecke M, Boucrot E, Camdere G, Hon WC, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23297414", "url": "https://glygen.org/publication/PubMed/23297414" } ] }, { "title": "Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Zhang J, Chen C, Hou X, Gao Y, Lin F, Yang J, Gao Z, Pan L, Tao L, Wen C, Yao Z, Tsun A, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23395819", "url": "https://glygen.org/publication/PubMed/23395819" } ] }, { "title": "USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.", "journal": "Nature", "date": "2013", "authors": "Li J, D'Angiolella V, Seeley ES, Kim S, Kobayashi T, Fu W, Campos EI, Pagano M, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23486064", "url": "https://glygen.org/publication/PubMed/23486064" } ] }, { "title": "Divergent modes for cargo-mediated control of clathrin-coated pit dynamics.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Soohoo AL, Puthenveedu MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23536704", "url": "https://glygen.org/publication/PubMed/23536704" } ] }, { "title": "Spatiotemporal control of endocytosis by phosphatidylinositol-3,4-bisphosphate.", "journal": "Nature", "date": "2013", "authors": "Posor Y, Eichhorn-Gruenig M, Puchkov D, Schoneberg J, Ullrich A, Lampe A, Muller R, Zarbakhsh S, Gulluni F, Hirsch E, Krauss M, Schultz C, Schmoranzer J, Noe F, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23823722", "url": "https://glygen.org/publication/PubMed/23823722" } ] }, { "title": "USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.", "journal": "Genes & development", "date": "2013", "authors": "Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23824326", "url": "https://glygen.org/publication/PubMed/23824326" } ] }, { "title": "USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Liu X, Li H, Zhong B, Blonska M, Gorjestani S, Yan M, Tian Q, Zhang DE, Lin X, Dong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23825189", "url": "https://glygen.org/publication/PubMed/23825189" } ] }, { "title": "Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Neumann S, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23861397", "url": "https://glygen.org/publication/PubMed/23861397" } ] }, { "title": "Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.", "journal": "Developmental cell", "date": "2013", "authors": "Aguet F, Antonescu CN, Mettlen M, Schmid SL, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23891661", "url": "https://glygen.org/publication/PubMed/23891661" } ] }, { "title": "Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Burska UL, Harle VJ, Coffey K, Darby S, Ramsey H, O'Neill D, Logan IR, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24056413", "url": "https://glygen.org/publication/PubMed/24056413" } ] }, { "title": "NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2013", "authors": "Ritter B, Murphy S, Dokainish H, Girard M, Gudheti MV, Kozlov G, Halin M, Philie J, Jorgensen EM, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24130457", "url": "https://glygen.org/publication/PubMed/24130457" } ] }, { "title": "Golgi-associated RhoBTB3 targets cyclin E for ubiquitylation and promotes cell cycle progression.", "journal": "The Journal of cell biology", "date": "2013", "authors": "Lu A, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019" } ], "reference": [ { "type": "PubMed", "id": "24145166", "url": "https://glygen.org/publication/PubMed/24145166" } ] }, { "title": "Cargo recognition in clathrin-mediated endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Traub LM, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24186068", "url": "https://glygen.org/publication/PubMed/24186068" } ] }, { "title": "Mycobacterium tuberculosis type VII secreted effector EsxH targets host ESCRT to impair trafficking.", "journal": "PLoS pathogens", "date": "2013", "authors": "Mehra A, Zahra A, Thompson V, Sirisaengtaksin N, Wells A, Porto M, Koster S, Penberthy K, Kubota Y, Dricot A, Rogan D, Vidal M, Hill DE, Bean AJ, Philips JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9635644", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9635644" } ], "reference": [ { "type": "PubMed", "id": "24204276", "url": "https://glygen.org/publication/PubMed/24204276" } ] }, { "title": "Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.", "journal": "PloS one", "date": "2013", "authors": "Zhong H, Wang D, Fang L, Zhang H, Luo R, Shang M, Ouyang C, Ouyang H, Chen H, Xiao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24260525", "url": "https://glygen.org/publication/PubMed/24260525" } ] }, { "title": "Whole-exome sequencing of pancreatic neoplasms with acinar differentiation.", "journal": "The Journal of pathology", "date": "2014", "authors": "Jiao Y, Yonescu R, Offerhaus GJ, Klimstra DS, Maitra A, Eshleman JR, Herman JG, Poh W, Pelosof L, Wolfgang CL, Vogelstein B, Kinzler KW, Hruban RH, Papadopoulos N, Wood LD", "evidence": [ { "database": "dbSNP", "id": "rs1327545344", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1327545344" } ], "reference": [ { "type": "PubMed", "id": "24293293", "url": "https://glygen.org/publication/PubMed/24293293" } ] }, { "title": "Ubiquitin-dependent sorting in endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Piper RC, Dikic I, Lukacs GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24384571", "url": "https://glygen.org/publication/PubMed/24384571" } ] }, { "title": "USP21 negatively regulates antiviral response by acting as a RIG-I deubiquitinase.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Fan Y, Mao R, Yu Y, Liu S, Shi Z, Cheng J, Zhang H, An L, Zhao Y, Xu X, Chen Z, Kogiso M, Zhang D, Zhang H, Zhang P, Jung JU, Li X, Xu G, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24493797", "url": "https://glygen.org/publication/PubMed/24493797" } ] }, { "title": "BAR domain scaffolds in dynamin-mediated membrane fission.", "journal": "Cell", "date": "2014", "authors": "Daumke O, Roux A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24581490", "url": "https://glygen.org/publication/PubMed/24581490" } ] }, { "title": "Role of beta-arrestins and arrestin domain-containing proteins in G protein-coupled receptor trafficking.", "journal": "Current opinion in cell biology", "date": "2014", "authors": "Kang DS, Tian X, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24680432", "url": "https://glygen.org/publication/PubMed/24680432" } ] }, { "title": "Regulation of clathrin-mediated endocytosis by dynamic ubiquitination and deubiquitination.", "journal": "Current biology : CB", "date": "2014", "authors": "Weinberg JS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24746795", "url": "https://glygen.org/publication/PubMed/24746795" } ] }, { "title": "Molecular structure, function, and dynamics of clathrin-mediated membrane traffic.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Kirchhausen T, Owen D, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24789820", "url": "https://glygen.org/publication/PubMed/24789820" } ] }, { "title": "The ubiquitin ligase deltex-3l regulates endosomal sorting of the G protein-coupled receptor CXCR4.", "journal": "Molecular biology of the cell", "date": "2014", "authors": "Holleman J, Marchese A", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "24790097", "url": "https://glygen.org/publication/PubMed/24790097" } ] }, { "title": "USP8 modulates ubiquitination of LRIG1 for Met degradation.", "journal": "Scientific reports", "date": "2014", "authors": "Oh YM, Lee SB, Choi J, Suh HY, Shim S, Song YJ, Kim B, Lee JM, Oh SJ, Jeong Y, Cheong KH, Song PH, Kim KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "24828152", "url": "https://glygen.org/publication/PubMed/24828152" } ] }, { "title": "The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.", "journal": "Nature", "date": "2014", "authors": "Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24896179", "url": "https://glygen.org/publication/PubMed/24896179" } ] }, { "title": "Inositol lipid phosphatases in membrane trafficking and human disease.", "journal": "The Biochemical journal", "date": "2014", "authors": "Billcliff PG, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24966051", "url": "https://glygen.org/publication/PubMed/24966051" } ] }, { "title": "A role of OCRL in clathrin-coated pit dynamics and uncoating revealed by studies of Lowe syndrome cells.", "journal": "eLife", "date": "2014", "authors": "Nandez R, Balkin DM, Messa M, Liang L, Paradise S, Czapla H, Hein MY, Duncan JS, Mann M, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25107275", "url": "https://glygen.org/publication/PubMed/25107275" } ] }, { "title": "Deubiquitination and stabilization of IL-33 by USP21.", "journal": "International journal of clinical and experimental pathology", "date": "2014", "authors": "Tao L, Chen C, Song H, Piccioni M, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25197364", "url": "https://glygen.org/publication/PubMed/25197364" } ] }, { "title": "Protein tyrosine phosphatase PTPN3 inhibits lung cancer cell proliferation and migration by promoting EGFR endocytic degradation.", "journal": "Oncogene", "date": "2015", "authors": "Li MY, Lai PL, Chou YT, Chi AP, Mi YZ, Khoo KH, Chang GD, Wu CW, Meng TC, Chen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "25263444", "url": "https://glygen.org/publication/PubMed/25263444" } ] }, { "title": "The membrane-associated proteins FCHo and SGIP are allosteric activators of the AP2 clathrin adaptor complex.", "journal": "eLife", "date": "2014", "authors": "Hollopeter G, Lange JJ, Zhang Y, Vu TN, Gu M, Ailion M, Lambie EJ, Slaughter BD, Unruh JR, Florens L, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25303366", "url": "https://glygen.org/publication/PubMed/25303366" } ] }, { "title": "The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Zhang Z, Yang H, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25305019", "url": "https://glygen.org/publication/PubMed/25305019" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "The deubiquitinating enzyme USP24 is a regulator of the UV damage response.", "journal": "Cell reports", "date": "2015", "authors": "Zhang L, Nemzow L, Chen H, Lubin A, Rong X, Sun Z, Harris TK, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25578727", "url": "https://glygen.org/publication/PubMed/25578727" } ] }, { "title": "LAPTM4B is a PtdIns(4,5)P2 effector that regulates EGFR signaling, lysosomal sorting, and degradation.", "journal": "The EMBO journal", "date": "2015", "authors": "Tan X, Sun Y, Thapa N, Liao Y, Hedman AC, Anderson RA", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "25588945", "url": "https://glygen.org/publication/PubMed/25588945" } ] }, { "title": "Mycobacterium tuberculosis suppresses innate immunity by coopting the host ubiquitin system.", "journal": "Nature immunology", "date": "2015", "authors": "Wang J, Li BX, Ge PP, Li J, Wang Q, Gao GF, Qiu XB, Liu CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9636383", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383" } ], "reference": [ { "type": "PubMed", "id": "25642820", "url": "https://glygen.org/publication/PubMed/25642820" } ] }, { "title": "The role of molecular chaperones in clathrin mediated vesicular trafficking.", "journal": "Frontiers in molecular biosciences", "date": "2015", "authors": "Sousa R, Lafer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26042225", "url": "https://glygen.org/publication/PubMed/26042225" } ] }, { "title": "RHOBTB3 promotes proteasomal degradation of HIFalpha through facilitating hydroxylation and suppresses the Warburg effect.", "journal": "Cell research", "date": "2015", "authors": "Zhang CS, Liu Q, Li M, Lin SY, Peng Y, Wu D, Li TY, Fu Q, Jia W, Wang X, Ma T, Zong Y, Cui J, Pu C, Lian G, Guo H, Ye Z, Lin SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9706019", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019" } ], "reference": [ { "type": "PubMed", "id": "26215701", "url": "https://glygen.org/publication/PubMed/26215701" } ] }, { "title": "Forty Years of Clathrin-coated Vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26403691", "url": "https://glygen.org/publication/PubMed/26403691" } ] }, { "title": "PAK4 promotes kinase-independent stabilization of RhoU to modulate cell adhesion.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Dart AE, Box GM, Court W, Gale ME, Brown JP, Pinder SE, Eccles SA, Wells CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "26598620", "url": "https://glygen.org/publication/PubMed/26598620" } ] }, { "title": "beta-Arrestin drives MAP kinase signalling from clathrin-coated structures after GPCR dissociation.", "journal": "Nature cell biology", "date": "2016", "authors": "Eichel K, Jullie D, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "26829388", "url": "https://glygen.org/publication/PubMed/26829388" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Clathrin assembly proteins: affinity purification and a model for coat assembly.", "journal": "The Journal of cell biology", "date": "1987", "authors": "Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2890644", "url": "https://glygen.org/publication/PubMed/2890644" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "database": "O-GlcNAc Atlas", "id": "O14964", "url": "https://oglcnac.org/atlas/detail/O14964" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "O-GlcNAc Transferase Recognizes Protein Substrates Using an Asparagine Ladder in the Tetratricopeptide Repeat (TPR) Superhelix.", "journal": "Journal of the American Chemical Society", "date": "2018", "authors": "Levine ZG, Fan C, Melicher MS, Orman M, Benjamin T, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "29485866", "url": "https://glygen.org/publication/PubMed/29485866" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "database": "O-GlcNAc Atlas", "id": "O14964", "url": "https://oglcnac.org/atlas/detail/O14964" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Mycobacterium tuberculosis Type VII Secretion System Effectors Differentially Impact the ESCRT Endomembrane Damage Response.", "journal": "mBio", "date": "2018", "authors": "Mittal E, Skowyra ML, Uwase G, Tinaztepe E, Mehra A, Koster S, Hanson PI, Philips JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9635644", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9635644" } ], "reference": [ { "type": "PubMed", "id": "30482832", "url": "https://glygen.org/publication/PubMed/30482832" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" }, { "database": "O-GlcNAc Atlas", "id": "O14964", "url": "https://oglcnac.org/atlas/detail/O14964" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Epstein-Barr Virus LMP1 Promotes Syntenin-1- and Hrs-Induced Extracellular Vesicle Formation for Its Own Secretion To Increase Cell Proliferation and Migration.", "journal": "mBio", "date": "2020", "authors": "Nkosi D, Sun L, Duke LC, Patel N, Surapaneni SK, Singh M, Meckes DG Jr", "evidence": [ { "database": "RefSeq", "id": "NP_004703", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703" } ], "reference": [ { "type": "PubMed", "id": "32546618", "url": "https://glygen.org/publication/PubMed/32546618" } ] }, { "title": "The atypical Rho GTPase RhoU interacts with intersectin-2 to regulate endosomal recycling pathways.", "journal": "Journal of cell science", "date": "2020", "authors": "Gubar O, Croise P, Kropyvko S, Gryaznova T, Toth P, Blangy A, Vitale N, Rynditch A, Gasman S, Ory S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013420", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420" } ], "reference": [ { "type": "PubMed", "id": "32737221", "url": "https://glygen.org/publication/PubMed/32737221" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O14964", "url": "https://oglcnac.org/atlas/detail/O14964" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Deep-etch visualization of proteins involved in clathrin assembly.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Heuser JE, Keen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "3417785", "url": "https://glygen.org/publication/PubMed/3417785" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "HRS regulates small extracellular vesicle PD-L1 secretion and is associated with anti-PD-1 treatment efficacy.", "journal": "Cancer immunology research", "date": "2022-12-09", "authors": "Xiao Bo-Lin, Wang Xiao-Le, Xia Hou-Fu, Zhang Lin-Zhou, Wang Kui-Ming, Chen Zhuo-Kun, Zhong Ya-Hua, Jiang Huan-Gang, Zhou Fu-Xiang, Wang Wei, Chen Gai-Li, Chen Gang", "evidence": [ { "database": "RefSeq", "id": "NP_004703", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004703" } ], "reference": [ { "type": "PubMed", "id": "36484721", "url": "https://glygen.org/publication/PubMed/36484721" } ] }, { "title": "`Two Birds One Stone` Strategy for the Site-Specific Analysis of Core Fucosylation and O-GlcNAcylation.", "journal": "Journal of the American Chemical Society", "date": "2023-07-26", "authors": "Luo Yawen, Wang Yuqiu, Tian Yinping, Zhou Hu, Wen Liuqing", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14964", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14964" } ], "reference": [ { "type": "PubMed", "id": "37340703", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "title": "An enzyme that removes clathrin coats: purification of an uncoating ATPase.", "journal": "The Journal of cell biology", "date": "1984", "authors": "Schlossman DM, Schmid SL, Braell WA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "6146630", "url": "https://glygen.org/publication/PubMed/6146630" } ] }, { "title": "The phosphotyrosine interaction domain of SHC recognizes tyrosine-phosphorylated NPXY motif.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Songyang Z, Margolis B, Chaudhuri M, Shoelson SE, Cantley LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "7541030", "url": "https://glygen.org/publication/PubMed/7541030" } ] }, { "title": "The phosphotyrosine interaction domain of Shc binds an LXNPXY motif on the epidermal growth factor receptor.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Batzer AG, Blaikie P, Nelson K, Schlessinger J, Margolis B", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "7542744", "url": "https://glygen.org/publication/PubMed/7542744" } ] }, { "title": "Interaction of tyrosine-based sorting signals with clathrin-associated proteins.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Ohno H, Stewart J, Fournier MC, Bosshart H, Rhee I, Miyatake S, Saito T, Gallusser A, Kirchhausen T, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7569928", "url": "https://glygen.org/publication/PubMed/7569928" } ] }, { "title": "Metabolism of the polyubiquitin degradation signal: structure, mechanism, and role of isopeptidase T.", "journal": "Biochemistry", "date": "1995", "authors": "Wilkinson KD, Tashayev VL, O'Connor LB, Larsen CN, Kasperek E, Pickart CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "7578059", "url": "https://glygen.org/publication/PubMed/7578059" } ] }, { "title": "Tyrosine phosphorylation of the c-cbl proto-oncogene protein product and association with epidermal growth factor (EGF) receptor upon EGF stimulation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Galisteo ML, Dikic I, Batzer AG, Langdon WY, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "7657591", "url": "https://glygen.org/publication/PubMed/7657591" } ] }, { "title": "Arrestin interactions with G protein-coupled receptors. Direct binding studies of wild type and mutant arrestins with rhodopsin, beta 2-adrenergic, and m2 muscarinic cholinergic receptors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gurevich VV, Dion SB, Onorato JJ, Ptasienski J, Kim CM, Sterne-Marr R, Hosey MM, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7822302", "url": "https://glygen.org/publication/PubMed/7822302" } ] }, { "title": "Dynamin self-assembles into rings suggesting a mechanism for coated vesicle budding.", "journal": "Nature", "date": "1995", "authors": "Hinshaw JE, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "7877694", "url": "https://glygen.org/publication/PubMed/7877694" } ] }, { "title": "Alteration of clathrin light chain expression by transfection and gene disruption.", "journal": "Molecular biology of the cell", "date": "1993", "authors": "Acton SL, Wong DH, Parham P, Brodsky FM, Jackson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "8374173", "url": "https://glygen.org/publication/PubMed/8374173" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "A role of amphiphysin in synaptic vesicle endocytosis suggested by its binding to dynamin in nerve terminals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "David C, McPherson PS, Mundigl O, de Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8552632", "url": "https://glygen.org/publication/PubMed/8552632" } ] }, { "title": "Role of beta-arrestin in mediating agonist-promoted G protein-coupled receptor internalization.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Ferguson SS, Downey WE 3rd, Colapietro AM, Barak LS, Menard L, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8553074", "url": "https://glygen.org/publication/PubMed/8553074" } ] }, { "title": "p120cbl is a major substrate of tyrosine phosphorylation upon B cell antigen receptor stimulation and interacts in vivo with Fyn and Syk tyrosine kinases, Grb2 and Shc adaptors, and the p85 subunit of phosphatidylinositol 3-kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Panchamoorthy G, Fukazawa T, Miyake S, Soltoff S, Reedquist K, Druker B, Shoelson S, Cantley L, Band H", "evidence": [ { "database": "Reactome", "id": "R-HSA-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971" } ], "reference": [ { "type": "PubMed", "id": "8621719", "url": "https://glygen.org/publication/PubMed/8621719" } ] }, { "title": "Dynamin II binds to the trans-Golgi network.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Maier O, Knoblich M, Westermann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "8670264", "url": "https://glygen.org/publication/PubMed/8670264" } ] }, { "title": "Beta-arrestin acts as a clathrin adaptor in endocytosis of the beta2-adrenergic receptor.", "journal": "Nature", "date": "1996", "authors": "Goodman OB Jr, Krupnick JG, Santini F, Gurevich VV, Penn RB, Gagnon AW, Keen JH, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8837779", "url": "https://glygen.org/publication/PubMed/8837779" } ] }, { "title": "Synaptic vesicle endocytosis impaired by disruption of dynamin-SH3 domain interactions.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Shupliakov O, Low P, Grabs D, Gad H, Chen H, David C, Takei K, De Camilli P, Brodin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9092476", "url": "https://glygen.org/publication/PubMed/9092476" } ] }, { "title": "Auxilin-induced interaction of the molecular chaperone Hsc70 with clathrin baskets.", "journal": "Biochemistry", "date": "1997", "authors": "Barouch W, Prasad K, Greene L, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9100026", "url": "https://glygen.org/publication/PubMed/9100026" } ] }, { "title": "Arrestin/clathrin interaction. Localization of the arrestin binding locus to the clathrin terminal domain.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Goodman OB Jr, Krupnick JG, Gurevich VV, Benovic JL, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9169477", "url": "https://glygen.org/publication/PubMed/9169477" } ] }, { "title": "Hrs, a tyrosine kinase substrate with a conserved double zinc finger domain, is localized to the cytoplasmic surface of early endosomes.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Komada M, Masaki R, Yamamoto A, Kitamura N", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "9252367", "url": "https://glygen.org/publication/PubMed/9252367" } ] }, { "title": "Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.", "journal": "Genes & development", "date": "1997", "authors": "Salcini AE, Confalonieri S, Doria M, Santolini E, Tassi E, Minenkova O, Cesareni G, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9303539", "url": "https://glygen.org/publication/PubMed/9303539" } ] }, { "title": "Hrs is associated with STAM, a signal-transducing adaptor molecule. Its suppressive effect on cytokine-induced cell growth.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Asao H, Sasaki Y, Arita T, Tanaka N, Endo K, Kasai H, Takeshita T, Endo Y, Fujita T, Sugamura K", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "9407053", "url": "https://glygen.org/publication/PubMed/9407053" } ] }, { "title": "A novel role for Rab5-GDI in ligand sequestration into clathrin-coated pits.", "journal": "Current biology : CB", "date": "1998", "authors": "McLauchlan H, Newell J, Morrice N, Osborne A, West M, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9427626", "url": "https://glygen.org/publication/PubMed/9427626" } ] }, { "title": "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.", "journal": "FEBS letters", "date": "1997", "authors": "Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9428629", "url": "https://glygen.org/publication/PubMed/9428629" } ] }, { "title": "Human Hrs, a tyrosine kinase substrate in growth factor-stimulated cells: cDNA cloning and mapping of the gene to chromosome 17.", "journal": "Gene", "date": "1998", "authors": "Lu L, Komada M, Kitamura N", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "reference": [ { "type": "PubMed", "id": "9630564", "url": "https://glygen.org/publication/PubMed/9630564" } ] }, { "title": "Dynamin undergoes a GTP-dependent conformational change causing vesiculation.", "journal": "Cell", "date": "1998", "authors": "Sweitzer SM, Hinshaw JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9635431", "url": "https://glygen.org/publication/PubMed/9635431" } ] }, { "title": "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.", "journal": "Nature", "date": "1998", "authors": "Chen H, Fre S, Slepnev VI, Capua MR, Takei K, Butler MH, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9723620", "url": "https://glygen.org/publication/PubMed/9723620" } ] }, { "title": "Identification and characterization of novel clathrin adaptor-related proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Takatsu H, Sakurai M, Shin HW, Murakami K, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "9733768", "url": "https://glygen.org/publication/PubMed/9733768" } ] }, { "title": "Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.", "journal": "The EMBO journal", "date": "1998", "authors": "Owen DJ, Wigge P, Vallis Y, Moore JD, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9736607", "url": "https://glygen.org/publication/PubMed/9736607" } ] }, { "title": "A structural explanation for the recognition of tyrosine-based endocytotic signals.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Owen DJ, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9812899", "url": "https://glygen.org/publication/PubMed/9812899" } ] } ], "pathway": [ { "id": "hsa:9146", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9146", "resource": "KEGG Pathway" }, { "id": "R-HSA-182971", "name": "EGFR downregulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-182971", "resource": "Reactome", "description": "EGFR downregulation" }, { "id": "R-HSA-432720", "name": "Lysosome Vesicle Biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720", "resource": "Reactome", "description": "Lysosome Vesicle Biogenesis" }, { "id": "R-HSA-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-HSA-6807004", "name": "Negative regulation of MET activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004", "resource": "Reactome", "description": "Negative regulation of MET activity" }, { "id": "R-HSA-8856825", "name": "Cargo recognition for clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "resource": "Reactome", "description": "Cargo recognition for clathrin-mediated endocytosis" }, { "id": "R-HSA-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" }, { "id": "R-HSA-8875360", "name": "InlB-mediated entry of Listeria monocytogenes into host cell", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875360", "resource": "Reactome", "description": "InlB-mediated entry of Listeria monocytogenes into host cell" }, { "id": "R-HSA-9013420", "name": "RHOU GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013420", "resource": "Reactome", "description": "RHOU GTPase cycle" }, { "id": "R-HSA-917729", "name": "Endosomal Sorting Complex Required For Transport (ESCRT)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917729", "resource": "Reactome", "description": "Endosomal Sorting Complex Required For Transport (ESCRT)" }, { "id": "R-HSA-9635644", "name": "Inhibition of membrane repair", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9635644", "resource": "Reactome", "description": "Inhibition of membrane repair" }, { "id": "R-HSA-9636383", "name": "Prevention of phagosomal-lysosomal fusion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636383", "resource": "Reactome", "description": "Prevention of phagosomal-lysosomal fusion" }, { "id": "R-HSA-9706019", "name": "RHOBTB3 ATPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9706019", "resource": "Reactome", "description": "RHOBTB3 ATPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "Q960X8-1", "protein_name": "Hepatocyte growth factor-regulated tyrosine kinase substrate", "gene_name": "Hrs", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MFRSSFDKNLENATSHLRLEPDWPSILLICDEINQKDVTPKNAFAAIKKKMNSPNPHSSCYSLLVLESIVKNCGAPVHEEVFTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSSDKYQAIKDTMTILKAKGHTFPELREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSGGAKSGPRPADSELPAEYLNSTLAQQVQTPARKTEQELKEEEELQLALALSQSEAEQQKPKLQSLPPAAYRMQQRSPSPEAPPEPKEYHQQPEEATNPELAKYLNRSYWEQRKISESSSMASPSAPSPMPPTPQPQQIMPLQVKSADEVQIDEFAANMRTQVEIFVNRMKSNSSRGRSISNDSSVQTLFMTLTSLHSQQLSYIKEMDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLRRIAEEQERQRQMQMAQKLDIMRKKKQEYLQYQRQLALQRIQEQEREMQLRQEQQKAQYLMGQSAPPFPYMPPSAVPQHGSPSHQLNNVYNPYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMPPNLQPGGLMQQPAPPGNPQMMPPMPENQFANNPAAILQLPQQHSIAQPPQIPFQPQPQQIPGQQPQQIPGQQPQQIPGQQPQQIPGQQPQQIPVQQPQPQPQMGHVMLQQHQAPPAAQAPPVTEIANNQVQAVAAAPAPPQNEPGPAPVKAEEPATAELISFD", "length": 760 }, "evidence": [ { "id": "O14964", "url": "https://omabrowser.org/oma/group/O14964/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q99LI8-1", "protein_name": "Hepatocyte growth factor-regulated tyrosine kinase substrate", "gene_name": "Hgs", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKTTYTAHPKAEPTPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMAEAPLPETDSQPITPCSGPFSEYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPATFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPTGAPGAQAAPQAQAGPTTSPAYSSYQPTPTPGYQSVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTALPGQDASLPAQQPYIPGQQPLYQQMAPSTGPPQQQPPVAQPAPTQGPPAQGSEAQLISFD", "length": 775 }, "evidence": [ { "id": "45928428", "url": "http://www.informatics.jax.org/homology/45928428", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JJ50-1", "protein_name": "Hepatocyte growth factor-regulated tyrosine kinase substrate", "gene_name": "Hgs", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKAASTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSTYTAHPKSEPAPLASSAPPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHTAPNSMVEAPLPETDSQPITSCSGPFSEQYQNGESEESHEQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINSTHPQLLELLNRLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPGTFSPAGSVEGSPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPAGAPGAQAAPQAQAGPTTNPAYSSYQPTPTPGYQNVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTTLPGQDASLPAQQPYITGQQPMYQQMAPSTGPPQQQPPVAQPPPTQGPPAQGNETQLISFD", "length": 776 }, "evidence": [ { "id": "45928428", "url": "http://www.informatics.jax.org/homology/45928428", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "early endosome membrane", "id": "GO:0031901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "multivesicular body membrane", "id": "GO:0032585", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032585", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "ESCRT-0 complex", "id": "GO:0033565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033565", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "phagocytic vesicle lumen", "id": "GO:0097013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097013", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 22, "go_terms": [ { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "membrane invagination", "id": "GO:0010324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010324", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "multivesicular body assembly", "id": "GO:0036258", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036258", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway", "id": "GO:0043328", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043328", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "receptor internalization", "id": "GO:0031623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031623", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "macroautophagy", "id": "GO:0016236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016236", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "endosomal transport", "id": "GO:0016197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016197", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "negative regulation of platelet-derived growth factor receptor signaling pathway", "id": "GO:0010642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010642", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "protein localization to membrane", "id": "GO:0072657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072657", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "protein targeting to lysosome", "id": "GO:0006622", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006622", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "endocytic recycling", "id": "GO:0032456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032456", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "negative regulation of receptor signaling pathway via JAK-STAT", "id": "GO:0046426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046426", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "positive regulation of exosomal secretion", "id": "GO:1903543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903543", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "negative regulation of vascular endothelial growth factor receptor signaling pathway", "id": "GO:0030948", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030948", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "regulation of protein catabolic process", "id": "GO:0042176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042176", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "regulation of MAP kinase activity", "id": "GO:0043405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043405", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "membrane fission", "id": "GO:0090148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090148", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "phosphatidylinositol binding", "id": "GO:0035091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "ubiquitin-like protein ligase binding", "id": "GO:0044389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044389", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" }, { "name": "kinase activity", "id": "GO:0016301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016301", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 313, "end_pos": 315, "annotation": "n_glycosylation_sequon" }, { "start_pos": 435, "end_pos": 437, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated (PubMed:25588945). Ubiquitinated by ITCH (PubMed:14602072, PubMed:24790097).", "evidence": [ { "database": "UniProtKB", "id": "O14964", "url": "https://www.uniprot.org/uniprot/O14964" }, { "database": "PubMed", "id": "25588945", "url": "https://glygen.org/publication/PubMed/25588945" }, { "database": "PubMed", "id": "24790097", "url": "https://glygen.org/publication/PubMed/24790097" }, { "database": "PubMed", "id": "14602072", "url": "https://glygen.org/publication/PubMed/14602072" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 297, 299, 300, 305, 306, 309, 310, 315 ], "snv_sites": [ 5, 56, 123, 297, 299, 300, 305, 306, 309, 315, 423, 449, 655, 675, 699, 715, 722 ], "glycation_sites": [], "phosphorylation_sites": [ 132, 198, 216, 240, 308, 310, 329, 334, 345, 567, 594, 625 ], "sequon_annotation_sites": [ { "start_pos": 313, "end_pos": 315 }, { "start_pos": 435, "end_pos": 437 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 404 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }