{
"uniprot_canonical_ac": "O14933-1",
"uniprot_ac": "O14933",
"uniprot_id": "UB2L6_HUMAN",
"mass": {
"chemical_mass": 17769.0,
"monoisotopic_mass": 17769.0
},
"refseq": {
"ac": "NP_004214",
"name": "ubiquitin/ISG15-conjugating enzyme E2 L6 isoform 1",
"summary": "The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
},
"gene_names": [
{
"name": "UBE2L6",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/O14933",
"id": "O14933"
},
{
"name": "RIG-B; UBCH8",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214",
"id": "NP_004214"
},
{
"name": "UBCH8",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/O14933",
"id": "O14933"
},
{
"name": "UBE2L6",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214",
"id": "NP_004214"
}
],
"protein_names": [
{
"name": "Ubiquitin/ISG15-conjugating enzyme E2 L6",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "O14933"
},
{
"name": "2.3.2.23",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "E2 ubiquitin-conjugating enzyme L6",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "RIG-B",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "Retinoic acid-induced gene B protein",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "UbcH8",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "Ubiquitin carrier protein L6",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "Ubiquitin-protein ligase L6",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14933"
},
{
"name": "retinoic acid induced gene B protein; ubiquitin/ISG15-conjugating enzyme E2 L6; ubiquitin conjugating enzyme E2L 6; ubiquitin-protein ligase L6; ubiquitin carrier protein L6; E2 ubiquitin-conjugating enzyme L6",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214",
"id": "NP_004214"
},
{
"name": "ubiquitin/ISG15-conjugating enzyme E2 L6 isoform 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214",
"id": "NP_004214"
}
],
"function": [
{
"annotation": "An integrative analysis identifying transcriptional features and key genes involved in COVID-19.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
},
{
"database": "PubMed",
"id": "33242255",
"url": "https://glygen.org/publication/PubMed/33242255"
}
]
},
{
"annotation": "Association of UBE2L6 and ABCB6 Expression With Platinum Resistance in Serous Ovarian Carcinoma.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
},
{
"database": "PubMed",
"id": "37500176",
"url": "https://glygen.org/publication/PubMed/37500176"
}
]
},
{
"annotation": "Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933#function"
},
{
"database": "PubMed",
"id": "16428300",
"url": "https://glygen.org/publication/PubMed/16428300"
},
{
"database": "PubMed",
"id": "15131269",
"url": "https://glygen.org/publication/PubMed/15131269"
},
{
"database": "PubMed",
"id": "20508617",
"url": "https://glygen.org/publication/PubMed/20508617"
}
]
},
{
"annotation": "Increased UBE2L6 regulated by type 1 interferon as potential marker in TB.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
},
{
"database": "PubMed",
"id": "34773365",
"url": "https://glygen.org/publication/PubMed/34773365"
}
]
},
{
"annotation": "The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
}
]
},
{
"annotation": "UBE2L6 is Involved in Cisplatin Resistance by Regulating the Transcription of ABCB6.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
},
{
"database": "PubMed",
"id": "32329696",
"url": "https://glygen.org/publication/PubMed/32329696"
}
]
}
],
"disease": [],
"snv": [
{
"evidence": [
{
"id": "O14933",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14933"
}
],
"glycoeffect": [],
"start_pos": 133,
"end_pos": 133,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "P",
"sequence_mut": "L",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "11",
"chr_pos": "57552422",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "P133",
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
},
{
"disease_id": "DOID:4159",
"recommended_name": {
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "skin cancer",
"description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
},
"synonyms": [
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "CA - skin cancer",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "malignant neoplasm of skin",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "melanoma and Non-melanoma skin cancer",
"description": ""
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "90.11",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "88.43",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "95.11",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "88.13",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "95.66",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "93.7",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "90.63",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "92.26",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "90.68",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "93.63",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "94.29",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "92.82",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "93.81",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14933"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "UBE2L6",
"url": "https://www.uniprot.org/uniprot/O14933",
"locus": {
"chromosome": "11",
"start_pos": 57551656,
"end_pos": 57568284,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000156587",
"url": "https://www.ensembl.org/id/ENSG00000156587"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000156587",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000156587",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "O14933",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14933",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "2.3.2.23",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.2.23&UniProtAcc=O14933",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00195",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00195",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "UBE2L6",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UBE2L6",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "9246",
"url": "https://www.ncbi.nlm.nih.gov/gene/9246",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "12490",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12490",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "O14933",
"url": "https://www.ebi.ac.uk/intact/interactors/id:O14933*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000608",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000608",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016135",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016135",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR023313",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR023313",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:9246",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9246",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "603890",
"url": "http://www.omim.org/entry/603890",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_O14933",
"url": "https://www.nextprot.org/entry/NX_O14933",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "PPYNLRA",
"url": "https://omabrowser.org/oma/group/PPYNLRA/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "5486024at2759",
"url": "http://www.orthodb.org/?query=5486024at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24067",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24067:SF347",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067:SF347",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24068",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24068:SF43",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068:SF43",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1WZV",
"url": "https://www.rcsb.org/structure/1WZV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1WZW",
"url": "https://www.rcsb.org/structure/1WZW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2KJH",
"url": "https://www.rcsb.org/structure/2KJH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SE9",
"url": "https://www.rcsb.org/structure/8SE9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SEA",
"url": "https://www.rcsb.org/structure/8SEA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SEB",
"url": "https://www.rcsb.org/structure/8SEB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SV8",
"url": "https://www.rcsb.org/structure/8SV8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00179",
"url": "http://pfam.xfam.org/family/PF00179",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "O14933",
"url": "https://pharos.nih.gov/targets/O14933",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_O14933",
"url": "http://purl.obolibrary.org/obo/PR_O14933",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "E9PKW8",
"url": "https://www.uniprot.org/uniprot/E9PKW8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PKW8-1",
"url": "https://www.uniprot.org/uniprot/E9PKW8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PQT7",
"url": "https://www.uniprot.org/uniprot/E9PQT7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E9PQT7-1",
"url": "https://www.uniprot.org/uniprot/E9PQT7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14933-1",
"url": "https://www.uniprot.org/uniprot/O14933-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14933-2",
"url": "https://www.uniprot.org/uniprot/O14933-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS",
"length": 153,
"header": "sp|O14933-1|UB2L6_HUMAN Isoform 1 of Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens OX=9606 GN=UBE2L6 PE=1 SV=4 CANONICAL=O14933-1"
},
"isoforms": [
{
"isoform_ac": "E9PKW8-1",
"url": "",
"sequence": {
"sequence": "MIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQ",
"length": 65,
"header": "tr|E9PKW8-1|E9PKW8_HUMAN Computationally mapped isoform of Ubiquitin conjugating enzyme E2 L6 OS=Homo sapiens OX=9606 GN=UBE2L6 PE=1 SV=1 CANONICAL=O14933-1"
},
"locus": {
"chromosome": "11",
"start_pos": 57554548,
"end_pos": 57552427,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000527022.1",
"url": "https://www.ensembl.org/id/ENST00000527022.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000435265.1",
"url": "https://www.ensembl.org/id/ENSP00000435265.1"
}
]
}
},
{
"isoform_ac": "E9PQT7-1",
"url": "",
"sequence": {
"sequence": "MRRWTWKASWSRWLAFELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREP",
"length": 127,
"header": "tr|E9PQT7-1|UB2L6_HUMAN Computationally mapped isoform of Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens OX=9606 GN=UBE2L6 PE=1 SV=1 CANONICAL=O14933-1"
},
"locus": {
"chromosome": "11",
"start_pos": 57567057,
"end_pos": 57552460,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000526659.1",
"url": "https://www.ensembl.org/id/ENST00000526659.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000434348.1",
"url": "https://www.ensembl.org/id/ENSP00000434348.1"
}
]
}
},
{
"isoform_ac": "O14933-1",
"url": "",
"sequence": {
"sequence": "MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS",
"length": 153,
"header": "sp|O14933-1|UB2L6_HUMAN Isoform 1 of Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens OX=9606 GN=UBE2L6 PE=1 SV=4 CANONICAL=O14933-1"
},
"locus": {
"chromosome": "11",
"start_pos": 57567611,
"end_pos": 57552361,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000287156.9",
"url": "https://www.ensembl.org/id/ENST00000287156.9"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000287156.4",
"url": "https://www.ensembl.org/id/ENSP00000287156.4"
}
]
}
},
{
"isoform_ac": "O14933-2",
"url": "",
"sequence": {
"sequence": "MIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS",
"length": 87,
"header": "sp|O14933-2|UB2L6_HUMAN Isoform 2 of Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Homo sapiens OX=9606 GN=UBE2L6 PE=1 SV=4 CANONICAL=O14933-1"
},
"locus": {
"chromosome": "11",
"start_pos": 57554548,
"end_pos": 57552361,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000340573.8",
"url": "https://www.ensembl.org/id/ENST00000340573.8"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000341980.4",
"url": "https://www.ensembl.org/id/ENSP00000341980.4"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Double-stranded-RNA-activated protein kinase PKR enhances transcriptional activation by tumor suppressor p53.",
"journal": "Molecular and cellular biology",
"date": "1999-04",
"authors": "Cuddihy A R, Li S, Tam N W, Wong A H, Taya Y, Abraham N, Bell J C, Koromilas A E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10082513",
"url": "https://glygen.org/publication/PubMed/10082513"
}
]
},
{
"title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "10097139",
"url": "https://glygen.org/publication/PubMed/10097139"
}
]
},
{
"title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.",
"journal": "Nature genetics",
"date": "1999",
"authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "10319874",
"url": "https://glygen.org/publication/PubMed/10319874"
}
]
},
{
"title": "The double-stranded RNA activated protein kinase PKR physically associates with the tumor suppressor p53 protein and phosphorylates human p53 on serine 392 in vitro.",
"journal": "Oncogene",
"date": "1999",
"authors": "Cuddihy AR, Wong AH, Tam NW, Li S, Koromilas AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10348343",
"url": "https://glygen.org/publication/PubMed/10348343"
}
]
},
{
"title": "A stop-codon mutation in the BRI gene associated with familial British dementia.",
"journal": "Nature",
"date": "1999",
"authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "10391242",
"url": "https://glygen.org/publication/PubMed/10391242"
}
]
},
{
"title": "DRBP76, a double-stranded RNA-binding nuclear protein, is phosphorylated by the interferon-induced protein kinase, PKR.",
"journal": "The Journal of biological chemistry",
"date": "1999-07-16",
"authors": "Patel R C, Vestal D J, Xu Z, Bandyopadhyay S, Guo W, Erme S M, Williams B R, Sen G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10400669",
"url": "https://glygen.org/publication/PubMed/10400669"
}
]
},
{
"title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "10411933",
"url": "https://glygen.org/publication/PubMed/10411933"
}
]
},
{
"title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.",
"journal": "European journal of biochemistry",
"date": "1999",
"authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "10583407",
"url": "https://glygen.org/publication/PubMed/10583407"
}
]
},
{
"title": "HIV-I TAT inhibits PKR activity by both RNA-dependent and RNA-independent mechanisms.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000-01-15",
"authors": "Cai R, Carpick B, Chun R F, Jeang K T, Williams B R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10620360",
"url": "https://glygen.org/publication/PubMed/10620360"
}
]
},
{
"title": "JNK2 and IKKbeta are required for activating the innate response to viral infection.",
"journal": "Immunity",
"date": "1999-12",
"authors": "Chu W M, Ostertag D, Li Z W, Chang L, Chen Y, Hu Y, Williams B, Perrault J, Karin M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10626894",
"url": "https://glygen.org/publication/PubMed/10626894"
}
]
},
{
"title": "NF-kappaB activation by double-stranded-RNA-activated protein kinase (PKR) is mediated through NF-kappaB-inducing kinase and IkappaB kinase.",
"journal": "Molecular and cellular biology",
"date": "2000-02",
"authors": "Zamanian-Daryoush M, Mogensen T H, DiDonato J A, Williams B R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10648614",
"url": "https://glygen.org/publication/PubMed/10648614"
}
]
},
{
"title": "Low fidelity DNA synthesis by human DNA polymerase-eta.",
"journal": "Nature",
"date": "2000",
"authors": "Matsuda T, Bebenek K, Masutani C, Hanaoka F, Kunkel TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "10801132",
"url": "https://glygen.org/publication/PubMed/10801132"
}
]
},
{
"title": "PKR stimulates NF-kappaB irrespective of its kinase function by interacting with the IkappaB kinase complex.",
"journal": "Molecular and cellular biology",
"date": "2000-07",
"authors": "Bonnet M C, Weil R, Dam E, Hovanessian A G, Meurs E F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10848580",
"url": "https://glygen.org/publication/PubMed/10848580"
}
]
},
{
"title": "Mechanisms of accurate translesion synthesis by human DNA polymerase eta.",
"journal": "The EMBO journal",
"date": "2000",
"authors": "Masutani C, Kusumoto R, Iwai S, Hanaoka F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "10856253",
"url": "https://glygen.org/publication/PubMed/10856253"
}
]
},
{
"title": "The B56alpha regulatory subunit of protein phosphatase 2A is a target for regulation by double-stranded RNA-dependent protein kinase PKR.",
"journal": "Molecular and cellular biology",
"date": "2000",
"authors": "Xu Z, Williams BR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "10866685",
"url": "https://glygen.org/publication/PubMed/10866685"
}
]
},
{
"title": "Genomic organization of the human ubiquitin-conjugating enzyme gene, UBE2L6 on chromosome 11q12.",
"journal": "Cytogenet. Cell Genet.",
"date": "2000",
"authors": "Ardley H C, Rose S A, Tan N, Leek J P, Markham A F, Robinson P A",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "10894956",
"url": "https://glygen.org/publication/PubMed/10894956"
}
]
},
{
"title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "10956649",
"url": "https://glygen.org/publication/PubMed/10956649"
}
]
},
{
"title": "Eukaryotic polymerases iota and zeta act sequentially to bypass DNA lesions.",
"journal": "Nature",
"date": "2000",
"authors": "Johnson RE, Washington MT, Haracska L, Prakash S, Prakash L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "10984059",
"url": "https://glygen.org/publication/PubMed/10984059"
}
]
},
{
"title": "Fidelity and processivity of DNA synthesis by DNA polymerase kappa, the product of the human DINB1 gene.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Ohashi E, Bebenek K, Matsuda T, Feaver WJ, Gerlach VL, Friedberg EC, Ohmori H, Kunkel TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "11006276",
"url": "https://glygen.org/publication/PubMed/11006276"
}
]
},
{
"title": "Two new proteases in the MHC class I processing pathway.",
"journal": "Nature immunology",
"date": "2000",
"authors": "Stoltze L, Schirle M, Schwarz G, Schroter C, Thompson MW, Hersh LB, Kalbacher H, Stevanovic S, Rammensee HG, Schild H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "11062501",
"url": "https://glygen.org/publication/PubMed/11062501"
}
]
},
{
"title": "A PPxY motif within the VP40 protein of Ebola virus interacts physically and functionally with a ubiquitin ligase: implications for filovirus budding.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Harty RN, Brown ME, Wang G, Huibregtse J, Hayes FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "11095724",
"url": "https://glygen.org/publication/PubMed/11095724"
}
]
},
{
"title": "A Role of RNA Helicase A in cis-Acting Transactivation Response Element-mediated Transcriptional Regulation of Human Immunodeficiency Virus Type 1.",
"journal": "The Journal of biological chemistry",
"date": "2001-02-23",
"authors": "Fujii R, Okamoto M, Aratani S, Oishi T, Ohshima T, Taira K, Baba M, Fukamizu A, Nakajima T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11096080",
"url": "https://glygen.org/publication/PubMed/11096080"
}
]
},
{
"title": "Ubiquitination of HIV-1 and MuLV Gag.",
"journal": "Virology",
"date": "2000",
"authors": "Ott DE, Coren LV, Chertova EN, Gagliardi TD, Schubert U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "11112487",
"url": "https://glygen.org/publication/PubMed/11112487"
}
]
},
{
"title": "Functional characterization of and cooperation between the double-stranded RNA-binding motifs of the protein kinase PKR.",
"journal": "The Journal of biological chemistry",
"date": "2001-03-30",
"authors": "Tian B, Mathews M B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11134010",
"url": "https://glygen.org/publication/PubMed/11134010"
}
]
},
{
"title": "Hepatitis C virus envelope protein E2 does not inhibit PKR by simple competition with autophosphorylation sites in the RNA-binding domain.",
"journal": "Journal of virology",
"date": "2001",
"authors": "Taylor DR, Tian B, Romano PR, Hinnebusch AG, Lai MM, Mathews MB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11152499",
"url": "https://glygen.org/publication/PubMed/11152499"
}
]
},
{
"title": "Identification of the interferon-inducible double-stranded RNA-dependent protein kinase as a regulator of cellular response to bulky adducts.",
"journal": "Cancer research",
"date": "2000-12-15",
"authors": "Bergeron J, Benlimame N, Zeng-Rong N, Xiao D, Scrivens P J, Koromilas A E, Alaoui-Jamali M A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11156368",
"url": "https://glygen.org/publication/PubMed/11156368"
}
]
},
{
"title": "Influenza B virus NS1 protein inhibits conjugation of the interferon (IFN)-induced ubiquitin-like ISG15 protein.",
"journal": "The EMBO journal",
"date": "2001",
"authors": "Yuan W, Krug RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "11157743",
"url": "https://glygen.org/publication/PubMed/11157743"
}
]
},
{
"title": "A novel centrosomal ring-finger protein, dorfin, mediates ubiquitin ligase activity.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "2001",
"authors": "Niwa J, Ishigaki S, Doyu M, Suzuki T, Tanaka K, Sobue G",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "11237715",
"url": "https://glygen.org/publication/PubMed/11237715"
}
]
},
{
"title": "Role of double-stranded RNA-dependent protein kinase in mediating hypersensitivity of Fanconi anemia complementation group C cells to interferon gamma, tumor necrosis factor-alpha, and double-stranded RNA.",
"journal": "Blood",
"date": "2001-03-15",
"authors": "Pang Q, Keeble W, Diaz J, Christianson T A, Fagerlie S, Rathbun K, Faulkner G R, O'Dwyer M, Bagby G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11238103",
"url": "https://glygen.org/publication/PubMed/11238103"
}
]
},
{
"title": "Modular structure of PACT: distinct domains for binding and activating PKR.",
"journal": "Molecular and cellular biology",
"date": "2001-03",
"authors": "Peters G A, Hartmann R, Qin J, Sen G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11238927",
"url": "https://glygen.org/publication/PubMed/11238927"
}
]
},
{
"title": "Phosphorylation regulates intracellular trafficking of beta-secretase.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278841",
"url": "https://glygen.org/publication/PubMed/11278841"
}
]
},
{
"title": "Enhanced antiviral and antiproliferative properties of a STAT1 mutant unable to interact with the protein kinase PKR.",
"journal": "The Journal of biological chemistry",
"date": "2001-04-27",
"authors": "Wong A H, Durbin J E, Li S, Dever T E, Decker T, Koromilas A E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278865",
"url": "https://glygen.org/publication/PubMed/11278865"
}
]
},
{
"title": "The catalytic activity of dsRNA-dependent protein kinase, PKR, is required for NF-kappaB activation.",
"journal": "Oncogene",
"date": "2001-01-18",
"authors": "Gil J, Rullas J, Garc\u00eda M A, Alcam\u00ed J, Esteban M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11313968",
"url": "https://glygen.org/publication/PubMed/11313968"
}
]
},
{
"title": "Binding of double-stranded RNA to protein kinase PKR is required for dimerization and promotes critical autophosphorylation events in the activation loop.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Zhang F, Romano PR, Nagamura-Inoue T, Tian B, Dever TE, Mathews MB, Ozato K, Hinnebusch AG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11337501",
"url": "https://glygen.org/publication/PubMed/11337501"
}
]
},
{
"title": "26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide.",
"journal": "The EMBO journal",
"date": "2001",
"authors": "Cascio P, Hilton C, Kisselev AF, Rock KL, Goldberg AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "11350924",
"url": "https://glygen.org/publication/PubMed/11350924"
}
]
},
{
"title": "Protein kinase PKR is required for platelet-derived growth factor signaling of c-fos gene expression via Erks and Stat3.",
"journal": "The EMBO journal",
"date": "2001",
"authors": "Deb A, Zamanian-Daryoush M, Xu Z, Kadereit S, Williams BR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11350938",
"url": "https://glygen.org/publication/PubMed/11350938"
}
]
},
{
"title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.",
"journal": "Genomics",
"date": "2001",
"authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "11401442",
"url": "https://glygen.org/publication/PubMed/11401442"
}
]
},
{
"title": "Nuclear factor 90 is a substrate and regulator of the eukaryotic initiation factor 2 kinase double-stranded RNA-activated protein kinase.",
"journal": "The Journal of biological chemistry",
"date": "2001-08-31",
"authors": "Parker L M, Fierro-Monti I, Mathews M B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11438540",
"url": "https://glygen.org/publication/PubMed/11438540"
}
]
},
{
"title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "11467836",
"url": "https://glygen.org/publication/PubMed/11467836"
}
]
},
{
"title": "FANCC interacts with Hsp70 to protect hematopoietic cells from IFN-gamma/TNF-alpha-mediated cytotoxicity.",
"journal": "The EMBO journal",
"date": "2001-08-15",
"authors": "Pang Q, Keeble W, Christianson T A, Faulkner G R, Bagby G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11500375",
"url": "https://glygen.org/publication/PubMed/11500375"
}
]
},
{
"title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.",
"journal": "Nature medicine",
"date": "2001",
"authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "11590439",
"url": "https://glygen.org/publication/PubMed/11590439"
}
]
},
{
"title": "Recognition of double-stranded RNA and activation of NF-kappaB by Toll-like receptor 3.",
"journal": "Nature",
"date": "2001",
"authors": "Alexopoulou L, Holt AC, Medzhitov R, Flavell RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "11607032",
"url": "https://glygen.org/publication/PubMed/11607032"
}
]
},
{
"title": "Double-stranded RNA-dependent protein kinase, PKR, down-regulates CDC2/cyclin B1 and induces apoptosis in non-transformed but not in v-mos transformed cells.",
"journal": "Oncogene",
"date": "2001-12-06",
"authors": "Dagon Y, Dovrat S, Vilchik S, Hacohen D, Shlomo G, Sredni B, Salzberg S, Nir U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11781817",
"url": "https://glygen.org/publication/PubMed/11781817"
}
]
},
{
"title": "UBP43 (USP18) specifically removes ISG15 from conjugated proteins.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Malakhov MP, Malakhova OA, Kim KI, Ritchie KJ, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "11788588",
"url": "https://glygen.org/publication/PubMed/11788588"
}
]
},
{
"title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.",
"journal": "Clinical and experimental immunology",
"date": "1979",
"authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "118839",
"url": "https://glygen.org/publication/PubMed/118839"
}
]
},
{
"title": "Gene-specific regulation by general translation factors.",
"journal": "Cell",
"date": "2002-02-22",
"authors": "Dever Thomas E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11909525",
"url": "https://glygen.org/publication/PubMed/11909525"
}
]
},
{
"title": "Inactivation of the PKR protein kinase and stimulation of mRNA translation by the cellular co-chaperone P58(IPK) does not require J domain function.",
"journal": "Biochemistry",
"date": "2002-04-16",
"authors": "Yan Wei, Gale Michael J, Tan Seng-Lai, Katze Michael G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11939789",
"url": "https://glygen.org/publication/PubMed/11939789"
}
]
},
{
"title": "The C-terminal, third conserved motif of the protein activator PACT plays an essential role in the activation of double-stranded-RNA-dependent protein kinase (PKR).",
"journal": "The Biochemical journal",
"date": "2002-08-15",
"authors": "Huang Xu, Hutchins Brian, Patel Rekha C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "11985496",
"url": "https://glygen.org/publication/PubMed/11985496"
}
]
},
{
"title": "Contribution of double-stranded RNA-activated protein kinase toward antiproliferative actions of heparin on vascular smooth muscle cells.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2002-09-01",
"authors": "Patel Rekha C, Handy Indhira, Patel Chandrashekhar V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12231563",
"url": "https://glygen.org/publication/PubMed/12231563"
}
]
},
{
"title": "The anti-apoptotic function of Hsp70 in the interferon-inducible double-stranded RNA-dependent protein kinase-mediated death signaling pathway requires the Fanconi anemia protein, FANCC.",
"journal": "The Journal of biological chemistry",
"date": "2002-12-20",
"authors": "Pang Qishen, Christianson Tracy A, Keeble Winifred, Koretsky Tara, Bagby Grover C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12397061",
"url": "https://glygen.org/publication/PubMed/12397061"
}
]
},
{
"title": "Role of human DNA polymerase kappa as an extender in translesion synthesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Haracska L, Prakash L, Prakash S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "12444249",
"url": "https://glygen.org/publication/PubMed/12444249"
}
]
},
{
"title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.",
"journal": "The Journal of comparative neurology",
"date": "2003",
"authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "12454989",
"url": "https://glygen.org/publication/PubMed/12454989"
}
]
},
{
"title": "Overlapping motifs (PTAP and PPEY) within the Ebola virus VP40 protein function independently as late budding domains: involvement of host proteins TSG101 and VPS-4.",
"journal": "Journal of virology",
"date": "2003",
"authors": "Licata JM, Simpson-Holley M, Wright NT, Han Z, Paragas J, Harty RN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "12525615",
"url": "https://glygen.org/publication/PubMed/12525615"
}
]
},
{
"title": "High-throughput immunoblotting. Ubiquitiin-like protein ISG15 modifies key regulators of signal transduction.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Malakhov MP, Kim KI, Malakhova OA, Jacobs BS, Borden EC, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "12582176",
"url": "https://glygen.org/publication/PubMed/12582176"
}
]
},
{
"title": "U-box proteins as a new family of ubiquitin ligases.",
"journal": "Biochemical and biophysical research communications",
"date": "2003",
"authors": "Hatakeyama S, Nakayama KI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "12646216",
"url": "https://glygen.org/publication/PubMed/12646216"
}
]
},
{
"title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1976",
"authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "1270801",
"url": "https://glygen.org/publication/PubMed/1270801"
}
]
},
{
"title": "Nucleophosmin interacts with and inhibits the catalytic function of eukaryotic initiation factor 2 kinase PKR.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Pang Q, Christianson TA, Koretsky T, Carlson H, David L, Keeble W, Faulkner GR, Speckhart A, Bagby GC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "12882984",
"url": "https://glygen.org/publication/PubMed/12882984"
}
]
},
{
"title": "Identification of the double-stranded RNA-binding domain of the human interferon-inducible protein kinase.",
"journal": "The Journal of biological chemistry",
"date": "1992-04-15",
"authors": "Patel R C, Sen G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "1373135",
"url": "https://glygen.org/publication/PubMed/1373135"
}
]
},
{
"title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "14506261",
"url": "https://glygen.org/publication/PubMed/14506261"
}
]
},
{
"title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.",
"journal": "Biochemistry",
"date": "2003",
"authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "14567678",
"url": "https://glygen.org/publication/PubMed/14567678"
}
]
},
{
"title": "The carboxy-terminal, M3 motifs of PACT and TRBP have opposite effects on PKR activity.",
"journal": "Virology",
"date": "2003-10-25",
"authors": "Gupta Vishal, Huang Xu, Patel Rekha C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "14585331",
"url": "https://glygen.org/publication/PubMed/14585331"
}
]
},
{
"title": "Proteasome and peptidase function in MHC-class-I-mediated antigen presentation.",
"journal": "Current opinion in immunology",
"date": "2004",
"authors": "Kloetzel PM, Ossendorp F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "14734113",
"url": "https://glygen.org/publication/PubMed/14734113"
}
]
},
{
"title": "Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA.",
"journal": "Science (New York, N.Y.)",
"date": "2004",
"authors": "Diebold SS, Kaisho T, Hemmi H, Akira S, Reis e Sousa C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "14976261",
"url": "https://glygen.org/publication/PubMed/14976261"
}
]
},
{
"title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "15064394",
"url": "https://glygen.org/publication/PubMed/15064394"
}
]
},
{
"title": "The UbcH8 ubiquitin E2 enzyme is also the E2 enzyme for ISG15, an IFN-alpha/beta-induced ubiquitin-like protein.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Zhao C, Beaudenon SL, Kelley ML, Waddell MB, Yuan W, Schulman BA, Huibregtse JM, Krug RM",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
},
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "15131269",
"url": "https://glygen.org/publication/PubMed/15131269"
}
]
},
{
"title": "Efficient and error-free replication past a minor-groove DNA adduct by the sequential action of human DNA polymerases iota and kappa.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Washington MT, Minko IG, Johnson RE, Wolfle WT, Harris TM, Lloyd RS, Prakash S, Prakash L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "15199127",
"url": "https://glygen.org/publication/PubMed/15199127"
}
]
},
{
"title": "The RNA helicase RIG-I has an essential function in double-stranded RNA-induced innate antiviral responses.",
"journal": "Nature immunology",
"date": "2004",
"authors": "Yoneyama M, Kikuchi M, Natsukawa T, Shinobu N, Imaizumi T, Miyagishi M, Taira K, Akira S, Fujita T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "15208624",
"url": "https://glygen.org/publication/PubMed/15208624"
}
]
},
{
"title": "Generation of major histocompatibility complex class I antigens: functional interplay between proteasomes and TPPII.",
"journal": "Nature immunology",
"date": "2004",
"authors": "Kloetzel PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "15224091",
"url": "https://glygen.org/publication/PubMed/15224091"
}
]
},
{
"title": "Post-proteasomal antigen processing for major histocompatibility complex class I presentation.",
"journal": "Nature immunology",
"date": "2004",
"authors": "Rock KL, York IA, Goldberg AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "15224092",
"url": "https://glygen.org/publication/PubMed/15224092"
}
]
},
{
"title": "Protein kinase R (PKR) interacts with and activates mitogen-activated protein kinase kinase 6 (MKK6) in response to double-stranded RNA stimulation.",
"journal": "The Journal of biological chemistry",
"date": "2004-09-03",
"authors": "Silva Arist\u00f3bolo M, Whitmore Mark, Xu Zan, Jiang Zhengfan, Li Xiaoxia, Williams Bryan R G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15229216",
"url": "https://glygen.org/publication/PubMed/15229216"
}
]
},
{
"title": "The Fanconi anemia proteins functionally interact with the protein kinase regulated by RNA (PKR).",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Zhang X, Li J, Sejas DP, Rathbun KR, Bagby GC, Pang Q",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15299030",
"url": "https://glygen.org/publication/PubMed/15299030"
}
]
},
{
"title": "Interferon-inducible ubiquitin E2, Ubc8, is a conjugating enzyme for protein ISGylation.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Kim KI, Giannakopoulos NV, Virgin HW, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485925",
"url": "https://glygen.org/publication/PubMed/15485925"
}
]
},
{
"title": "The proteasome and MHC class I antigen processing.",
"journal": "Biochimica et biophysica acta",
"date": "2004",
"authors": "Kloetzel PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "15571818",
"url": "https://glygen.org/publication/PubMed/15571818"
}
]
},
{
"title": "An unconventional NLS is critical for the nuclear import of the influenza A virus nucleoprotein and ribonucleoprotein.",
"journal": "Traffic (Copenhagen, Denmark)",
"date": "2005",
"authors": "Cros JF, Garcia-Sastre A, Palese P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "15702989",
"url": "https://glygen.org/publication/PubMed/15702989"
}
]
},
{
"title": "Phosphorylation of HIV Tat by PKR increases interaction with TAR RNA and enhances transcription.",
"journal": "Virology journal",
"date": "2005-02-28",
"authors": "Endo-Munoz Liliana, Warby Tammra, Harrich David, McMillan Nigel A J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15737233",
"url": "https://glygen.org/publication/PubMed/15737233"
}
]
},
{
"title": "Identification of the heparin-binding domains of the interferon-induced protein kinase, PKR.",
"journal": "The FEBS journal",
"date": "2005-03",
"authors": "Fasciano Stephen, Hutchins Brian, Handy Indhira, Patel Rekha C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15752359",
"url": "https://glygen.org/publication/PubMed/15752359"
}
]
},
{
"title": "Mechanisms for HIV Tat upregulation of IL-10 and other cytokine expression: kinase signaling and PKR-mediated immune response.",
"journal": "FEBS letters",
"date": "2005-06-06",
"authors": "Li James C B, Lee Davy C W, Cheung Benny K W, Lau Allan S Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "15907845",
"url": "https://glygen.org/publication/PubMed/15907845"
}
]
},
{
"title": "Senile seminal vesicle amyloid is derived from semenogelin I.",
"journal": "The Journal of laboratory and clinical medicine",
"date": "2005",
"authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "15962837",
"url": "https://glygen.org/publication/PubMed/15962837"
}
]
},
{
"title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16009940",
"url": "https://glygen.org/publication/PubMed/16009940"
}
]
},
{
"title": "ISG15 modification of Ubc13 suppresses its ubiquitin-conjugating activity.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Takeuchi T, Yokosawa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16112642",
"url": "https://glygen.org/publication/PubMed/16112642"
}
]
},
{
"title": "ISG15 modification of ubiquitin E2 Ubc13 disrupts its ability to form thioester bond with ubiquitin.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Zou W, Papov V, Malakhova O, Kim KI, Dao C, Li J, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16122702",
"url": "https://glygen.org/publication/PubMed/16122702"
}
]
},
{
"title": "Identification and characterization of MAVS, a mitochondrial antiviral signaling protein that activates NF-kappaB and IRF 3.",
"journal": "Cell",
"date": "2005",
"authors": "Seth RB, Sun L, Ea CK, Chen ZJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "16125763",
"url": "https://glygen.org/publication/PubMed/16125763"
}
]
},
{
"title": "IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.",
"journal": "Nature immunology",
"date": "2005",
"authors": "Kawai T, Takahashi K, Sato S, Coban C, Kumar H, Kato H, Ishii KJ, Takeuchi O, Akira S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "16127453",
"url": "https://glygen.org/publication/PubMed/16127453"
}
]
},
{
"title": "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Giannakopoulos NV, Luo JK, Papov V, Zou W, Lenschow DJ, Jacobs BS, Borden EC, Li J, Virgin HW, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16139798",
"url": "https://glygen.org/publication/PubMed/16139798"
}
]
},
{
"title": "VISA is an adapter protein required for virus-triggered IFN-beta signaling.",
"journal": "Molecular cell",
"date": "2005",
"authors": "Xu LG, Wang YY, Han KJ, Li LY, Zhai Z, Shu HB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "16153868",
"url": "https://glygen.org/publication/PubMed/16153868"
}
]
},
{
"title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "16174740",
"url": "https://glygen.org/publication/PubMed/16174740"
}
]
},
{
"title": "Higher-order substrate recognition of eIF2alpha by the RNA-dependent protein kinase PKR.",
"journal": "Cell",
"date": "2005",
"authors": "Dar AC, Dever TE, Sicheri F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16179258",
"url": "https://glygen.org/publication/PubMed/16179258"
}
]
},
{
"title": "Mechanistic link between PKR dimerization, autophosphorylation, and eIF2alpha substrate recognition.",
"journal": "Cell",
"date": "2005",
"authors": "Dey M, Cao C, Dar AC, Tamura T, Ozato K, Sicheri F, Dever TE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16179259",
"url": "https://glygen.org/publication/PubMed/16179259"
}
]
},
{
"title": "The interferon-inducible ubiquitin-protein isopeptide ligase (E3) EFP also functions as an ISG15 E3 ligase.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Zou W, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16352599",
"url": "https://glygen.org/publication/PubMed/16352599"
}
]
},
{
"title": "Tyrosine phosphorylation acts as a molecular switch to full-scale activation of the eIF2alpha RNA-dependent protein kinase.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Su Q, Wang S, Baltzis D, Qu LK, Wong AH, Koromilas AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16373505",
"url": "https://glygen.org/publication/PubMed/16373505"
}
]
},
{
"title": "Hsp90 regulates activation of interferon regulatory factor 3 and TBK-1 stabilization in Sendai virus-infected cells.",
"journal": "Molecular biology of the cell",
"date": "2006",
"authors": "Yang K, Shi H, Qi R, Sun S, Tang Y, Zhang B, Wang C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "16394098",
"url": "https://glygen.org/publication/PubMed/16394098"
}
]
},
{
"title": "Herc5, an interferon-induced HECT E3 enzyme, is required for conjugation of ISG15 in human cells.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Dastur A, Beaudenon S, Kelley M, Krug RM, Huibregtse JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16407192",
"url": "https://glygen.org/publication/PubMed/16407192"
}
]
},
{
"title": "The p53-inducible E3 ubiquitin ligase p53RFP induces p53-dependent apoptosis.",
"journal": "FEBS Lett.",
"date": "2006",
"authors": "Huang Jun, Xu Liang-Guo, Liu Ting, Zhai Zhonghe, Shu Hong-Bing",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "16427630",
"url": "https://glygen.org/publication/PubMed/16427630"
}
]
},
{
"title": "Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme.",
"journal": "Journal of biochemistry",
"date": "2005",
"authors": "Takeuchi T, Iwahara S, Saeki Y, Sasajima H, Yokosawa H",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
},
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16428300",
"url": "https://glygen.org/publication/PubMed/16428300"
}
]
},
{
"title": "The catalytic activity of the eukaryotic initiation factor-2alpha kinase PKR is required to negatively regulate Stat1 and Stat3 via activation of the T-cell protein-tyrosine phosphatase.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Wang S, Raven JF, Baltzis D, Kazemi S, Brunet DV, Hatzoglou M, Tremblay ML, Koromilas AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16431927",
"url": "https://glygen.org/publication/PubMed/16431927"
}
]
},
{
"title": "Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Tokgoz Z, Bohnsack RN, Haas AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "16595681",
"url": "https://glygen.org/publication/PubMed/16595681"
}
]
},
{
"title": "The N-terminus of PKR is responsible for the activation of the NF-kappaB signaling pathway by interacting with the IKK complex.",
"journal": "Cellular signalling",
"date": "2006-11",
"authors": "Bonnet Marion C, Daurat Caroline, Ottone Catherine, Meurs Eliane F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16600570",
"url": "https://glygen.org/publication/PubMed/16600570"
}
]
},
{
"title": "Negative regulation of interferon-regulatory factor 3-dependent innate antiviral response by the prolyl isomerase Pin1.",
"journal": "Nature immunology",
"date": "2006",
"authors": "Saitoh T, Tun-Kyi A, Ryo A, Yamamoto M, Finn G, Fujita T, Akira S, Yamamoto N, Lu KP, Yamaoka S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "16699525",
"url": "https://glygen.org/publication/PubMed/16699525"
}
]
},
{
"title": "NK lytic-associated molecule, involved in NK cytotoxic function, is an E3 ligase.",
"journal": "J. Immunol.",
"date": "2006",
"authors": "Fortier JM, Kornbluth J",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "16709802",
"url": "https://glygen.org/publication/PubMed/16709802"
}
]
},
{
"title": "Pin-ning down immune responses to RNA viruses.",
"journal": "Nature immunology",
"date": "2006",
"authors": "Goutagny N, Severa M, Fitzgerald KA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "16715065",
"url": "https://glygen.org/publication/PubMed/16715065"
}
]
},
{
"title": "Double-stranded RNA-dependent protein kinase phosphorylation of the alpha-subunit of eukaryotic translation initiation factor 2 mediates apoptosis.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Scheuner D, Patel R, Wang F, Lee K, Kumar K, Wu J, Nilsson A, Karin M, Kaufman RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16717090",
"url": "https://glygen.org/publication/PubMed/16717090"
}
]
},
{
"title": "Cumulative mutations of ubiquitin acceptor sites in human immunodeficiency virus type 1 gag cause a late budding defect.",
"journal": "Journal of virology",
"date": "2006",
"authors": "Gottwein E, Jager S, Habermann A, Krausslich HG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16775314",
"url": "https://glygen.org/publication/PubMed/16775314"
}
]
},
{
"title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).",
"journal": "Nature structural & molecular biology",
"date": "2006",
"authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "16799559",
"url": "https://glygen.org/publication/PubMed/16799559"
}
]
},
{
"title": "HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Wong JJ, Pung YF, Sze NS, Chin KC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16815975",
"url": "https://glygen.org/publication/PubMed/16815975"
}
]
},
{
"title": "Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2006",
"authors": "York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "16849449",
"url": "https://glygen.org/publication/PubMed/16849449"
}
]
},
{
"title": "Negative regulation of protein phosphatase 2Cbeta by ISG15 conjugation.",
"journal": "FEBS letters",
"date": "2006",
"authors": "Takeuchi T, Kobayashi T, Tamura S, Yokosawa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16872604",
"url": "https://glygen.org/publication/PubMed/16872604"
}
]
},
{
"title": "ISG15 enhances the innate antiviral response by inhibition of IRF-3 degradation.",
"journal": "Cellular and molecular biology (Noisy-le-Grand, France)",
"date": "2006",
"authors": "Lu G, Reinert JT, Pitha-Rowe I, Okumura A, Kellum M, Knobeloch KP, Hassel B, Pitha PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "16914094",
"url": "https://glygen.org/publication/PubMed/16914094"
}
]
},
{
"title": "A novel family of membrane-bound E3 ubiquitin ligases.",
"journal": "Journal of biochemistry",
"date": "2006",
"authors": "Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "16954532",
"url": "https://glygen.org/publication/PubMed/16954532"
}
]
},
{
"title": "Molecular cloning and characterization of the human double-stranded RNA-activated protein kinase induced by interferon.",
"journal": "Cell",
"date": "1990-07-27",
"authors": "Meurs E, Chong K, Galabru J, Thomas N S, Kerr I M, Williams B R, Hovanessian A G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "1695551",
"url": "https://glygen.org/publication/PubMed/1695551"
}
]
},
{
"title": "Phosphorylation of specific serine residues in the PKR activation domain of PACT is essential for its ability to mediate apoptosis.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Peters GA, Li S, Sen GC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "16982605",
"url": "https://glygen.org/publication/PubMed/16982605"
}
]
},
{
"title": "Human DNA polymerase kappa forms nonproductive complexes with matched primer termini but not with mismatched primer termini.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Carlson KD, Johnson RE, Prakash L, Prakash S, Washington MT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "17043239",
"url": "https://glygen.org/publication/PubMed/17043239"
}
]
},
{
"title": "Double-stranded RNA deaminase ADAR1 increases host susceptibility to virus infection.",
"journal": "Journal of virology",
"date": "2007-01",
"authors": "Nie Yongzhan, Hammond Graeme L, Yang Jing-Hua",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "17079286",
"url": "https://glygen.org/publication/PubMed/17079286"
}
]
},
{
"title": "Activation of PKR: an open and shut case?",
"journal": "Trends in biochemical sciences",
"date": "2007-02",
"authors": "Cole James L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "17196820",
"url": "https://glygen.org/publication/PubMed/17196820"
}
]
},
{
"title": "ISG15 modification of the eIF4E cognate 4EHP enhances cap structure-binding activity of 4EHP.",
"journal": "Genes & development",
"date": "2007",
"authors": "Okumura F, Zou W, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "17289916",
"url": "https://glygen.org/publication/PubMed/17289916"
}
]
},
{
"title": "Nuclear and nucleolar targeting of influenza A virus NS1 protein: striking differences between different virus subtypes.",
"journal": "Journal of virology",
"date": "2007",
"authors": "Melen K, Kinnunen L, Fagerlund R, Ikonen N, Twu KY, Krug RM, Julkunen I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "17376915",
"url": "https://glygen.org/publication/PubMed/17376915"
}
]
},
{
"title": "TRIM25 RING-finger E3 ubiquitin ligase is essential for RIG-I-mediated antiviral activity.",
"journal": "Nature",
"date": "2007",
"authors": "Gack MU, Shin YC, Joo CH, Urano T, Liang C, Sun L, Takeuchi O, Akira S, Chen Z, Inoue S, Jung JU",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "17392790",
"url": "https://glygen.org/publication/PubMed/17392790"
}
]
},
{
"title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.",
"journal": "The Biochemical journal",
"date": "2007",
"authors": "Costantini C, Ko MH, Jonas MC, Puglielli L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "17425515",
"url": "https://glygen.org/publication/PubMed/17425515"
}
]
},
{
"title": "Negative regulation of MDA5- but not RIG-I-mediated innate antiviral signaling by the dihydroxyacetone kinase.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2007",
"authors": "Diao F, Li S, Tian Y, Zhang M, Xu LG, Zhang Y, Wang RP, Chen D, Zhai Z, Zhong B, Tien P, Shu HB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "17600090",
"url": "https://glygen.org/publication/PubMed/17600090"
}
]
},
{
"title": "DUBA: a deubiquitinase that regulates type I interferon production.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Kayagaki N, Phung Q, Chan S, Chaudhari R, Quan C, O'Rourke KM, Eby M, Pietras E, Cheng G, Bazan JF, Zhang Z, Arnott D, Dixit VM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "17991829",
"url": "https://glygen.org/publication/PubMed/17991829"
}
]
},
{
"title": "Negative feedback regulation of RIG-I-mediated antiviral signaling by interferon-induced ISG15 conjugation.",
"journal": "Journal of virology",
"date": "2008",
"authors": "Kim MJ, Hwang SY, Imaizumi T, Yoo JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "18057259",
"url": "https://glygen.org/publication/PubMed/18057259"
}
]
},
{
"title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.",
"journal": "Human molecular genetics",
"date": "2008",
"authors": "Lee JT, Wheeler TC, Li L, Chin LS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "18065497",
"url": "https://glygen.org/publication/PubMed/18065497"
}
]
},
{
"title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "18070888",
"url": "https://glygen.org/publication/PubMed/18070888"
}
]
},
{
"title": "Interaction of human tRNA-dihydrouridine synthase-2 with interferon-induced protein kinase PKR.",
"journal": "Nucleic acids research",
"date": "2008",
"authors": "Mittelstadt M, Frump A, Khuu T, Fowlkes V, Handy I, Patel CV, Patel RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "18096616",
"url": "https://glygen.org/publication/PubMed/18096616"
}
]
},
{
"title": "NLRX1 is a regulator of mitochondrial antiviral immunity.",
"journal": "Nature",
"date": "2008",
"authors": "Moore CB, Bergstralh DT, Duncan JA, Lei Y, Morrison TE, Zimmermann AG, Accavitti-Loper MA, Madden VJ, Sun L, Ye Z, Lich JD, Heise MT, Chen Z, Ting JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "18200010",
"url": "https://glygen.org/publication/PubMed/18200010"
}
]
},
{
"title": "ISG15 inhibits Nedd4 ubiquitin E3 activity and enhances the innate antiviral response.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Malakhova OA, Zhang DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "18287095",
"url": "https://glygen.org/publication/PubMed/18287095"
}
]
},
{
"title": "ISG15 inhibits Ebola VP40 VLP budding in an L-domain-dependent manner by blocking Nedd4 ligase activity.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Okumura A, Pitha PM, Harty RN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "18305167",
"url": "https://glygen.org/publication/PubMed/18305167"
}
]
},
{
"title": "Crystal structure of human IPS-1/MAVS/VISA/Cardif caspase activation recruitment domain.",
"journal": "BMC structural biology",
"date": "2008",
"authors": "Potter JA, Randall RE, Taylor GL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "18307765",
"url": "https://glygen.org/publication/PubMed/18307765"
}
]
},
{
"title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.",
"journal": "The Journal of pathology",
"date": "1991",
"authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "1837051",
"url": "https://glygen.org/publication/PubMed/1837051"
}
]
},
{
"title": "Structural basis of toll-like receptor 3 signaling with double-stranded RNA.",
"journal": "Science (New York, N.Y.)",
"date": "2008",
"authors": "Liu L, Botos I, Wang Y, Leonard JN, Shiloach J, Segal DM, Davies DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "18420935",
"url": "https://glygen.org/publication/PubMed/18420935"
}
]
},
{
"title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.",
"journal": "Kidney international",
"date": "2008",
"authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "18449172",
"url": "https://glygen.org/publication/PubMed/18449172"
}
]
},
{
"title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.",
"journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis",
"date": "2008",
"authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "18484335",
"url": "https://glygen.org/publication/PubMed/18484335"
}
]
},
{
"title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.",
"journal": "The Journal of clinical investigation",
"date": "1991",
"authors": "Maury CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "1849145",
"url": "https://glygen.org/publication/PubMed/1849145"
}
]
},
{
"title": "The basis for selective E1-E2 interactions in the ISG15 conjugation system.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Durfee LA, Kelley ML, Huibregtse JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "18583345",
"url": "https://glygen.org/publication/PubMed/18583345"
}
]
},
{
"title": "Length-dependent recognition of double-stranded ribonucleic acids by retinoic acid-inducible gene-I and melanoma differentiation-associated gene 5.",
"journal": "The Journal of experimental medicine",
"date": "2008",
"authors": "Kato H, Takeuchi O, Mikamo-Satoh E, Hirai R, Kawai T, Matsushita K, Hiiragi A, Dermody TS, Fujita T, Akira S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "18591409",
"url": "https://glygen.org/publication/PubMed/18591409"
}
]
},
{
"title": "Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.",
"journal": "Cell",
"date": "2008",
"authors": "Lee I, Schindelin H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "18662542",
"url": "https://glygen.org/publication/PubMed/18662542"
}
]
},
{
"title": "Nck-1 interacts with PKR and modulates its activation by dsRNA.",
"journal": "Biochemical and biophysical research communications",
"date": "2008",
"authors": "Cardin E, Larose L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "18835251",
"url": "https://glygen.org/publication/PubMed/18835251"
}
]
},
{
"title": "PKR regulates B56(alpha)-mediated BCL2 phosphatase activity in acute lymphoblastic leukemia-derived REH cells.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Ruvolo VR, Kurinna SM, Karanjeet KB, Schuster TF, Martelli AM, McCubrey JA, Ruvolo PP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "18957415",
"url": "https://glygen.org/publication/PubMed/18957415"
}
]
},
{
"title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Ko MH, Puglielli L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "19011241",
"url": "https://glygen.org/publication/PubMed/19011241"
}
]
},
{
"title": "Riplet/RNF135, a RING finger protein, ubiquitinates RIG-I to promote interferon-beta induction during the early phase of viral infection.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Oshiumi H, Matsumoto M, Hatakeyama S, Seya T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "19017631",
"url": "https://glygen.org/publication/PubMed/19017631"
}
]
},
{
"title": "Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.",
"journal": "The international journal of biochemistry & cell biology",
"date": "2009",
"authors": "Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19028597",
"url": "https://glygen.org/publication/PubMed/19028597"
}
]
},
{
"title": "ISG15 Arg151 and the ISG15-conjugating enzyme UbE1L are important for innate immune control of Sindbis virus.",
"journal": "Journal of virology",
"date": "2009",
"authors": "Giannakopoulos NV, Arutyunova E, Lai C, Lenschow DJ, Haas AL, Virgin HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "19073728",
"url": "https://glygen.org/publication/PubMed/19073728"
}
]
},
{
"title": "Inhibition of IRF3-dependent antiviral responses by cellular and viral proteins.",
"journal": "Cell research",
"date": "2009",
"authors": "Tsuchida T, Kawai T, Akira S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "19125153",
"url": "https://glygen.org/publication/PubMed/19125153"
}
]
},
{
"title": "Two-polymerase mechanisms dictate error-free and error-prone translesion DNA synthesis in mammals.",
"journal": "The EMBO journal",
"date": "2009",
"authors": "Shachar S, Ziv O, Avkin S, Adar S, Wittschieben J, Reissner T, Chaney S, Friedberg EC, Wang Z, Carell T, Geacintov N, Livneh Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "19153606",
"url": "https://glygen.org/publication/PubMed/19153606"
}
]
},
{
"title": "An antiviral response directed by PKR phosphorylation of the RNA helicase A.",
"journal": "PLoS pathogens",
"date": "2009",
"authors": "Sadler AJ, Latchoumanin O, Hawkes D, Mak J, Williams BR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19229320",
"url": "https://glygen.org/publication/PubMed/19229320"
}
]
},
{
"title": "ISG15 modification of filamin B negatively regulates the type I interferon-induced JNK signalling pathway.",
"journal": "EMBO reports",
"date": "2009",
"authors": "Jeon YJ, Choi JS, Lee JY, Yu KR, Kim SM, Ka SH, Oh KH, Kim KI, Zhang DE, Bang OS, Chung CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "19270716",
"url": "https://glygen.org/publication/PubMed/19270716"
}
]
},
{
"title": "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2009",
"authors": "Schulman BA, Harper JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19352404",
"url": "https://glygen.org/publication/PubMed/19352404"
}
]
},
{
"title": "PKR, a p53 target gene, plays a crucial role in the tumor-suppressor function of p53.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2009-05-12",
"authors": "Yoon Cheol-Hee, Lee Eun-Soo, Lim Dae-Seog, Bae Yong-Soo",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19416861",
"url": "https://glygen.org/publication/PubMed/19416861"
}
]
},
{
"title": "What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?",
"journal": "Journal of molecular evolution",
"date": "2009",
"authors": "Michelle C, Vourc'h P, Mignon L, Andres CR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19452197",
"url": "https://glygen.org/publication/PubMed/19452197"
}
]
},
{
"title": "REUL is a novel E3 ubiquitin ligase and stimulator of retinoic-acid-inducible gene-I.",
"journal": "PloS one",
"date": "2009",
"authors": "Gao D, Yang YK, Wang RP, Zhou X, Diao FC, Li MD, Zhai ZH, Jiang ZF, Chen DY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "19484123",
"url": "https://glygen.org/publication/PubMed/19484123"
}
]
},
{
"title": "RING domain E3 ubiquitin ligases.",
"journal": "Annual review of biochemistry",
"date": "2009",
"authors": "Deshaies RJ, Joazeiro CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19489725",
"url": "https://glygen.org/publication/PubMed/19489725"
}
]
},
{
"title": "Structural basis of double-stranded RNA recognition by the RIG-I like receptor MDA5.",
"journal": "Archives of biochemistry and biophysics",
"date": "2009",
"authors": "Li X, Lu C, Stewart M, Xu H, Strong RK, Igumenova T, Li P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "19531363",
"url": "https://glygen.org/publication/PubMed/19531363"
}
]
},
{
"title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.",
"journal": "Biochemistry",
"date": "2009",
"authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "19658395",
"url": "https://glygen.org/publication/PubMed/19658395"
}
]
},
{
"title": "RNA-specific adenosine deaminase ADAR1 suppresses measles virus-induced apoptosis and activation of protein kinase PKR.",
"journal": "The Journal of biological chemistry",
"date": "2009-10-23",
"authors": "Toth Ann M, Li Zhiqun, Cattaneo Roberto, Samuel Charles E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19710021",
"url": "https://glygen.org/publication/PubMed/19710021"
}
]
},
{
"title": "Adenosine deaminase ADAR1 increases gene expression at the translational level by decreasing protein kinase PKR-dependent eIF-2alpha phosphorylation.",
"journal": "Journal of molecular biology",
"date": "2009-11-06",
"authors": "Wang Ying, Samuel Charles E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19733181",
"url": "https://glygen.org/publication/PubMed/19733181"
}
]
},
{
"title": "Phosphorylation of the human microRNA-generating complex mediates MAPK/Erk signaling.",
"journal": "Cell",
"date": "2009-10-02",
"authors": "Paroo Zain, Ye Xuecheng, Chen She, Liu Qinghua",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19804757",
"url": "https://glygen.org/publication/PubMed/19804757"
}
]
},
{
"title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.",
"journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience",
"date": "2009",
"authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "19828817",
"url": "https://glygen.org/publication/PubMed/19828817"
}
]
},
{
"title": "PKR is not a universal target of tumor suppressor p53 in response to genotoxic stress.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2009-11-01",
"authors": "Rahman Mashrur, Lem Christopher, Muaddi Hala, Koromilas Antonis E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "19838063",
"url": "https://glygen.org/publication/PubMed/19838063"
}
]
},
{
"title": "Building ubiquitin chains: E2 enzymes at work.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2009",
"authors": "Ye Y, Rape M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19851334",
"url": "https://glygen.org/publication/PubMed/19851334"
}
]
},
{
"title": "Mechanisms of ubiquitin transfer by the anaphase-promoting complex.",
"journal": "Journal of biology",
"date": "2009",
"authors": "Matyskiela ME, Rodrigo-Brenni MC, Morgan DO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19874575",
"url": "https://glygen.org/publication/PubMed/19874575"
}
]
},
{
"title": "PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.",
"journal": "Nature immunology",
"date": "2009",
"authors": "You F, Sun H, Zhou X, Sun W, Liang S, Zhai Z, Jiang Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "19881509",
"url": "https://glygen.org/publication/PubMed/19881509"
}
]
},
{
"title": "The E3 ubiquitin ligase Triad3A negatively regulates the RIG-I/MAVS signaling pathway by targeting TRAF3 for degradation.",
"journal": "PLoS pathogens",
"date": "2009",
"authors": "Nakhaei P, Mesplede T, Solis M, Sun Q, Zhao T, Yang L, Chuang TH, Ware CF, Lin R, Hiscott J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "19893624",
"url": "https://glygen.org/publication/PubMed/19893624"
}
]
},
{
"title": "The structure of the UbcH8-ubiquitin complex shows a unique ubiquitin interaction site.",
"journal": "Biochemistry",
"date": "2009",
"authors": "Serniwka Stephanie A, Shaw Gary S",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "19928833",
"url": "https://glygen.org/publication/PubMed/19928833"
}
]
},
{
"title": "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2010",
"authors": "van Wijk SJ, Timmers HT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19940261",
"url": "https://glygen.org/publication/PubMed/19940261"
}
]
},
{
"title": "ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Zhao C, Hsiang TY, Kuo RL, Krug RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "20133869",
"url": "https://glygen.org/publication/PubMed/20133869"
}
]
},
{
"title": "Species-specific antagonism of host ISGylation by the influenza B virus NS1 protein.",
"journal": "Journal of virology",
"date": "2010",
"authors": "Versteeg GA, Hale BG, van Boheemen S, Wolff T, Lenschow DJ, Garcia-Sastre A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "20219937",
"url": "https://glygen.org/publication/PubMed/20219937"
}
]
},
{
"title": "TAX1BP1 and A20 inhibit antiviral signaling by targeting TBK1-IKKi kinases.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Parvatiyar K, Barber GN, Harhaj EW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "20304918",
"url": "https://glygen.org/publication/PubMed/20304918"
}
]
},
{
"title": "Positive regulation of interferon regulatory factor 3 activation by Herc5 via ISG15 modification.",
"journal": "Molecular and cellular biology",
"date": "2010",
"authors": "Shi HX, Yang K, Liu X, Liu XY, Wei B, Shan YF, Zhu LH, Wang C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "20308324",
"url": "https://glygen.org/publication/PubMed/20308324"
}
]
},
{
"title": "Herc5 attenuates influenza A virus by catalyzing ISGylation of viral NS1 protein.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2010",
"authors": "Tang Y, Zhong G, Zhu L, Liu X, Shan Y, Feng H, Bu Z, Chen H, Wang C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "20385878",
"url": "https://glygen.org/publication/PubMed/20385878"
}
]
},
{
"title": "New Cdc2 Tyr 4 phosphorylation by dsRNA-activated protein kinase triggers Cdc2 polyubiquitination and G2 arrest under genotoxic stresses.",
"journal": "EMBO reports",
"date": "2010",
"authors": "Yoon CH, Miah MA, Kim KP, Bae YS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "20395957",
"url": "https://glygen.org/publication/PubMed/20395957"
}
]
},
{
"title": "Reconstitution of the RIG-I pathway reveals a signaling role of unanchored polyubiquitin chains in innate immunity.",
"journal": "Cell",
"date": "2010",
"authors": "Zeng W, Sun L, Jiang X, Chen X, Hou F, Adhikari A, Xu M, Chen ZJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "20403326",
"url": "https://glygen.org/publication/PubMed/20403326"
}
]
},
{
"title": "Respiratory syncytial virus-mediated NF-kappa B p65 phosphorylation at serine 536 is dependent on RIG-I, TRAF6, and IKK beta.",
"journal": "Journal of virology",
"date": "2010",
"authors": "Yoboua F, Martel A, Duval A, Mukawera E, Grandvaux N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "20410276",
"url": "https://glygen.org/publication/PubMed/20410276"
}
]
},
{
"title": "NLRC5 negatively regulates the NF-kappaB and type I interferon signaling pathways.",
"journal": "Cell",
"date": "2010",
"authors": "Cui J, Zhu L, Xia X, Wang HY, Legras X, Hong J, Ji J, Shen P, Zheng S, Chen ZJ, Wang RF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-936440",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440"
}
],
"reference": [
{
"type": "PubMed",
"id": "20434986",
"url": "https://glygen.org/publication/PubMed/20434986"
}
]
},
{
"title": "Ubiquitin conjugase UBCH8 targets active FMS-like tyrosine kinase 3 for proteasomal degradation.",
"journal": "Leukemia",
"date": "2010",
"authors": "Buchwald M, Pietschmann K, Muller JP, Bohmer FD, Heinzel T, Kramer OH",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "20508617",
"url": "https://glygen.org/publication/PubMed/20508617"
}
]
},
{
"title": "Respiratory syncytial virus limits alpha subunit of eukaryotic translation initiation factor 2 (eIF2alpha) phosphorylation to maintain translation and viral replication.",
"journal": "The Journal of biological chemistry",
"date": "2010-07-30",
"authors": "Groskreutz Dayna J, Babor Ellen C, Monick Martha M, Varga Steven M, Hunninghake Gary W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "20519500",
"url": "https://glygen.org/publication/PubMed/20519500"
}
]
},
{
"title": "Tom70 mediates activation of interferon regulatory factor 3 on mitochondria.",
"journal": "Cell research",
"date": "2010",
"authors": "Liu XY, Wei B, Shi HX, Shan YF, Wang C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "20628368",
"url": "https://glygen.org/publication/PubMed/20628368"
}
]
},
{
"title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.",
"journal": "The EMBO journal",
"date": "2010",
"authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "20676056",
"url": "https://glygen.org/publication/PubMed/20676056"
}
]
},
{
"title": "The double-stranded RNA-dependent protein kinase differentially regulates insulin receptor substrates 1 and 2 in HepG2 cells.",
"journal": "Molecular biology of the cell",
"date": "2010",
"authors": "Yang X, Nath A, Opperman MJ, Chan C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "20685959",
"url": "https://glygen.org/publication/PubMed/20685959"
}
]
},
{
"title": "Heparan sulfate proteoglycans in amyloidosis.",
"journal": "Progress in molecular biology and translational science",
"date": "2010",
"authors": "Zhang X, Li JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "20807650",
"url": "https://glygen.org/publication/PubMed/20807650"
}
]
},
{
"title": "Multiple forms of PKR present in the nuclei of acute leukemia cells represent an active kinase that is responsive to stress.",
"journal": "Leukemia",
"date": "2011",
"authors": "Blalock WL, Bavelloni A, Piazzi M, Tagliavini F, Faenza I, Martelli AM, Follo MY, Cocco L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21072047",
"url": "https://glygen.org/publication/PubMed/21072047"
}
]
},
{
"title": "Phosphorylation of the NFAR proteins by the dsRNA-dependent protein kinase PKR constitutes a novel mechanism of translational regulation and cellular defense.",
"journal": "Genes & development",
"date": "2010",
"authors": "Harashima A, Guettouche T, Barber GN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21123651",
"url": "https://glygen.org/publication/PubMed/21123651"
}
]
},
{
"title": "The role of hRev7, the accessory subunit of hPolzeta, in translesion synthesis past DNA damage induced by benzo[a]pyrene diol epoxide (BPDE).",
"journal": "BMC cell biology",
"date": "2010",
"authors": "Neal JA, Fletcher KL, McCormick JJ, Maher VM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "21143968",
"url": "https://glygen.org/publication/PubMed/21143968"
}
]
},
{
"title": "Immunoglobulin heavy-chain-associated amyloidosis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1990",
"authors": "Eulitz M, Weiss DT, Solomon A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "2118650",
"url": "https://glygen.org/publication/PubMed/2118650"
}
]
},
{
"title": "Multiple levels of PKR inhibition during HIV-1 replication.",
"journal": "Reviews in medical virology",
"date": "2011-01",
"authors": "Clerzius Guerline, G\u00e9linas Jean-Fran\u00e7ois, Gatignol Anne",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21294215",
"url": "https://glygen.org/publication/PubMed/21294215"
}
]
},
{
"title": "Precursor miR-886, a novel noncoding RNA repressed in cancer, associates with PKR and modulates its activity.",
"journal": "RNA (New York, N.Y.)",
"date": "2011-06",
"authors": "Lee Kwanbok, Kunkeaw Nawapol, Jeon Sung Ho, Lee Inhan, Johnson Betty H, Kang Gum-Yong, Bang Joo Young, Park Hyung Soon, Leelayuwat Chanvit, Lee Yong Sun",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21518807",
"url": "https://glygen.org/publication/PubMed/21518807"
}
]
},
{
"title": "Proliferating cell nuclear antigen (PCNA)-associated KIAA0101/PAF15 protein is a cell cycle-regulated anaphase-promoting complex/cyclosome substrate.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2011",
"authors": "Emanuele MJ, Ciccia A, Elia AE, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "21628590",
"url": "https://glygen.org/publication/PubMed/21628590"
}
]
},
{
"title": "Inhibition of RNase L and RNA-dependent protein kinase (PKR) by sunitinib impairs antiviral innate immunity.",
"journal": "The Journal of biological chemistry",
"date": "2011-07-29",
"authors": "Jha Babal Kant, Polyakova Irina, Kessler Patricia, Dong Beihua, Dickerman Benjamin, Sen Ganes C, Silverman Robert H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21636578",
"url": "https://glygen.org/publication/PubMed/21636578"
}
]
},
{
"title": "The cellular TAR RNA binding protein, TRBP, promotes HIV-1 replication primarily by inhibiting the activation of double-stranded RNA-dependent kinase PKR.",
"journal": "Journal of virology",
"date": "2011-12",
"authors": "Sanghvi Viraj R, Steel Laura F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21937648",
"url": "https://glygen.org/publication/PubMed/21937648"
}
]
},
{
"title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1990",
"authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "2195544",
"url": "https://glygen.org/publication/PubMed/2195544"
}
]
},
{
"title": "Heparin activates PKR by inducing dimerization.",
"journal": "Journal of molecular biology",
"date": "2011-11-11",
"authors": "Anderson Eric, Pierre-Louis Willythssa S, Wong C Jason, Lary Jeffrey W, Cole James L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21978664",
"url": "https://glygen.org/publication/PubMed/21978664"
}
]
},
{
"title": "Activation of the Antiviral Kinase PKR and Viral Countermeasures.",
"journal": "Viruses",
"date": "2009-12",
"authors": "Dauber Bianca, Wolff Thorsten",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "21994559",
"url": "https://glygen.org/publication/PubMed/21994559"
}
]
},
{
"title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2011",
"authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "22065755",
"url": "https://glygen.org/publication/PubMed/22065755"
}
]
},
{
"title": "Respiratory syncytial virus glycoprotein G interacts with DC-SIGN and L-SIGN to activate ERK1 and ERK2.",
"journal": "Journal of virology",
"date": "2012-02",
"authors": "Johnson Teresa R, McLellan Jason S, Graham Barney S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "22090124",
"url": "https://glygen.org/publication/PubMed/22090124"
}
]
},
{
"title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.",
"journal": "IUBMB life",
"date": "2012",
"authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "22131221",
"url": "https://glygen.org/publication/PubMed/22131221"
}
]
},
{
"title": "The RAX/PACT-PKR stress response pathway promotes p53 sumoylation and activation, leading to G(1) arrest.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2012",
"authors": "Bennett RL, Pan Y, Christian J, Hui T, May WS Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "22214662",
"url": "https://glygen.org/publication/PubMed/22214662"
}
]
},
{
"title": "Tat-responsive region RNA of human immunodeficiency virus 1 can prevent activation of the double-stranded-RNA-activated protein kinase.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1990-11",
"authors": "Gunnery S, Rice A P, Robertson H D, Mathews M B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "2247437",
"url": "https://glygen.org/publication/PubMed/2247437"
}
]
},
{
"title": "Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Pierotti A, Dong KW, Glucksman MJ, Orlowski M, Roberts JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "2261476",
"url": "https://glygen.org/publication/PubMed/2261476"
}
]
},
{
"title": "Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Wojtaszek J, Liu J, D'Souza S, Wang S, Xue Y, Walker GC, Zhou P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "22700975",
"url": "https://glygen.org/publication/PubMed/22700975"
}
]
},
{
"title": "Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric polymerase (Pol) zeta, and Pol kappa.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Wojtaszek J, Lee CJ, D'Souza S, Minesinger B, Kim H, D'Andrea AD, Walker GC, Zhou P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "22859295",
"url": "https://glygen.org/publication/PubMed/22859295"
}
]
},
{
"title": "Characterization of the direct physical interaction of nc886, a cellular non-coding RNA, and PKR.",
"journal": "FEBS letters",
"date": "2012-09-21",
"authors": "Jeon Sung Ho, Lee Kwanbok, Lee Kwang Soo, Kunkeaw Nawapol, Johnson Betty H, Holthauzen Luis Marcelo F, Gong Bin, Leelayuwat Chanvit, Lee Yong Sun",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "22986343",
"url": "https://glygen.org/publication/PubMed/22986343"
}
]
},
{
"title": "Systems-wide analysis of ubiquitylation dynamics reveals a key role for PAF15 ubiquitylation in DNA-damage bypass.",
"journal": "Nature cell biology",
"date": "2012",
"authors": "Povlsen LK, Beli P, Wagner SA, Poulsen SL, Sylvestersen KB, Poulsen JW, Nielsen ML, Bekker-Jensen S, Mailand N, Choudhary C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "23000965",
"url": "https://glygen.org/publication/PubMed/23000965"
}
]
},
{
"title": "Cytoplasmic STAT3 represses autophagy by inhibiting PKR activity.",
"journal": "Molecular cell",
"date": "2012-12-14",
"authors": "Shen Shensi, Niso-Santano Mireia, Adjemian Sandy, Takehara Tetsuo, Malik Shoaib Ahmad, Minoux Herv\u00e9, Souquere Sylvie, Mari\u00f1o Guillermo, Lachkar Sylvie, Senovilla Laura, Galluzzi Lorenzo, Kepp Oliver, Pierron G\u00e9rard, Maiuri Maria Chiara, Hikita Hayato, Kroemer Romano, Kroemer Guido",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "23084476",
"url": "https://glygen.org/publication/PubMed/23084476"
}
]
},
{
"title": "Structural insights into the assembly of human translesion polymerase complexes.",
"journal": "Protein & cell",
"date": "2012",
"authors": "Xie W, Yang X, Xu M, Jiang T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "23143872",
"url": "https://glygen.org/publication/PubMed/23143872"
}
]
},
{
"title": "Activation of double-stranded RNA-activated protein kinase (PKR) by interferon-stimulated gene 15 (ISG15) modification down-regulates protein translation.",
"journal": "The Journal of biological chemistry",
"date": "2013-01-25",
"authors": "Okumura Fumihiko, Okumura Akiko J, Uematsu Keiji, Hatakeyama Shigetsugu, Zhang Dong-Er, Kamura Takumi",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "23229543",
"url": "https://glygen.org/publication/PubMed/23229543"
}
]
},
{
"title": "p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression.",
"journal": "PloS one",
"date": "2013",
"authors": "Chang CN, Feng MJ, Chen YL, Yuan RH, Jeng YM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "23593430",
"url": "https://glygen.org/publication/PubMed/23593430"
}
]
},
{
"title": "Suppression of antiviral innate immunity by sunitinib enhances oncolytic virotherapy.",
"journal": "Molecular therapy : the journal of the American Society of Gene Therapy",
"date": "2013-09",
"authors": "Jha Babal K, Dong Beihua, Nguyen Carvell T, Polyakova Irina, Silverman Robert H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "23732991",
"url": "https://glygen.org/publication/PubMed/23732991"
}
]
},
{
"title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.",
"journal": "Journal of cell science",
"date": "2013",
"authors": "Willnow TE, Andersen OM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "23813966",
"url": "https://glygen.org/publication/PubMed/23813966"
}
]
},
{
"title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.",
"journal": "Laboratory investigation; a journal of technical methods and pathology",
"date": "1985",
"authors": "Snow AD, Kisilevsky R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "2409350",
"url": "https://glygen.org/publication/PubMed/2409350"
}
]
},
{
"title": "Identification of the PKR nuclear interactome reveals roles in ribosome biogenesis, mRNA processing and cell division.",
"journal": "Journal of cellular physiology",
"date": "2014-08",
"authors": "Blalock William L, Piazzi Manuela, Bavelloni Alberto, Raffini Mirco, Faenza Irene, D'Angelo Antonietta, Cocco Lucio",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "24347309",
"url": "https://glygen.org/publication/PubMed/24347309"
}
]
},
{
"title": "Human Pol zeta purified with accessory subunits is active in translesion DNA synthesis and complements Pol eta in cisplatin bypass.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2014",
"authors": "Lee YS, Gregory MT, Yang W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "24449906",
"url": "https://glygen.org/publication/PubMed/24449906"
}
]
},
{
"title": "NF90 exerts antiviral activity through regulation of PKR phosphorylation and stress granules in infected cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2014-04-15",
"authors": "Wen Xi, Huang Xiaofeng, Mok Bobo Wing-Yee, Chen Yixin, Zheng Min, Lau Siu-Ying, Wang Pui, Song Wenjun, Jin Dong-Yan, Yuen Kwok-Yung, Chen Honglin",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "24623135",
"url": "https://glygen.org/publication/PubMed/24623135"
}
]
},
{
"title": "IPS-1 plays an essential role in dsRNA-induced stress granule formation by interacting with PKR and promoting its activation.",
"journal": "Journal of cell science",
"date": "2014-06-01",
"authors": "Zhang Peifen, Li Yuye, Xia Jun, He Junfang, Pu Jieying, Xie Jiong, Wu Siyu, Feng Lianqiang, Huang Xi, Zhang Ping",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "24659800",
"url": "https://glygen.org/publication/PubMed/24659800"
}
]
},
{
"title": "A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2014",
"authors": "Barraud P, Banerjee S, Mohamed WI, Jantsch MF, Allain FH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "24753571",
"url": "https://glygen.org/publication/PubMed/24753571"
}
]
},
{
"title": "TRIM4 modulates type I interferon induction and cellular antiviral response by targeting RIG-I for K63-linked ubiquitination.",
"journal": "Journal of molecular cell biology",
"date": "2014",
"authors": "Yan J, Li Q, Mao AP, Hu MM, Shu HB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-168928",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928"
}
],
"reference": [
{
"type": "PubMed",
"id": "24755855",
"url": "https://glygen.org/publication/PubMed/24755855"
}
]
},
{
"title": "Modification of PCNA by ISG15 plays a crucial role in termination of error-prone translesion DNA synthesis.",
"journal": "Molecular cell",
"date": "2014",
"authors": "Park JM, Yang SW, Yu KR, Ka SH, Lee SW, Seol JH, Jeon YJ, Chung CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "24768535",
"url": "https://glygen.org/publication/PubMed/24768535"
}
]
},
{
"title": "The Role of SORL1 in Alzheimer's Disease.",
"journal": "Molecular neurobiology",
"date": "2015",
"authors": "Yin RH, Yu JT, Tan L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "24833601",
"url": "https://glygen.org/publication/PubMed/24833601"
}
]
},
{
"title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.",
"journal": "Current Alzheimer research",
"date": "2014",
"authors": "Kandalepas PC, Vassar R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "24893886",
"url": "https://glygen.org/publication/PubMed/24893886"
}
]
},
{
"title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.",
"journal": "Current Alzheimer research",
"date": "2015",
"authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "25523424",
"url": "https://glygen.org/publication/PubMed/25523424"
}
]
},
{
"title": "p53-derived host restriction of HIV-1 replication by protein kinase R-mediated Tat phosphorylation and inactivation.",
"journal": "Journal of virology",
"date": "2015-04",
"authors": "Yoon Cheol-Hee, Kim Sang-Yoon, Byeon Se Eun, Jeong Yideul, Lee Jinjoo, Kim Kwang Pyo, Park Jinseu, Bae Yong-Soo",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "25653431",
"url": "https://glygen.org/publication/PubMed/25653431"
}
]
},
{
"title": "Potential role for snoRNAs in PKR activation during metabolic stress.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2015-04-21",
"authors": "Youssef Osama A, Safran Sarah A, Nakamura Takahisa, Nix David A, Hotamisligil G\u00f6khan S, Bass Brenda L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "25848059",
"url": "https://glygen.org/publication/PubMed/25848059"
}
]
},
{
"title": "Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.",
"journal": "Virology",
"date": "2015-08",
"authors": "Li Yan, Jain Neeraj, Limpanawat Suweeraya, To Janet, Quistgaard Esben M, Nordlund Par, Thanabalu Thirumaran, Torres Jaume",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "25854864",
"url": "https://glygen.org/publication/PubMed/25854864"
}
]
},
{
"title": "Abeta42 and Abeta40: similarities and differences.",
"journal": "Journal of peptide science : an official publication of the European Peptide Society",
"date": "2015",
"authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "26018760",
"url": "https://glygen.org/publication/PubMed/26018760"
}
]
},
{
"title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.",
"journal": "Neurobiology of aging",
"date": "2015",
"authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "26417681",
"url": "https://glygen.org/publication/PubMed/26417681"
}
]
},
{
"title": "The Regulatory and Kinase Domains but Not the Interdomain Linker Determine Human Double-stranded RNA-activated Kinase (PKR) Sensitivity to Inhibition by Viral Non-coding RNAs.",
"journal": "The Journal of biological chemistry",
"date": "2015-11-20",
"authors": "Sunita S, Schwartz Samantha L, Conn Graeme L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "26432638",
"url": "https://glygen.org/publication/PubMed/26432638"
}
]
},
{
"title": "Activated PKR inhibits pancreatic \u03b2-cell proliferation through sumoylation-dependent stabilization of P53.",
"journal": "Molecular immunology",
"date": "2015-12",
"authors": "Song Ying, Wan XiaoMeng, Gao LiLi, Pan Yi, Xie WeiPing, Wang Hong, Guo Jun",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "26446704",
"url": "https://glygen.org/publication/PubMed/26446704"
}
]
},
{
"title": "Regulation of PKR by RNA: formation of active and inactive dimers.",
"journal": "Biochemistry",
"date": "2015-11-10",
"authors": "Husain Bushra, Hesler Stephen, Cole James L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "26488609",
"url": "https://glygen.org/publication/PubMed/26488609"
}
]
},
{
"title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.",
"journal": "The Journal of biological chemistry",
"date": "2016",
"authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "26668317",
"url": "https://glygen.org/publication/PubMed/26668317"
}
]
},
{
"title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.",
"journal": "Cellular and molecular life sciences : CMLS",
"date": "2016",
"authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "26686862",
"url": "https://glygen.org/publication/PubMed/26686862"
}
]
},
{
"title": "Essential role of protein kinase R antagonism by TRS1 in human cytomegalovirus replication.",
"journal": "Virology",
"date": "2016-02",
"authors": "Braggin Jacquelyn E, Child Stephanie J, Geballe Adam P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "26716879",
"url": "https://glygen.org/publication/PubMed/26716879"
}
]
},
{
"title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.",
"journal": "Neural regeneration research",
"date": "2015",
"authors": "Hermey G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "26807092",
"url": "https://glygen.org/publication/PubMed/26807092"
}
]
},
{
"title": "Editing of Cellular Self-RNAs by Adenosine Deaminase ADAR1 Suppresses Innate Immune Stress Responses.",
"journal": "The Journal of biological chemistry",
"date": "2016-03-18",
"authors": "George Cyril X, Ramaswami Gokul, Li Jin Billy, Samuel Charles E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "26817845",
"url": "https://glygen.org/publication/PubMed/26817845"
}
]
},
{
"title": "Activation of PKR by short stem-loop RNAs containing single-stranded arms.",
"journal": "RNA (New York, N.Y.)",
"date": "2016-07",
"authors": "Mayo Christopher B, Wong C Jason, Lopez Prisma E, Lary Jeffrey W, Cole James L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "27208315",
"url": "https://glygen.org/publication/PubMed/27208315"
}
]
},
{
"title": "Discriminating Self and Non-Self by RNA: Roles for RNA Structure, Misfolding, and Modification in Regulating the Innate Immune Sensor PKR.",
"journal": "Accounts of chemical research",
"date": "2016-06-21",
"authors": "Hull Chelsea M, Bevilacqua Philip C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "27269119",
"url": "https://glygen.org/publication/PubMed/27269119"
}
]
},
{
"title": "NF90 is a novel influenza A virus NS1-interacting protein that antagonizes the inhibitory role of NS1 on PKR phosphorylation.",
"journal": "FEBS letters",
"date": "2016-08",
"authors": "Li Ting, Li Xi, Zhu WenFei, Wang HuiYu, Mei Lin, Wu ShaoQiang, Lin XiangMei, Han XueQing",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "27423063",
"url": "https://glygen.org/publication/PubMed/27423063"
}
]
},
{
"title": "Mechanism of Protein Kinase R Inhibition by Human Cytomegalovirus pTRS1.",
"journal": "Journal of virology",
"date": "2017",
"authors": "Vincent HA, Ziehr B, Moorman NJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "27974558",
"url": "https://glygen.org/publication/PubMed/27974558"
}
]
},
{
"title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1978",
"authors": "Costa PP, Figueira AS, Bravo FR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "279930",
"url": "https://glygen.org/publication/PubMed/279930"
}
]
},
{
"title": "Human noncoding RNA 886 (nc886) adopts two structurally distinct conformers that are functionally opposing regulators of PKR.",
"journal": "RNA (New York, N.Y.)",
"date": "2017-04",
"authors": "Calderon Brenda M, Conn Graeme L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "28069888",
"url": "https://glygen.org/publication/PubMed/28069888"
}
]
},
{
"title": "ADAR1 and PACT contribute to efficient translation of transcripts containing HIV-1 trans-activating response (TAR) element.",
"journal": "The Biochemical journal",
"date": "2017",
"authors": "Chukwurah E, Handy I, Patel RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "28167698",
"url": "https://glygen.org/publication/PubMed/28167698"
}
]
},
{
"title": "Auto-phosphorylation Represses Protein Kinase R Activity.",
"journal": "Scientific reports",
"date": "2017-03-10",
"authors": "Wang Die, de Weerd Nicole A, Willard Belinda, Polekhina Galina, Williams Bryan R G, Sadler Anthony J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "28281686",
"url": "https://glygen.org/publication/PubMed/28281686"
}
]
},
{
"title": "Non-coding RNA 886 promotes renal cell carcinoma growth and metastasis through the Janus kinase 2/signal transducer and activator of transcription 3 signaling pathway.",
"journal": "Molecular medicine reports",
"date": "2017-10",
"authors": "Lei Jun, Xiao Ju-Hua, Zhang Shou-Hua, Liu Zhi-Qiang, Huang Kai, Luo Zhi-Peng, Xiao Xin-Lan, Hong Zheng-Dong",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "28765891",
"url": "https://glygen.org/publication/PubMed/28765891"
}
]
},
{
"title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.",
"journal": "Lancet (London, England)",
"date": "1988",
"authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "2900981",
"url": "https://glygen.org/publication/PubMed/2900981"
}
]
},
{
"title": "Inhibition of the inflammatory response to stress by targeting interaction between PKR and its cellular activator PACT.",
"journal": "Scientific reports",
"date": "2017-11-23",
"authors": "Dabo Stephanie, Maillard Patrick, Collados Rodriguez Milagros, Hansen Marianne Dor\u00e9, Mazouz Sabrina, Bigot Donna-Joe, Tible Marion, Janvier Genevi\u00e8ve, Helynck Olivier, Cassonnet Patricia, Jacob Yves, Bellalou Jacques, Gatignol Anne, Patel Rekha C, Hugon Jacques, Munier-Lehmann H\u00e9l\u00e8ne, Meurs Eliane F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29170442",
"url": "https://glygen.org/publication/PubMed/29170442"
}
]
},
{
"title": "PPP2R5A: A multirole protein phosphatase subunit in regulating cancer development.",
"journal": "Cancer letters",
"date": "2018",
"authors": "Mao Z, Liu C, Lin X, Sun B, Su C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29175459",
"url": "https://glygen.org/publication/PubMed/29175459"
}
]
},
{
"title": "Contribution of the two dsRBM motifs to the double-stranded RNA binding and protein interactions of PACT.",
"journal": "Journal of cellular biochemistry",
"date": "2018-04",
"authors": "Chukwurah Evelyn, Willingham Victoria, Singh Madhurima, Castillo-Azofeifa David, Patel Rekha C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29231267",
"url": "https://glygen.org/publication/PubMed/29231267"
}
]
},
{
"title": "Stress-induced TRBP phosphorylation enhances its interaction with PKR to regulate cellular survival.",
"journal": "Scientific reports",
"date": "2018",
"authors": "Chukwurah E, Patel RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29348664",
"url": "https://glygen.org/publication/PubMed/29348664"
}
]
},
{
"title": "Nc886 is epigenetically repressed in prostate cancer and acts as a tumor suppressor through the inhibition of cell growth.",
"journal": "BMC cancer",
"date": "2018-02-02",
"authors": "Fort Rafael Sebasti\u00e1n, Math\u00f3 Cecilia, Geraldo Murilo Vieira, Ottati Mar\u00eda Carolina, Yamashita Alex Shimura, Saito Kelly Cristina, Leite Katia Ramos Moreira, M\u00e9ndez Manuel, Maedo Noem\u00ed, M\u00e9ndez Laura, Garat Beatriz, Kimura Edna Teruko, Sotelo-Silveira Jos\u00e9 Roberto, Duhagon Mar\u00eda Ana",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29394925",
"url": "https://glygen.org/publication/PubMed/29394925"
}
]
},
{
"title": "Human ADAR1 Prevents Endogenous RNA from Triggering Translational Shutdown.",
"journal": "Cell",
"date": "2018-02-08",
"authors": "Chung Hachung, Calis Jorg J A, Wu Xianfang, Sun Tony, Yu Yingpu, Sarbanes Stephanie L, Dao Thi Viet Loan, Shilvock Abigail R, Hoffmann H-Heinrich, Rosenberg Brad R, Rice Charles M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29395325",
"url": "https://glygen.org/publication/PubMed/29395325"
}
]
},
{
"title": "Role of eIF2\u03b1 Kinases in Translational Control and Adaptation to Cellular Stress.",
"journal": "Cold Spring Harbor perspectives in biology",
"date": "2018-07-02",
"authors": "Wek Ronald C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29440070",
"url": "https://glygen.org/publication/PubMed/29440070"
}
]
},
{
"title": "Inflammation kinase PKR phosphorylates \u03b1-synuclein and causes \u03b1-synuclein-dependent cell death.",
"journal": "Neurobiology of disease",
"date": "2018-07",
"authors": "Reimer Lasse, Vesterager Louise Buur, Betzer Cristine, Zheng Jin, Nielsen L\u00e6rke Dalsgaard, Kofoed Rikke Hahn, Lassen Louise Berkhoudt, B\u00f8lcho Ulrik, Paludan S\u00f8ren Riis, Fog Karina, Jensen Poul Henning",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "29501855",
"url": "https://glygen.org/publication/PubMed/29501855"
}
]
},
{
"title": "PKR Senses Nuclear and Mitochondrial Signals by Interacting with Endogenous Double-Stranded RNAs.",
"journal": "Molecular cell",
"date": "2018-09-20",
"authors": "Kim Yoosik, Park Joha, Kim Sujin, Kim MinA, Kang Myeong-Gyun, Kwak Chulhwan, Kang Minjeong, Kim Baekgyu, Rhee Hyun-Woo, Kim V Narry",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "30174290",
"url": "https://glygen.org/publication/PubMed/30174290"
}
]
},
{
"title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1987",
"authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "3035556",
"url": "https://glygen.org/publication/PubMed/3035556"
}
]
},
{
"title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "3053705",
"url": "https://glygen.org/publication/PubMed/3053705"
}
]
},
{
"title": "The search for a PKR code-differential regulation of protein kinase R activity by diverse RNA and protein regulators.",
"journal": "RNA (New York, N.Y.)",
"date": "2019",
"authors": "Bou-Nader C, Gordon JM, Henderson FE, Zhang J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "30770398",
"url": "https://glygen.org/publication/PubMed/30770398"
}
]
},
{
"title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.",
"journal": "The New England journal of medicine",
"date": "1986",
"authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "3080684",
"url": "https://glygen.org/publication/PubMed/3080684"
}
]
},
{
"title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1986",
"authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "3094007",
"url": "https://glygen.org/publication/PubMed/3094007"
}
]
},
{
"title": "Structure and Degradation of Circular RNAs Regulate PKR Activation in Innate Immunity.",
"journal": "Cell",
"date": "2019-05-02",
"authors": "Liu Chu-Xiao, Li Xiang, Nan Fang, Jiang Shan, Gao Xiang, Guo Si-Kun, Xue Wei, Cui Yange, Dong Kaige, Ding Huihua, Qu Bo, Zhou Zhaocai, Shen Nan, Yang Li, Chen Ling-Ling",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "31031002",
"url": "https://glygen.org/publication/PubMed/31031002"
}
]
},
{
"title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.",
"journal": "Biochemical and biophysical research communications",
"date": "1988",
"authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "3142462",
"url": "https://glygen.org/publication/PubMed/3142462"
}
]
},
{
"title": "vtRNA2-1/nc886 Produces a Small RNA That Contributes to Its Tumor Suppression Action through the microRNA Pathway in Prostate Cancer.",
"journal": "Non-coding RNA",
"date": "2020-02-20",
"authors": "Fort Rafael Sebasti\u00e1n, Garat Beatriz, Sotelo-Silveira Jos\u00e9 Roberto, Duhagon Mar\u00eda Ana",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "32093270",
"url": "https://glygen.org/publication/PubMed/32093270"
}
]
},
{
"title": "UBE2L6 is Involved in Cisplatin Resistance by Regulating the Transcription of ABCB6.",
"journal": "Anti-cancer agents in medicinal chemistry",
"date": "2020",
"authors": "Murakami M, Izumi H, Kurita T, Koi C, Morimoto Y, Yoshino K",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
}
],
"reference": [
{
"type": "PubMed",
"id": "32329696",
"url": "https://glygen.org/publication/PubMed/32329696"
}
]
},
{
"title": "PKR kinase directly regulates tau expression and Alzheimer's disease-related tau phosphorylation.",
"journal": "Brain pathology (Zurich, Switzerland)",
"date": "2021-01",
"authors": "Reimer Lasse, Betzer Cristine, Kofoed Rikke Hahn, Volbracht Christiane, Fog Karina, Kurhade Chaitanya, Nilsson Emma, \u00d6verby Anna K, Jensen Poul Henning",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "32716602",
"url": "https://glygen.org/publication/PubMed/32716602"
}
]
},
{
"title": "Cell fate determined by the activation balance between PKR and SPHK1.",
"journal": "Cell death and differentiation",
"date": "2021-01",
"authors": "Qiao Han, Jiang Tianqing, Mu Peiqiang, Chen Xiaoxuan, Wen Xianhui, Hu Zhangsheng, Tang Shulin, Wen Jikai, Deng Yiqun",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "32801355",
"url": "https://glygen.org/publication/PubMed/32801355"
}
]
},
{
"title": "An integrative analysis identifying transcriptional features and key genes involved in COVID-19.",
"journal": "Epigenomics",
"date": "2020",
"authors": "Li G, Wang J, He X, Zhang L, Ran Q, Xiong A, Wu D, Hu L, Song Q, Zhu D",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
}
],
"reference": [
{
"type": "PubMed",
"id": "33242255",
"url": "https://glygen.org/publication/PubMed/33242255"
}
]
},
{
"title": "The PKR/P38/RIPK1 Signaling Pathway as a Therapeutic Target in Alzheimer's Disease.",
"journal": "International journal of molecular sciences",
"date": "2021-03-19",
"authors": "Hugon Jacques, Paquet Claire",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "33808629",
"url": "https://glygen.org/publication/PubMed/33808629"
}
]
},
{
"title": "PKR activity modulation by phosphomimetic mutations of serine residues located three aminoacids upstream of double-stranded RNA binding motifs.",
"journal": "Scientific reports",
"date": "2021-04-28",
"authors": "Cesaro Teresa, Hayashi Yohei, Borghese Fabian, Vertommen Didier, Wavreil Fanny, Michiels Thomas",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "33911136",
"url": "https://glygen.org/publication/PubMed/33911136"
}
]
},
{
"title": "Regulation of PKR activation and apoptosis during oxidative stress by TRBP phosphorylation.",
"journal": "The international journal of biochemistry & cell biology",
"date": "2021-08",
"authors": "Ukhueduan Benedicth, Chukwurah Evelyn, Patel Rekha C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "34174402",
"url": "https://glygen.org/publication/PubMed/34174402"
}
]
},
{
"title": "Increased UBE2L6 regulated by type 1 interferon as potential marker in TB.",
"journal": "Journal of cellular and molecular medicine",
"date": "2021",
"authors": "Gao J, Li C, Li W, Chen H, Fu Y, Yi Z",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
}
],
"reference": [
{
"type": "PubMed",
"id": "34773365",
"url": "https://glygen.org/publication/PubMed/34773365"
}
]
},
{
"title": "Nc886 promotes renal cancer cell drug-resistance by enhancing EMT through Rock2 phosphorylation-mediated \u03b2-catenin nuclear translocation.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2022-02",
"authors": "Gao Weiyin, Zhang Shouhua, Guorong Li, Liu Queling, Zhu Anyi, Gui Fu, Zou Yan, Wu Yiguo, Luo Yang, Hong Zhengdong",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "34974812",
"url": "https://glygen.org/publication/PubMed/34974812"
}
]
},
{
"title": "Downregulation of nc886 contributes to prostate cancer cell invasion and TGF\u03b21-induced EMT.",
"journal": "Genes & diseases",
"date": "2022-07",
"authors": "Yang Ronghui, Zuo Lingkun, Ma Hui, Zhou Ying, Zhou Ping, Wang Liyong, Wang Miao, Latif Mahrukh, Kong Lu",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "35685460",
"url": "https://glygen.org/publication/PubMed/35685460"
}
]
},
{
"title": "Mitochondrial double-stranded RNAs govern the stress response in chondrocytes to promote osteoarthritis development.",
"journal": "Cell reports",
"date": "2022-08-09",
"authors": "Kim Sujin, Lee Keonyong, Choi Yong Seok, Ku Jayoung, Kim Hyeonkyeong, Kharbash Raisa, Yoon Jimin, Lee Yong Seuk, Kim Jin-Hong, Lee Yun Jong, Kim Yoosik",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "35947956",
"url": "https://glygen.org/publication/PubMed/35947956"
}
]
},
{
"title": "An Unexpected Encounter: Respiratory Syncytial Virus Nonstructural Protein 1 Interacts with Mediator Subunit MED25.",
"journal": "Journal of virology",
"date": "2022-10-12",
"authors": "Van Royen Tessa, Sedeyn Koen, Moschonas George D, Toussaint Wendy, Vuylsteke Marnik, Van Haver Delphi, Impens Francis, Eyckerman Sven, Lemmens Irma, Tavernier Jan, Schepens Bert, Saelens Xavier",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110"
}
],
"reference": [
{
"type": "PubMed",
"id": "36102648",
"url": "https://glygen.org/publication/PubMed/36102648"
}
]
},
{
"title": "Protein kinase R dependent phosphorylation of \u03b1-synuclein regulates its membrane binding and aggregation.",
"journal": "PNAS nexus",
"date": "2022-11",
"authors": "Reimer Lasse, Gram Hjalte, Jensen Nanna M\u00f8ller, Betzer Cristine, Yang Li, Jin Lorrain, Shi Min, Boudeffa Driss, Fusco Giuliana, De Simone Alfonso, Kirik Deniz, Lashuel Hilal A, Zhang Jing, Jensen Poul Henning",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "36712380",
"url": "https://glygen.org/publication/PubMed/36712380"
}
]
},
{
"title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.",
"journal": "Biochemical and biophysical research communications",
"date": "1987",
"authors": "Pepys MB, Butler PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "3675579",
"url": "https://glygen.org/publication/PubMed/3675579"
}
]
},
{
"title": "Inhibition of RNA-binding proteins with small molecules.",
"journal": "Nature reviews. Chemistry",
"date": "2020-09",
"authors": "Wu Peng",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "37127961",
"url": "https://glygen.org/publication/PubMed/37127961"
}
]
},
{
"title": "Association of UBE2L6 and ABCB6 Expression With Platinum Resistance in Serous Ovarian Carcinoma.",
"journal": "Anticancer research",
"date": "2023-08",
"authors": "Shibahara Mami, Kurita Tomoko, Murakami Midori, Harada Hiroshi, Koi Chiho, Izumi Hiroto, Yoshino Kiyoshi",
"evidence": [
{
"database": "RefSeq",
"id": "NP_004214",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_004214"
}
],
"reference": [
{
"type": "PubMed",
"id": "37500176",
"url": "https://glygen.org/publication/PubMed/37500176"
}
]
},
{
"title": "HIV-1 Tat directly interacts with the interferon-induced, double-stranded RNA-dependent kinase, PKR.",
"journal": "Virology",
"date": "1995-11-10",
"authors": "McMillan N A, Chun R F, Siderovski D P, Galabru J, Toone W M, Samuel C E, Mak T W, Hovanessian A G, Jeang K T, Williams B R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7491766",
"url": "https://glygen.org/publication/PubMed/7491766"
}
]
},
{
"title": "TAR RNA-binding protein is an inhibitor of the interferon-induced protein kinase PKR.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994-05-24",
"authors": "Park H, Davies M V, Langland J O, Chang H W, Nam Y S, Tartaglia J, Paoletti E, Jacobs B L, Kaufman R J, Venkatesan S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7515177",
"url": "https://glygen.org/publication/PubMed/7515177"
}
]
},
{
"title": "The interferon-inducible double-stranded RNA-activated protein kinase self-associates in vitro and in vivo.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995-08-29",
"authors": "Patel R C, Stanton P, McMillan N M, Williams B R, Sen G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7545299",
"url": "https://glygen.org/publication/PubMed/7545299"
}
]
},
{
"title": "Nuclear import of influenza virus RNA can be mediated by viral nucleoprotein and transport factors required for protein import.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "O'Neill RE, Jaskunas R, Blobel G, Palese P, Moroianu J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "7559393",
"url": "https://glygen.org/publication/PubMed/7559393"
}
]
},
{
"title": "Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase.",
"journal": "Molecular and cellular biology",
"date": "1995-10",
"authors": "Patterson J B, Samuel C E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7565688",
"url": "https://glygen.org/publication/PubMed/7565688"
}
]
},
{
"title": "Mechanism of interferon action: evidence for intermolecular autophosphorylation and autoactivation of the interferon-induced, RNA-dependent protein kinase PKR.",
"journal": "Journal of virology",
"date": "1993-12",
"authors": "Thomis D C, Samuel C E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7693978",
"url": "https://glygen.org/publication/PubMed/7693978"
}
]
},
{
"title": "Nuclear localization of the interferon-inducible protein kinase PKR in human cells and transfected mouse cells.",
"journal": "Experimental cell research",
"date": "1995-05",
"authors": "Jeffrey I W, Kadereit S, Meurs E F, Metzger T, Bachmann M, Schwemmle M, Hovanessian A G, Clemens M J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7737357",
"url": "https://glygen.org/publication/PubMed/7737357"
}
]
},
{
"title": "Organization of the double-stranded RNA-activated protein kinase DAI and virus-associated VA RNAI in adenovirus-2-infected HeLa cells.",
"journal": "Journal of cell science",
"date": "1993-09",
"authors": "Jim\u00e9nez-Garc\u00eda L F, Green S R, Mathews M B, Spector D L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "7903669",
"url": "https://glygen.org/publication/PubMed/7903669"
}
]
},
{
"title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.",
"journal": "Clinical and experimental immunology",
"date": "1994",
"authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8033412",
"url": "https://glygen.org/publication/PubMed/8033412"
}
]
},
{
"title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.",
"journal": "Nature genetics",
"date": "1993",
"authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8097946",
"url": "https://glygen.org/publication/PubMed/8097946"
}
]
},
{
"title": "Structure of pentameric human serum amyloid P component.",
"journal": "Nature",
"date": "1994",
"authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8114934",
"url": "https://glygen.org/publication/PubMed/8114934"
}
]
},
{
"title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994",
"authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8159701",
"url": "https://glygen.org/publication/PubMed/8159701"
}
]
},
{
"title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.",
"journal": "Nature",
"date": "1993",
"authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8464497",
"url": "https://glygen.org/publication/PubMed/8464497"
}
]
},
{
"title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.",
"journal": "Biochemistry",
"date": "1993",
"authors": "Jarrett JT, Berger EP, Lansbury PT Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8490014",
"url": "https://glygen.org/publication/PubMed/8490014"
}
]
},
{
"title": "The P58 cellular inhibitor complexes with the interferon-induced, double-stranded RNA-dependent protein kinase, PKR, to regulate its autophosphorylation and activity.",
"journal": "The Journal of biological chemistry",
"date": "1996-01-19",
"authors": "Polyak S J, Tang N, Wambach M, Barber G N, Katze M G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8576172",
"url": "https://glygen.org/publication/PubMed/8576172"
}
]
},
{
"title": "Double-stranded (ds) RNA binding and not dimerization correlates with the activation of the dsRNA-dependent protein kinase (PKR).",
"journal": "The Journal of biological chemistry",
"date": "1996-01-19",
"authors": "Wu S, Kaufman R J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8576179",
"url": "https://glygen.org/publication/PubMed/8576179"
}
]
},
{
"title": "Thymine-thymine dimer bypass by yeast DNA polymerase zeta.",
"journal": "Science (New York, N.Y.)",
"date": "1996",
"authors": "Nelson JR, Lawrence CW, Hinkle DC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "8658138",
"url": "https://glygen.org/publication/PubMed/8658138"
}
]
},
{
"title": "Characterization of the heparin-mediated activation of PKR, the interferon-inducible RNA-dependent protein kinase.",
"journal": "Virology",
"date": "1996-07-01",
"authors": "George C X, Thomis D C, McCormack S J, Svahn C M, Samuel C E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8661426",
"url": "https://glygen.org/publication/PubMed/8661426"
}
]
},
{
"title": "Deoxycytidyl transferase activity of yeast REV1 protein.",
"journal": "Nature",
"date": "1996",
"authors": "Nelson JR, Lawrence CW, Hinkle DC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5656169",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169"
}
],
"reference": [
{
"type": "PubMed",
"id": "8751446",
"url": "https://glygen.org/publication/PubMed/8751446"
}
]
},
{
"title": "Specific mutations near the amino terminus of double-stranded RNA-dependent protein kinase (PKR) differentially affect its double-stranded RNA binding and dimerization properties.",
"journal": "The Journal of biological chemistry",
"date": "1996-10-11",
"authors": "Patel R C, Stanton P, Sen G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8810342",
"url": "https://glygen.org/publication/PubMed/8810342"
}
]
},
{
"title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.",
"journal": "Pathology international",
"date": "1996",
"authors": "Tsutsumi Y, Serizawa A, Hori S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "8870004",
"url": "https://glygen.org/publication/PubMed/8870004"
}
]
},
{
"title": "The 58-kDa cellular inhibitor of the double stranded RNA-dependent protein kinase requires the tetratricopeptide repeat 6 and DnaJ motifs to stimulate protein synthesis in vivo.",
"journal": "The Journal of biological chemistry",
"date": "1996-11-08",
"authors": "Tang N M, Ho C Y, Katze M G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "8910500",
"url": "https://glygen.org/publication/PubMed/8910500"
}
]
},
{
"title": "Prolactin-derived amyloid in the aging pituitary gland.",
"journal": "The American journal of pathology",
"date": "1997",
"authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "9006323",
"url": "https://glygen.org/publication/PubMed/9006323"
}
]
},
{
"title": "Oncogenic potential of TAR RNA binding protein TRBP and its regulatory interaction with RNA-dependent protein kinase PKR.",
"journal": "The EMBO journal",
"date": "1997-02-03",
"authors": "Benkirane M, Neuveut C, Chun R F, Smith S M, Samuel C E, Gatignol A, Jeang K T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9034343",
"url": "https://glygen.org/publication/PubMed/9034343"
}
]
},
{
"title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.",
"journal": "Nature genetics",
"date": "1997",
"authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "9054935",
"url": "https://glygen.org/publication/PubMed/9054935"
}
]
},
{
"title": "The Tat protein of human immunodeficiency virus type 1 is a substrate and inhibitor of the interferon-induced, virally activated protein kinase, PKR.",
"journal": "The Journal of biological chemistry",
"date": "1997-03-28",
"authors": "Brand S R, Kobayashi R, Mathews M B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9079663",
"url": "https://glygen.org/publication/PubMed/9079663"
}
]
},
{
"title": "Physical interaction between specific E2 and Hect E3 enzymes determines functional cooperativity.",
"journal": "J. Biol. Chem.",
"date": "1997",
"authors": "Kumar S, Kao W H, Howley P M",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"reference": [
{
"type": "PubMed",
"id": "9153201",
"url": "https://glygen.org/publication/PubMed/9153201"
}
]
},
{
"title": "Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Craiu A, Akopian T, Goldberg A, Rock KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9380723",
"url": "https://glygen.org/publication/PubMed/9380723"
}
]
},
{
"title": "DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.",
"journal": "The Journal of biological chemistry",
"date": "1998-01-23",
"authors": "Ting N S, Kao P N, Chan D W, Lintott L G, Lees-Miller S P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9442054",
"url": "https://glygen.org/publication/PubMed/9442054"
}
]
},
{
"title": "Ultrastructural localization of interferon-inducible double-stranded RNA-activated enzymes in human cells.",
"journal": "Experimental cell research",
"date": "1998-03-15",
"authors": "Besse S, Rebouillat D, Marie I, Puvion-Dutilleul F, Hovanessian A G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9521856",
"url": "https://glygen.org/publication/PubMed/9521856"
}
]
},
{
"title": "Ubiquitin is covalently attached to the p6Gag proteins of human immunodeficiency virus type 1 and simian immunodeficiency virus and to the p12Gag protein of Moloney murine leukemia virus.",
"journal": "Journal of virology",
"date": "1998",
"authors": "Ott DE, Coren LV, Copeland TD, Kane BP, Johnson DG, Sowder RC 2nd, Yoshinaka Y, Oroszlan S, Arthur LO, Henderson LE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1169408",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408"
}
],
"reference": [
{
"type": "PubMed",
"id": "9525617",
"url": "https://glygen.org/publication/PubMed/9525617"
}
]
},
{
"title": "Autophosphorylation in the activation loop is required for full kinase activity in vivo of human and yeast eukaryotic initiation factor 2alpha kinases PKR and GCN2.",
"journal": "Molecular and cellular biology",
"date": "1998",
"authors": "Romano PR, Garcia-Barrio MT, Zhang X, Wang Q, Taylor DR, Zhang F, Herring C, Mathews MB, Qin J, Hinnebusch AG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9528799",
"url": "https://glygen.org/publication/PubMed/9528799"
}
]
},
{
"title": "Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Beninga J, Rock KL, Goldberg AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9668046",
"url": "https://glygen.org/publication/PubMed/9668046"
}
]
},
{
"title": "PACT, a protein activator of the interferon-induced protein kinase, PKR.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Patel RC, Sen GC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9687506",
"url": "https://glygen.org/publication/PubMed/9687506"
}
]
},
{
"title": "Tumor suppressor p53 as a component of the tumor necrosis factor-induced, protein kinase PKR-mediated apoptotic pathway in human promonocytic U937 cells.",
"journal": "The Journal of biological chemistry",
"date": "1998-09-25",
"authors": "Yeung M C, Lau A S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9737981",
"url": "https://glygen.org/publication/PubMed/9737981"
}
]
},
{
"title": "Requirement of PKR dimerization mediated by specific hydrophobic residues for its activation by double-stranded RNA and its antigrowth effects in yeast.",
"journal": "Molecular and cellular biology",
"date": "1998-12",
"authors": "Patel R C, Sen G C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9819388",
"url": "https://glygen.org/publication/PubMed/9819388"
}
]
},
{
"title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.",
"journal": "FEBS letters",
"date": "1998",
"authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977225",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225"
}
],
"reference": [
{
"type": "PubMed",
"id": "9862427",
"url": "https://glygen.org/publication/PubMed/9862427"
}
]
},
{
"title": "The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Melville MW, Tan SL, Wambach M, Song J, Morimoto RI, Katze MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9833482",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482"
}
],
"reference": [
{
"type": "PubMed",
"id": "9920933",
"url": "https://glygen.org/publication/PubMed/9920933"
}
]
}
],
"pathway": [
{
"id": "hsa:9246",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9246",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-1169408",
"name": "ISG15 antiviral mechanism",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408",
"resource": "Reactome",
"description": "ISG15 antiviral mechanism"
},
{
"id": "R-HSA-168928",
"name": "DDX58/IFIH1-mediated induction of interferon-alpha/beta",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168928",
"resource": "Reactome",
"description": "DDX58/IFIH1-mediated induction of interferon-alpha/beta"
},
{
"id": "R-HSA-5656169",
"name": "Termination of translesion DNA synthesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169",
"resource": "Reactome",
"description": "Termination of translesion DNA synthesis"
},
{
"id": "R-HSA-936440",
"name": "Negative regulators of DDX58/IFIH1 signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936440",
"resource": "Reactome",
"description": "Negative regulators of DDX58/IFIH1 signaling"
},
{
"id": "R-HSA-977225",
"name": "Amyloid fiber formation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225",
"resource": "Reactome",
"description": "Amyloid fiber formation"
},
{
"id": "R-HSA-983168",
"name": "Antigen processing: Ubiquitination & Proteasome degradation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168",
"resource": "Reactome",
"description": "Antigen processing: Ubiquitination & Proteasome degradation"
},
{
"id": "R-HSA-9833110",
"name": "RSV-host interactions",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110",
"resource": "Reactome",
"description": "RSV-host interactions"
},
{
"id": "R-HSA-9833482",
"name": "PKR-mediated signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482",
"resource": "Reactome",
"description": "PKR-mediated signaling"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "Q4V8J2-1",
"protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6",
"gene_name": "Ube2l6",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MTASKRVAKELDDLSKELPPYLRHLSSDDANVLVWHMLLLPDQLPYRLKAFGLRIDFPREYPLKPPTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLLTQDPEMFRKKAEEFTLQYGVDRPS",
"length": 153
},
"evidence": [
{
"id": "45936761",
"url": "http://www.informatics.jax.org/homology/45936761",
"database": "MGI"
},
{
"id": "O14933",
"url": "https://omabrowser.org/oma/group/O14933/",
"database": "OMA"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q9QZU9-1",
"protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6",
"gene_name": "Ube2l6",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MMASKRVAKELESLSKELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFPREYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLKFGVDRPS",
"length": 153
},
"evidence": [
{
"id": "45936761",
"url": "http://www.informatics.jax.org/homology/45936761",
"database": "MGI"
},
{
"id": "O14933",
"url": "https://omabrowser.org/oma/group/O14933/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 7,
"go_terms": [
{
"name": "ATP binding",
"id": "GO:0005524",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin-like protein transferase activity",
"id": "GO:0019787",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019787",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin protein ligase binding",
"id": "GO:0031625",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin-protein transferase activity",
"id": "GO:0004842",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin binding",
"id": "GO:0043130",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ISG15 transferase activity",
"id": "GO:0042296",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042296",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin conjugating enzyme activity",
"id": "GO:0061631",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061631",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 6,
"go_terms": [
{
"name": "protein modification by small protein conjugation",
"id": "GO:0032446",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032446",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "protein modification process",
"id": "GO:0036211",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036211",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "innate immune response",
"id": "GO:0045087",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "protein polyubiquitination",
"id": "GO:0000209",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin-dependent protein catabolic process",
"id": "GO:0006511",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ISG15-protein conjugation",
"id": "GO:0032020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032020",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 5,
"go_terms": [
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "cytoplasm",
"id": "GO:0005737",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
},
{
"name": "ubiquitin ligase complex",
"id": "GO:0000151",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 24,
"end_pos": 26,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "ISGylated.",
"evidence": [
{
"database": "UniProtKB",
"id": "O14933",
"url": "https://www.uniprot.org/uniprot/O14933"
},
{
"database": "PubMed",
"id": "16428300",
"url": "https://glygen.org/publication/PubMed/16428300"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "R-HSA-1169394",
"name": "ISGylation of IRF3",
"equation": "",
"summary": "The transcription factor IRF3 is a target for ISGylation. Conjugation of ISG15 positively regulates IRF3 and thereby promotes induction of type I interferons. ISGylation of IRF3 prevents the binding of PIN1, a protein that promotes IRF3 ubiquitination and subsequent degradation.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-936014"
],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1169394",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169394"
}
]
},
{
"id": "R-HSA-1169395",
"name": "ISGylation of viral protein NS1",
"equation": "",
"summary": "Some viral proteins are also targeted for ISGylation. The well studied viral protein ISGylation is the modification of the influenza A viral protein NS1, which functions as an IFN antagonist during viral infection. Studies identified seven lysine residues in NS1 as potential ISGylation sites among which K41 (Zhao et al. 2010), K126 and K217 (Tang et al. 2010) were found to be critical. ISGylation at these sites disrupts NS1 association with importin-alpha, a protein required for the nuclear import of NS1.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1169395",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169395"
}
]
},
{
"id": "R-HSA-1169398",
"name": "ISGylation of host protein filamin B",
"equation": "",
"summary": "ISG15 negatively regulates the scaffold protein filamin B. In response to type I IFNs, filamin B recruits RAC1, MEKK1, and MKK4, enhancing their sequential activation and thereby promoting JNK activation and apoptosis. ISGylation of filamin B leads to the disassociation of RAC1, MEKK1, and MKK4 from the scaffold, preventing type I IFN dependent JNK activation and apoptosis. It has been suggested that this inhibition of apoptosis may protect uninfected bystander cells from IFN-mediated apoptosis (Jeon et al, 2009).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-HSA-354163"
],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1169398",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169398"
}
]
},
{
"id": "R-HSA-1169402",
"name": "ISGylation of E2 conjugating enzymes",
"equation": "",
"summary": "Ubiquitin conjugating E2 enzymes UBC13 and UBCH6 are targets for ISGylation. This suppresses the ubiquitin-conjugating activity of both UBC13 and UBCH6. This modification may play an important role in the control of signal transduction pathways, such as the NF-kB pathway, which are associated with K63-linked polyubiquitination (Takeuchi et al, 2005).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1",
"P51965-1",
"P61088-1"
],
"evidence": [
{
"id": "R-HSA-1169402",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169402"
}
]
},
{
"id": "R-HSA-1169403",
"name": "Interaction of E3 ligase with ISG15:E2 complex",
"equation": "",
"summary": "Ubiquitin ligase HERC5/CEB1 appears to be the predominant E3 ligase for ISGylation; EFP and HHARI/ARIH1 have also been reported as ISG15 E3 ligases. The E3 ligase recognizes specific target substrates and mediates the transfer of ISG15 from E2 to the substrate.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1169403",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169403"
}
]
},
{
"id": "R-HSA-1169404",
"name": "Transfer of ISG15 from E1 to E2 (UBCH8)",
"equation": "",
"summary": "Activated ISG15 linked to UBE1L is transferred to the E2 conjugating enzyme UBCH8.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-936550"
],
"enzyme_list": [
"O14933-1",
"P41226-1"
],
"evidence": [
{
"id": "R-HSA-1169404",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169404"
}
]
},
{
"id": "R-HSA-1169405",
"name": "ISGylation of protein phosphatase 1 beta (PP2CB)",
"equation": "",
"summary": "Protein phosphatase 1 beta (PPM1B/PP2CB) is a target for ISG15. PP2CB dephosphorylates TAK1 and suppresses TAK1/TAB1-mediated IkB alpha degradation and thereby controls the NF-kB signaling pathway, which plays a critical role in innate and adaptive immunity and cancer. ISGylation of PP2CB may block the suppressive function of the phosphatase against TAK1/TAB1 mediated NF-kB activation.",
"cellular_location": "cytosol",
"input_participant_list": [
"R-HSA-1169375"
],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O75688-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1169405",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169405"
}
]
},
{
"id": "R-HSA-1169406",
"name": "ISGylation of host proteins",
"equation": "",
"summary": "Many host proteins are targets for ISGylation including constitutively expressed proteins involved in various cellular pathways such as immunity, RNA splicing, chromatin remodeling/polymerase II transcription, stress responses and translation. Many ISG15 target proteins are IFN alpha/beta-induced antiviral proteins such as PKR, MxA, IRF3, and RIG-I, also included are several key regulators of signal transduction such as PLC gamma1, JAK1, STAT1 and ERK1. The contribution of most of these modified proteins to antiviral activity is unclear because the fate of the vast majority of ISGylated target proteins is unknown.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P27361-1",
"P19174-1",
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1",
"P51965-1",
"P19525-1",
"O95786-1",
"P23458-1"
],
"evidence": [
{
"id": "R-HSA-1169406",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169406"
}
]
},
{
"id": "R-HSA-1678842",
"name": "Competitive inhibition of translation initiation by ISGylated 4EHP",
"equation": "",
"summary": "Eukaryotic translation initiation factor 4F (eIF4F) is a protein complex that mediates recruitment of ribosomes to mRNA (Gingras et al. 1999). eIF4F contains complex of cap-binding protein eIF4E, scaffold protein eIF4G, and RNA helicase eIF4A. There are three eIF4E-family members in mammals termed eIF4E-1 (eIF4E), eIF4E2 (4EHP), and eIF4E3, of which both eIF4E and eIF4E3 are able to bind to eIF4G to facilitate translation initiation. However, 4EHP does not interact with eIF4G and thus cannot function in ribosome recruitment. 4EHP competes with eIF4E or eIF4E3 for binding to the RNA 5? cap structure and prevents translation initiation. ISGylated 4EHP has a much higher cap structure binding activity, suggesting a regulatory function of ISGylation in protein translation during immune responses (Okumura et al. 2007, Joshi et al. 2004).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P60842-1",
"Q9Y4X5-1",
"Q14240-1",
"O14933-1",
"P38919-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1678842",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1678842"
}
]
},
{
"id": "R-HSA-1678843",
"name": "ISGylation of protein translation regulator 4EHP",
"equation": "",
"summary": "4EHP is a member of eukaryotic translation initiation factor 4E (eIF4E) family that acts as an mRNA 5' cap structure-binding protein and suppresses translation. 4EHP is one of the targets of ISG15 and ISGylated 4EHP has a much higher cap structure-binding activity.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-1678843",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1678843"
}
]
},
{
"id": "R-HSA-168935",
"name": "viral dsRNA binds DDX58",
"equation": "",
"summary": "Probable ATP-dependent RNA helicase DDX58 (DDX58, RIG-I, RIG-1) has two caspase recruitment domains (CARD) in its N-terminus, a DExD/H helicase domain with an ATP binding motif in the middle and a repressor domain (RD) in the C-terminus. In the absence of appropriate stimulation, DDX58 is in a 'closed' conformation in which the repressor domain phyically interacts with the helicase domain masking CARD. Upon viral infection, the free triphosphate structure at the 5' end of viral RNAs activates DDX58 by binding to its RNA helicase domain. This provokes a change in DDX58 conformation exposing the CARD leading to DDX58 dimerization, allowing it to interact with Mitochondrial antiviral-signaling protein (MAVS, IPS-1).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q96C10-1",
"O14933-1",
"Q9UII4-1",
"O95786-1",
"P41226-1"
],
"evidence": [
{
"id": "R-HSA-168935",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168935"
}
]
},
{
"id": "R-HSA-5653754",
"name": "UBE2L6:TRIM25 ISGylates monoUb:K164-PCNA",
"equation": "",
"summary": "The complex of ISG15 E2 conjugating enzyme UBE2L6 (UBCH8) and ISG15 E3 conjugating enzyme TRIM25 (EFP) doubly ISGylates monoubiquitinated PCNA (MonoUb:K164-PCNA) on lysine residues K164 and K168. Note that PCNA is a homotrimer, meaning ISGylation of K164 (and K168) occurs on a different subunit than that monoubiquitinated on K164. UBA7 (UBE1L) is the ISG15 E1-activating enzyme (Park et al. 2014).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9UNA4-1",
"Q9UBZ9-1",
"Q9UBT6-1",
"O14933-1",
"Q14258-1",
"Q9Y253-1",
"P41226-1"
],
"evidence": [
{
"id": "R-HSA-5653754",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5653754"
}
]
},
{
"id": "R-HSA-5653756",
"name": "TRIM25 binds monoUb:164-PCNA",
"equation": "",
"summary": "PCNA monoubiquitinated on lysine residue K164 (MonoUb:K164-PCNA) is bound by ISG15 E3 ligase TRIM25 (EFP) in complex with ISG15 E2 conjugating enzyme UBE2L6 (UBCH8) (Park et al. 2014).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9UNA4-1",
"Q9UBZ9-1",
"Q9UBT6-1",
"O14933-1",
"Q14258-1",
"Q9Y253-1"
],
"evidence": [
{
"id": "R-HSA-5653756",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5653756"
}
]
},
{
"id": "R-HSA-5658496",
"name": "SIAH1:UBE2L6:Ubiquitin binds SNCA",
"equation": "",
"summary": "Seven in absentia homolog 1 (SIAH1) and 2 (SIAH2) are E3 ubiquitin-protein ligases that mediates ubiquitination of a number of target proteins including Synphilin-1 (SNCAIP) (Nagano et al. 2003) and alpha-synuclein (SNCA) (Liani et al. 2004, Lee et al. 2008). Ubiquitination of SNCA by SIAH1 is disrupted by the Parkinson's Disease (PD)-linked A30P mutation but not by the A53T mutation. SIAH1 binds the E2 ubiquitin-conjugating enzyme UBE2L6 (UBCH8) (Lee et al. 2008). This facilitates the mono- and di-ubiquitination of SNCA in vivo, but does not target SNCA for proteasomal degradation, rather it promotes SNCA aggregation and enhances toxicity (Lee et al. 2008). Monoubiquitinated SNCA may work as a seed for aggregation (Engelender 2008) and recruit other PD-related proteins, such as SNCAIP and UCHL1.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O43255-1",
"Q8IUQ4-1",
"O14933-1"
],
"evidence": [
{
"id": "R-HSA-5658496",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658496"
}
]
},
{
"id": "R-HSA-5660753",
"name": "SIAH1:UBE2L6:Ubiquitin ubiquitinates SNCA",
"equation": "",
"summary": "SIAH1 transfers ubiquitin from UBE2L6 to SNCA, generating monoubiquitinated SNCA (Ub-SNCA) (Liani et al 2004, Rott et al. 2008, Lee et al. 2008). Monoubiquitination of SNCA promotes its aggregation in vitro and in vivo, which is toxic to cells. Lewy Bodies, a characteristic of Parkinson's Disease, contain monoubiquitinted SNCA deposits (Hasegawa et al. 2002). Mass spectrometry analysis demonstrates that SIAH monoubiquitinates alpha-synuclein at lysines 12, 21, and 23 (Rott et al. 2008).
Monoubiquitination is generally thought to lead to degradation via the lysosomal pathway (d'Azzo et al. 2005) but monoubiquitinated SNCA appears to be preferentially targeted for degradation by the proteasome (Rott et al. 2011).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O43255-1",
"Q8IUQ4-1",
"O14933-1"
],
"evidence": [
{
"id": "R-HSA-5660753",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5660753"
}
]
},
{
"id": "R-HSA-5660757",
"name": "Ub-SNCA dissociates from the conjugating enzyme",
"equation": "",
"summary": "SNCA is monoubiquitinated and under some circumstances released to accumulate in the cell. Alternatively Ub-SNCA may undergo further rounds of ubiquitination producing diubiquitinated or polyubiquitinated forms. The precise mechanism of release and subsequent further ubiquitination is unclear (Sadowski et al. 2011); the E3 ligase may remain bound to SNCA while the E2 ligase dissociates to be replaced by a Ubiquitin-associated replacement, or the E2/E3 complex may dissociate completely allowing a different E3 to bind the SNCA substrate.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q8IUQ4-1",
"O14933-1"
],
"evidence": [
{
"id": "R-HSA-5660757",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5660757"
}
]
},
{
"id": "R-HSA-936412",
"name": "RNF125 mediated ubiquitination of DDX58, IFIH1 and MAVS",
"equation": "",
"summary": "RNF125 acts as an E3-ubiquitin ligase that conjugates with RIG-I (DDX58), MDA5 (IFIH1) and IPS-1 (MAVS) and mediate their proteosomal degradation. UbcH1, UbcH5a, UbcH5b, and UbcH5c function as an E2 enzyme and conjugate ubiquitin to RNF125 and DDX58 via K48. Among these enzymes UbcH5c is the major E2 enzyme showing enhanced ubiquitin conjugation to DDX58. RNF125 mediated ubiquitination of RIG-I, MDA5 and MAVS (IPS-1) inhibits DDX58/IFIH1 signaling by shunting these proteins toward proteasomal degradation.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O14933-1",
"Q9BYX4-1",
"P51668-1",
"P61077-1",
"Q96EQ8-1",
"P62837-1",
"O95786-1",
"P61086-1"
],
"evidence": [
{
"id": "R-HSA-936412",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936412"
}
]
},
{
"id": "R-HSA-936563",
"name": "ISGylation of DDX58",
"equation": "",
"summary": "ISG15 is an ubiquitin (Ub)-like protein which is conjugated to intracellular proteins via an isopeptide bond. Similar to ubiquitination, the conjugation of ISG15 (ISGylation) requires a three-step process, involving an E1 activating enzyme (UBE1L), an E2 conjugating enzyme (UbcM8/H8), and HERC5/Ceb1 an IFN-inducible ISG15-specific E3 ligase. ISG15 conjugation may play an important regulatory role in IFN-mediated antiviral responses. IFN induces ISG15 conjugation to DDX58 negatively regulating DDX58-mediated antiviral signaling. ISGylated DDX58 becomes subject to an irreversible biochemical process, such as proteolysis or proteasomeal degradation.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O14933-1",
"Q9UII4-1",
"O95786-1",
"P41226-1"
],
"evidence": [
{
"id": "R-HSA-936563",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936563"
}
]
},
{
"id": "R-HSA-983140",
"name": "Transfer of Ub from E2 to substrate and release of E2",
"equation": "",
"summary": "Interaction of E3 with both substrate and E2-Ub, brings them into proximity so that ubiquitin is transferred from E2 to the substrate. In most cases the transfer of ubiquitin is direct from E2 to substrate, but in a small subset of E3s, it occurs via a covalent E3-Ub thioester intermediate (Raymond et al. 2009).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BYM8-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9UHC7-1",
"Q96PU5-1",
"Q9Y2X8-1",
"Q9Y4L5-1",
"Q8TDB6-1",
"Q9NQ86-1",
"O43255-1",
"Q96BH1-1",
"P49427-1",
"P61081-1",
"P62877-1",
"Q8WVD3-1",
"Q15386-1",
"Q5VVX9-1",
"Q86XS8-1",
"O94822-1",
"Q2Q1W2-1",
"O60291-1",
"Q5U5Q3-1",
"Q96AX9-1",
"Q96F44-1",
"Q9NVW2-1",
"O94874-1",
"Q7Z3V4-1",
"Q8IUQ4-1",
"Q13049-1",
"Q9UNE7-1",
"Q16763-1",
"Q86Y13-1",
"Q8TBB1-1",
"Q8WV44-1",
"Q96PM5-1",
"Q9C026-1",
"O60260-1",
"Q9UBS8-1",
"Q9Y252-1",
"P60604-1",
"Q712K3-1",
"Q969K3-1",
"O15033-1",
"O94972-1",
"Q86WT6-1",
"Q9H4P4-1",
"Q13191-1",
"Q14669-1",
"Q7Z6Z7-1",
"O14933-1",
"O95376-1",
"P68036-1",
"Q96LR5-1",
"Q7Z419-1",
"Q96J02-1",
"Q9BV68-1",
"Q969Q1-1",
"Q9H0M0-1",
"Q9HAU4-1",
"Q9HCE7-1",
"Q5T447-1",
"Q15751-1",
"Q9UII4-1",
"Q05086-1",
"O43164-1",
"Q86XT4-1",
"P78317-1",
"P49459-1",
"Q7Z6E9-1",
"Q5VTB9-1",
"Q5XPI4-1",
"Q63HN8-3",
"Q6ZMZ0-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"Q9Y508-1",
"P51965-1",
"P61088-1",
"P62837-1",
"Q6ZNA4-1",
"P62253-1",
"Q7Z6J8-1",
"Q8IWV8-1",
"Q8ND25-1",
"Q9Y385-1",
"Q5T4S7-1",
"Q8N7E2-1",
"Q8NHG8-1",
"Q9HCM9-1",
"P19474-1",
"Q8WY64-1",
"Q9Y4B6-1",
"Q6Q0C0-1",
"Q6UWE0-1",
"Q8N6D2-1",
"Q8TC41-1",
"Q9NV58-1",
"P61086-1",
"P46934-1",
"P41226-1",
"P62256-1",
"Q14139-1",
"Q96B02-1",
"Q9C037-1",
"Q8IYU2-1",
"Q9P2P5-1",
"O95714-1",
"Q15034-1",
"Q8NG27-1",
"Q9BWF2-1",
"O94941-1",
"P63146-1",
"Q5GLZ8-1",
"Q5U5R9-1",
"Q8IVU3-1",
"Q9ULT8-1",
"Q7Z6J0-1",
"Q9H9P5-4",
"Q8IWV7-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983140",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983140"
}
]
},
{
"id": "R-HSA-983152",
"name": "Transfer of ubiquitin from E1 to E2",
"equation": "",
"summary": "Activated ubiquitin is transferred from E1 to the active site cystine of ubiquitin conjugating enzymes (E2s) via a trans-esterification reaction. E2s catalyze covalent attachment of ubiquitin to target proteins. They all share an active-site ubiquitin-binding cysteine residue and are distinguished by the presence of a ubiquitin-conjugating catalytic (UBC) fold required for binding of distinct ubiquitin ligases or E3s. Once conjugated to ubiquitin, the E2 molecule binds one of several E3s (Glickman et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"A0AVT1-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9Y2X8-1",
"P49427-1",
"P61081-1",
"P22314-1",
"Q5VVX9-1",
"Q16763-1",
"P60604-1",
"Q712K3-1",
"O14933-1",
"P68036-1",
"Q96LR5-1",
"P49459-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"P51965-1",
"P61088-1",
"P62837-1",
"P62253-1",
"Q9Y385-1",
"P61086-1",
"Q8TBC4-1",
"P41226-1",
"P62256-1",
"Q96B02-1",
"P63146-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983152",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983152"
}
]
},
{
"id": "R-HSA-983156",
"name": "Polyubiquitination of substrate",
"equation": "",
"summary": "Monoubiquitinated substrate acquires additional ubiquitin modifications in the form of multiple single attachments or a ubiquitin chain. Polyubiquitin chains added through K48 residue of ubiquitin typically targets the substrate for degradation (Raymond et al. 2009).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BYM8-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9UHC7-1",
"Q96PU5-1",
"Q9Y2X8-1",
"Q9Y4L5-1",
"Q8TDB6-1",
"Q9NQ86-1",
"O43255-1",
"Q96BH1-1",
"P49427-1",
"P61081-1",
"P62877-1",
"Q8WVD3-1",
"Q15386-1",
"Q5VVX9-1",
"Q86XS8-1",
"O94822-1",
"Q2Q1W2-1",
"O60291-1",
"Q5U5Q3-1",
"Q96AX9-1",
"Q96F44-1",
"Q9NVW2-1",
"O94874-1",
"Q7Z3V4-1",
"Q8IUQ4-1",
"Q13049-1",
"Q9UNE7-1",
"Q16763-1",
"Q86Y13-1",
"Q8TBB1-1",
"Q8WV44-1",
"Q96PM5-1",
"Q9C026-1",
"O60260-1",
"Q9UBS8-1",
"Q9Y252-1",
"P60604-1",
"Q712K3-1",
"Q969K3-1",
"O15033-1",
"O94972-1",
"Q86WT6-1",
"Q9H4P4-1",
"Q13191-1",
"Q14669-1",
"Q7Z6Z7-1",
"O14933-1",
"O95376-1",
"P68036-1",
"Q96LR5-1",
"Q7Z419-1",
"Q96J02-1",
"Q9BV68-1",
"Q969Q1-1",
"Q9H0M0-1",
"Q9HAU4-1",
"Q9HCE7-1",
"Q5T447-1",
"Q15751-1",
"Q9UII4-1",
"Q05086-1",
"O43164-1",
"Q86XT4-1",
"P78317-1",
"P49459-1",
"Q7Z6E9-1",
"Q5VTB9-1",
"Q5XPI4-1",
"Q63HN8-3",
"Q6ZMZ0-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"Q9Y508-1",
"P51965-1",
"P61088-1",
"P62837-1",
"Q6ZNA4-1",
"P62253-1",
"Q7Z6J8-1",
"Q8IWV8-1",
"Q8ND25-1",
"Q9Y385-1",
"Q5T4S7-1",
"Q8N7E2-1",
"Q8NHG8-1",
"Q9HCM9-1",
"P19474-1",
"Q8WY64-1",
"Q9Y4B6-1",
"Q6Q0C0-1",
"Q6UWE0-1",
"Q8N6D2-1",
"Q8TC41-1",
"Q9NV58-1",
"P61086-1",
"P46934-1",
"P41226-1",
"P62256-1",
"Q14139-1",
"Q96B02-1",
"Q9C037-1",
"Q8IYU2-1",
"Q9P2P5-1",
"O95714-1",
"Q15034-1",
"Q8NG27-1",
"Q9BWF2-1",
"O94941-1",
"P63146-1",
"Q5GLZ8-1",
"Q5U5R9-1",
"Q8IVU3-1",
"Q9ULT8-1",
"Q7Z6J0-1",
"Q9H9P5-4",
"Q8IWV7-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983156",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983156"
}
]
},
{
"id": "R-HSA-983157",
"name": "Interaction of E3 with substrate and E2-Ub complex",
"equation": "",
"summary": "Ubiquitin E3 ligases confer specificity to ubiquitination by recognizing target substrates and mediating transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to substrate (Raymond et al. 2009). E3 ligases includes a large, diverse set of proteins characterized by several defining motifs which include a HECT (homologous to E6-associated C-terminus), RING (Really Interesting New Gene) and U-box domains. The E3 ligases can be multisubunit complexes rather than a single polypeptide. Presently three different kinds of E3 complexes have been described called SCF, APC, and VHL. E3 ligases binds to both substrate and an E2 thioesterified with ubiquitin (E2-Ub).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BYM8-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9UHC7-1",
"Q96PU5-1",
"Q9Y2X8-1",
"Q9Y4L5-1",
"Q8TDB6-1",
"Q9NQ86-1",
"O43255-1",
"Q96BH1-1",
"P49427-1",
"P61081-1",
"P62877-1",
"Q8WVD3-1",
"Q15386-1",
"Q5VVX9-1",
"Q86XS8-1",
"O94822-1",
"Q2Q1W2-1",
"O60291-1",
"Q5U5Q3-1",
"Q96AX9-1",
"Q96F44-1",
"Q9NVW2-1",
"O94874-1",
"Q7Z3V4-1",
"Q8IUQ4-1",
"Q13049-1",
"Q9UNE7-1",
"Q16763-1",
"Q86Y13-1",
"Q8TBB1-1",
"Q8WV44-1",
"Q96PM5-1",
"Q9C026-1",
"O60260-1",
"Q9UBS8-1",
"Q9Y252-1",
"P60604-1",
"Q712K3-1",
"Q969K3-1",
"O15033-1",
"O94972-1",
"Q86WT6-1",
"Q9H4P4-1",
"Q13191-1",
"Q14669-1",
"Q7Z6Z7-1",
"O14933-1",
"O95376-1",
"P68036-1",
"Q96LR5-1",
"Q7Z419-1",
"Q96J02-1",
"Q9BV68-1",
"Q969Q1-1",
"Q9H0M0-1",
"Q9HAU4-1",
"Q9HCE7-1",
"Q5T447-1",
"Q15751-1",
"Q9UII4-1",
"Q05086-1",
"O43164-1",
"Q86XT4-1",
"P78317-1",
"P49459-1",
"Q7Z6E9-1",
"Q5VTB9-1",
"Q5XPI4-1",
"Q63HN8-3",
"Q6ZMZ0-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"Q9Y508-1",
"P51965-1",
"P61088-1",
"P62837-1",
"Q6ZNA4-1",
"P62253-1",
"Q7Z6J8-1",
"Q8IWV8-1",
"Q8ND25-1",
"Q9Y385-1",
"Q5T4S7-1",
"Q8N7E2-1",
"Q8NHG8-1",
"Q9HCM9-1",
"P19474-1",
"Q8WY64-1",
"Q9Y4B6-1",
"Q6Q0C0-1",
"Q6UWE0-1",
"Q8N6D2-1",
"Q8TC41-1",
"Q9NV58-1",
"P61086-1",
"P46934-1",
"P41226-1",
"P62256-1",
"Q14139-1",
"Q96B02-1",
"Q9C037-1",
"Q8IYU2-1",
"Q9P2P5-1",
"O95714-1",
"Q15034-1",
"Q8NG27-1",
"Q9BWF2-1",
"O94941-1",
"P63146-1",
"Q5GLZ8-1",
"Q5U5R9-1",
"Q8IVU3-1",
"Q9ULT8-1",
"Q7Z6J0-1",
"Q9H9P5-4",
"Q8IWV7-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983157",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983157"
}
]
},
{
"id": "R-HSA-9833973",
"name": "ISGylation of PKR",
"equation": "",
"summary": "PKR (EIF2AK2) is modified by ISG15 ligase complex on lysine residues 69 and 159, which activates PKR by dimerization and autophosphorylation, leading to down-regulation of protein translation without the necessity of RNA binding to PKR (Okomura et al, 2013).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-HSA-168699"
],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1",
"P19525-1"
],
"evidence": [
{
"id": "R-HSA-9833973",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833973"
}
]
},
{
"id": "R-HSA-9837231",
"name": "ISGylation of BECN1",
"equation": "",
"summary": "Beclin-1 (BECN1) is an activator of autophagy. Its activity is decreased by ISGylation of two residues, triggered by interferon-beta. Human respiratory syncytial virus (hRSV) NS2 protein inhibits BECN1 ISGylation to activate autophagy pathways during hRSV infection (Chiok et al, 2022).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-HSA-1632841"
],
"output_participant_list": [],
"enzyme_list": [
"Q9Y4X5-1",
"O14933-1",
"Q9UII4-1",
"Q14258-1"
],
"evidence": [
{
"id": "R-HSA-9837231",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9837231"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-HSA-1169375",
"participant_name": "PPM1B [cytosol]",
"crossref": [
{
"id": "O75688",
"database": "UniProt",
"url": ""
},
{
"id": "HMDBP08793",
"database": "HMDB Protein",
"url": ""
},
{
"id": "NP_001028729.1",
"database": "RefSeq",
"url": ""
},
{
"id": "O75688",
"database": "GeneCards",
"url": ""
},
{
"id": "PPM1B_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "O75688",
"database": "ZINC target",
"url": ""
},
{
"id": "PPM1B_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "19496",
"database": "Orphanet",
"url": ""
},
{
"id": "NP_808908.1",
"database": "RefSeq",
"url": ""
},
{
"id": "PPM1B_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENST00000282412",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_808907.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000387287",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000367813",
"database": "Ensembl",
"url": ""
},
{
"id": "O75688",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENST00000409432",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000138032",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSG00000138032-PPM1B",
"database": "HPA",
"url": ""
},
{
"id": "2P8E",
"database": "PDB",
"url": ""
},
{
"id": "PPM1B_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "NP_002697.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000282412",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000138032",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000345249",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000326089",
"database": "Ensembl",
"url": ""
},
{
"id": "PPM1B_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENST00000378551",
"database": "Ensembl",
"url": ""
},
{
"id": "O75688",
"database": "PRO",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1632841",
"participant_name": "BECN1 [cytosol]",
"crossref": [
{
"id": "Q14457",
"database": "UniProt",
"url": ""
},
{
"id": "6DCN",
"database": "PDB",
"url": ""
},
{
"id": "2P1L",
"database": "PDB",
"url": ""
},
{
"id": "6DCO",
"database": "PDB",
"url": ""
},
{
"id": "Q14457",
"database": "PRO",
"url": ""
},
{
"id": "2PON",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000126581",
"database": "Ensembl",
"url": ""
},
{
"id": "5VAU",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000355231",
"database": "Ensembl",
"url": ""
},
{
"id": "8SOR",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000465364",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000590099",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000361523",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_003757.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000126581-BECN1",
"database": "HPA",
"url": ""
},
{
"id": "ENSG00000126581",
"database": "OpenTargets",
"url": ""
},
{
"id": "5VAX",
"database": "PDB",
"url": ""
},
{
"id": "8SRQ",
"database": "PDB",
"url": ""
},
{
"id": "5VAY",
"database": "PDB",
"url": ""
},
{
"id": "4MI8",
"database": "PDB",
"url": ""
},
{
"id": "Q14457",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "5EFM",
"database": "PDB",
"url": ""
},
{
"id": "6HOK",
"database": "PDB",
"url": ""
},
{
"id": "NP_001300928.1",
"database": "RefSeq",
"url": ""
},
{
"id": "7BL1",
"database": "PDB",
"url": ""
},
{
"id": "NP_001300929.1",
"database": "RefSeq",
"url": ""
},
{
"id": "5HHE",
"database": "PDB",
"url": ""
},
{
"id": "3DVU",
"database": "PDB",
"url": ""
},
{
"id": "4DDP",
"database": "PDB",
"url": ""
},
{
"id": "6HOI",
"database": "PDB",
"url": ""
},
{
"id": "NP_001300927.1",
"database": "RefSeq",
"url": ""
},
{
"id": "6HOJ",
"database": "PDB",
"url": ""
},
{
"id": "Q14457",
"database": "GeneCards",
"url": ""
}
]
},
{
"participant_id": "R-HSA-168699",
"participant_name": "EIF2AK2 [cytosol]",
"crossref": [
{
"id": "P19525",
"database": "UniProt",
"url": ""
},
{
"id": "P19525",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "8BI7",
"database": "PDB",
"url": ""
},
{
"id": "7OBL",
"database": "PDB",
"url": ""
},
{
"id": "7OBK",
"database": "PDB",
"url": ""
},
{
"id": "2A19",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000647926",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000681507",
"database": "Ensembl",
"url": ""
},
{
"id": "XP_011531289.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000405334",
"database": "Ensembl",
"url": ""
},
{
"id": "6D3K",
"database": "PDB",
"url": ""
},
{
"id": "P19525",
"database": "ZINC target",
"url": ""
},
{
"id": "ENSG00000055332",
"database": "Ensembl",
"url": ""
},
{
"id": "6D3L",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000378559",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000055332",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENST00000395127",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000679507",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000233057",
"database": "Ensembl",
"url": ""
},
{
"id": "2.7.10.2",
"database": "IntEnz",
"url": ""
},
{
"id": "P19525",
"database": "PRO",
"url": ""
},
{
"id": "2A1A",
"database": "PDB",
"url": ""
},
{
"id": "NP_001129124.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2016",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "3UIU",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000233057",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_002750.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000385014",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000505138",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000681463",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP08840",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSP00000506024",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000497534",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000055332-EIF2AK2",
"database": "HPA",
"url": ""
},
{
"id": "ENSP00000505772",
"database": "Ensembl",
"url": ""
},
{
"id": "8I9J",
"database": "PDB",
"url": ""
},
{
"id": "1QU6",
"database": "PDB",
"url": ""
},
{
"id": "P19525",
"database": "GeneCards",
"url": ""
},
{
"id": "NP_001129123.1",
"database": "RefSeq",
"url": ""
}
]
},
{
"participant_id": "R-HSA-354163",
"participant_name": "FLNB [cytosol]",
"crossref": [
{
"id": "O75369",
"database": "UniProt",
"url": ""
},
{
"id": "16059",
"database": "Orphanet",
"url": ""
},
{
"id": "2EEA",
"database": "PDB",
"url": ""
},
{
"id": "NP_001448.2",
"database": "RefSeq",
"url": ""
},
{
"id": "2WA6",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000136068",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_001157791.1",
"database": "RefSeq",
"url": ""
},
{
"id": "5DCP",
"database": "PDB",
"url": ""
},
{
"id": "2DI9",
"database": "PDB",
"url": ""
},
{
"id": "2DMC",
"database": "PDB",
"url": ""
},
{
"id": "2DLG",
"database": "PDB",
"url": ""
},
{
"id": "2DI8",
"database": "PDB",
"url": ""
},
{
"id": "2DMB",
"database": "PDB",
"url": ""
},
{
"id": "2WA5",
"database": "PDB",
"url": ""
},
{
"id": "NP_001157789.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4B7L",
"database": "PDB",
"url": ""
},
{
"id": "NP_001157790.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2EE9",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000429972",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000490882",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000415599",
"database": "Ensembl",
"url": ""
},
{
"id": "O75369",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000136068",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000351339",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000295956",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000295956",
"database": "Ensembl",
"url": ""
},
{
"id": "2DJ4",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000420213",
"database": "Ensembl",
"url": ""
},
{
"id": "3FER",
"database": "PDB",
"url": ""
},
{
"id": "2EE6",
"database": "PDB",
"url": ""
},
{
"id": "2EED",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000358537",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000136068-FLNB",
"database": "HPA",
"url": ""
},
{
"id": "2E9I",
"database": "PDB",
"url": ""
},
{
"id": "2DIC",
"database": "PDB",
"url": ""
},
{
"id": "2DIA",
"database": "PDB",
"url": ""
},
{
"id": "2DIB",
"database": "PDB",
"url": ""
},
{
"id": "O75369",
"database": "GeneCards",
"url": ""
},
{
"id": "2EEB",
"database": "PDB",
"url": ""
},
{
"id": "2WA7",
"database": "PDB",
"url": ""
},
{
"id": "2E9J",
"database": "PDB",
"url": ""
},
{
"id": "2EEC",
"database": "PDB",
"url": ""
},
{
"id": "O75369",
"database": "PRO",
"url": ""
}
]
},
{
"participant_id": "R-HSA-936014",
"participant_name": "UBE2L6 [cytosol]",
"crossref": [
{
"id": "ENST00000287156",
"database": "Ensembl",
"url": ""
},
{
"id": "O14933",
"database": "UniProt",
"url": ""
},
{
"id": "O14933",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000156587",
"database": "OpenTargets",
"url": ""
},
{
"id": "O14933",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENST00000340573",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP00564",
"database": "HMDB Protein",
"url": ""
},
{
"id": "O14933",
"database": "GeneCards",
"url": ""
},
{
"id": "NP_937826.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000341980",
"database": "Ensembl",
"url": ""
},
{
"id": "1WZW",
"database": "PDB",
"url": ""
},
{
"id": "2KJH",
"database": "PDB",
"url": ""
},
{
"id": "NP_004214.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000156587-UBE2L6",
"database": "HPA",
"url": ""
},
{
"id": "ENSP00000287156",
"database": "Ensembl",
"url": ""
},
{
"id": "1WZV",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000156587",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-936550",
"participant_name": "UBA7 [cytosol]",
"crossref": [
{
"id": "P41226",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "HMDBP09311",
"database": "HMDB Protein",
"url": ""
},
{
"id": "P41226",
"database": "GeneCards",
"url": ""
},
{
"id": "UBA7_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENST00000333486",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000333266",
"database": "Ensembl",
"url": ""
},
{
"id": "P41226",
"database": "ZINC target",
"url": ""
},
{
"id": "P41226",
"database": "UniProt",
"url": ""
},
{
"id": "NP_003326.2",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000182179",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSG00000182179",
"database": "Ensembl",
"url": ""
},
{
"id": "UBA7_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "ENSG00000182179-UBA7",
"database": "HPA",
"url": ""
},
{
"id": "P41226",
"database": "PRO",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0AVT1",
"gene_name": "UBA6",
"activity": [
{
"ec_number": "6.2.1.45",
"activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.",
"evidence": [
{
"id": "A0AVT1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0AVT1"
}
]
},
{
"ec_number": "6.2.1.45",
"activity": "",
"evidence": [
{
"id": "A0AVT1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0AVT1"
}
]
}
]
},
{
"uniprot_ac": "O00762",
"gene_name": "UBE2C",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O00762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00762"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "O00762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00762"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "O00762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00762"
}
]
}
]
},
{
"uniprot_ac": "O14933",
"gene_name": "UBE2L6",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "O14933",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14933"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "O14933",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14933"
}
]
}
]
},
{
"uniprot_ac": "O15033",
"gene_name": "AREL1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O15033",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15033"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "O15033",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15033"
}
]
}
]
},
{
"uniprot_ac": "O43164",
"gene_name": "PJA2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O43164",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43164"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O43164",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43164"
}
]
}
]
},
{
"uniprot_ac": "O43255",
"gene_name": "SIAH2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O43255",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43255"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O43255",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43255"
}
]
}
]
},
{
"uniprot_ac": "O60260",
"gene_name": "PRKN",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "O60260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60260"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "O60260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60260"
}
]
},
{
"ec_number": "6.3.2.19",
"activity": "",
"evidence": [
{
"id": "O60260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60260"
}
]
}
]
},
{
"uniprot_ac": "O60291",
"gene_name": "MGRN1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O60291",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60291"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O60291",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60291"
}
]
}
]
},
{
"uniprot_ac": "O75688",
"gene_name": "PPM1B",
"activity": [
{
"ec_number": "3.1.3.16",
"activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.",
"evidence": [
{
"id": "O75688",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75688"
}
]
},
{
"ec_number": "3.1.3.16",
"activity": "",
"evidence": [
{
"id": "O75688",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75688"
}
]
}
]
},
{
"uniprot_ac": "O94822",
"gene_name": "LTN1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O94822",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94822"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O94822",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94822"
}
]
}
]
},
{
"uniprot_ac": "O94874",
"gene_name": "UFL1",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "O94874",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94874"
}
]
}
]
},
{
"uniprot_ac": "O94941",
"gene_name": "UBOX5",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O94941",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94941"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O94941",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94941"
}
]
}
]
},
{
"uniprot_ac": "O94972",
"gene_name": "TRIM37",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O94972",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94972"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O94972",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94972"
}
]
}
]
},
{
"uniprot_ac": "O95376",
"gene_name": "ARIH2",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "O95376",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95376"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "O95376",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95376"
}
]
}
]
},
{
"uniprot_ac": "O95714",
"gene_name": "HERC2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O95714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95714"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "O95714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95714"
}
]
}
]
},
{
"uniprot_ac": "O95786",
"gene_name": "RIGI",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "O95786",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95786"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "O95786",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95786"
}
]
}
]
},
{
"uniprot_ac": "P19174",
"gene_name": "PLCG1",
"activity": [
{
"ec_number": "3.1.4.11",
"activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).",
"evidence": [
{
"id": "P19174",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19174"
}
]
},
{
"ec_number": "3.1.4.11",
"activity": "",
"evidence": [
{
"id": "P19174",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19174"
}
]
}
]
},
{
"uniprot_ac": "P19474",
"gene_name": "TRIM21",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P19474",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19474"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P19474",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19474"
}
]
}
]
},
{
"uniprot_ac": "P19525",
"gene_name": "EIF2AK2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P19525",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19525"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P19525",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19525"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "P19525",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19525"
}
]
}
]
},
{
"uniprot_ac": "P22314",
"gene_name": "UBA1",
"activity": [
{
"ec_number": "6.2.1.45",
"activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P22314",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22314"
}
]
},
{
"ec_number": "6.2.1.45",
"activity": "",
"evidence": [
{
"id": "P22314",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22314"
}
]
}
]
},
{
"uniprot_ac": "P23458",
"gene_name": "JAK1",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P23458",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23458"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P23458",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23458"
}
]
}
]
},
{
"uniprot_ac": "P27361",
"gene_name": "MAPK3",
"activity": [
{
"ec_number": "2.7.11.24",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P27361",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P27361"
}
]
},
{
"ec_number": "2.7.11.24",
"activity": "",
"evidence": [
{
"id": "P27361",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P27361"
}
]
}
]
},
{
"uniprot_ac": "P38919",
"gene_name": "EIF4A3",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P38919",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P38919"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "P38919",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P38919"
}
]
}
]
},
{
"uniprot_ac": "P41226",
"gene_name": "UBA7",
"activity": [
{
"ec_number": "6.2.1.-",
"activity": "",
"evidence": [
{
"id": "P41226",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41226"
}
]
}
]
},
{
"uniprot_ac": "P46934",
"gene_name": "NEDD4",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P46934",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46934"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "P46934",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46934"
}
]
}
]
},
{
"uniprot_ac": "P49427",
"gene_name": "CDC34",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P49427",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49427"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P49427",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49427"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P49427",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49427"
}
]
}
]
},
{
"uniprot_ac": "P49459",
"gene_name": "UBE2A",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P49459",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49459"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P49459",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49459"
}
]
}
]
},
{
"uniprot_ac": "P51668",
"gene_name": "UBE2D1",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P51668",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51668"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P51668",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51668"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P51668",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51668"
}
]
}
]
},
{
"uniprot_ac": "P51965",
"gene_name": "UBE2E1",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P51965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51965"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P51965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51965"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P51965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51965"
}
]
}
]
},
{
"uniprot_ac": "P60604",
"gene_name": "UBE2G2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P60604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60604"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P60604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60604"
}
]
}
]
},
{
"uniprot_ac": "P60842",
"gene_name": "EIF4A1",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P60842",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60842"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "P60842",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60842"
}
]
}
]
},
{
"uniprot_ac": "P61077",
"gene_name": "UBE2D3",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
},
{
"ec_number": "2.3.2.24",
"activity": "",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
}
]
},
{
"uniprot_ac": "P61081",
"gene_name": "UBE2M",
"activity": [
{
"ec_number": "2.3.2.34",
"activity": "[E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine + [E2 NEDD8-conjugating enzyme]-L-cysteine = [E1 NEDD8-activating enzyme]-L-cysteine + [E2 NEDD8-conjugating enzyme]-S-[NEDD8-protein]-yl-L-cysteine.",
"evidence": [
{
"id": "P61081",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61081"
}
]
},
{
"ec_number": "2.3.2.34",
"activity": "",
"evidence": [
{
"id": "P61081",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61081"
}
]
}
]
},
{
"uniprot_ac": "P61086",
"gene_name": "UBE2K",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P61086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61086"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P61086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61086"
}
]
}
]
},
{
"uniprot_ac": "P61088",
"gene_name": "UBE2N",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P61088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61088"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P61088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61088"
}
]
}
]
},
{
"uniprot_ac": "P62253",
"gene_name": "UBE2G1",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P62253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62253"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P62253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62253"
}
]
}
]
},
{
"uniprot_ac": "P62256",
"gene_name": "UBE2H",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P62256",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62256"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P62256",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62256"
}
]
},
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P62256",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62256"
}
]
}
]
},
{
"uniprot_ac": "P62837",
"gene_name": "UBE2D2",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P62837",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62837"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P62837",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62837"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P62837",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62837"
}
]
}
]
},
{
"uniprot_ac": "P62877",
"gene_name": "RBX1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
},
{
"ec_number": "2.3.2.32",
"activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
},
{
"ec_number": "2.3.2.32",
"activity": "",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
}
]
},
{
"uniprot_ac": "P63146",
"gene_name": "UBE2B",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P63146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63146"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P63146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63146"
}
]
}
]
},
{
"uniprot_ac": "P68036",
"gene_name": "UBE2L3",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P68036",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68036"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P68036",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68036"
}
]
}
]
},
{
"uniprot_ac": "P78317",
"gene_name": "RNF4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P78317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78317"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P78317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78317"
}
]
}
]
},
{
"uniprot_ac": "Q05086",
"gene_name": "UBE3A",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q05086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05086"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q05086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05086"
}
]
}
]
},
{
"uniprot_ac": "Q13049",
"gene_name": "TRIM32",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q13049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13049"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q13049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13049"
}
]
}
]
},
{
"uniprot_ac": "Q13191",
"gene_name": "CBLB",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q13191",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13191"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q13191",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13191"
}
]
}
]
},
{
"uniprot_ac": "Q14139",
"gene_name": "UBE4A",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q14139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14139"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q14139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14139"
}
]
}
]
},
{
"uniprot_ac": "Q14240",
"gene_name": "EIF4A2",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q14240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14240"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "Q14240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14240"
}
]
}
]
},
{
"uniprot_ac": "Q14258",
"gene_name": "TRIM25",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q14258",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14258"
}
]
},
{
"ec_number": "6.3.2.n3",
"activity": "ATP + [ISG15] + [protein]-lysine = AMP + diphosphate + [protein]-N-ISGyllysine.",
"evidence": [
{
"id": "Q14258",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14258"
}
]
},
{
"ec_number": "6.3.2.n3",
"activity": "",
"evidence": [
{
"id": "Q14258",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14258"
}
]
}
]
},
{
"uniprot_ac": "Q14669",
"gene_name": "TRIP12",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q14669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14669"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q14669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14669"
}
]
}
]
},
{
"uniprot_ac": "Q15034",
"gene_name": "HERC3",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q15034",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15034"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q15034",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15034"
}
]
}
]
},
{
"uniprot_ac": "Q15386",
"gene_name": "UBE3C",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q15386",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15386"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q15386",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15386"
}
]
}
]
},
{
"uniprot_ac": "Q15751",
"gene_name": "HERC1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q15751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15751"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q15751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15751"
}
]
}
]
},
{
"uniprot_ac": "Q16763",
"gene_name": "UBE2S",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q16763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16763"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q16763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16763"
}
]
}
]
},
{
"uniprot_ac": "Q2Q1W2",
"gene_name": "TRIM71",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q2Q1W2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q2Q1W2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q2Q1W2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q2Q1W2"
}
]
}
]
},
{
"uniprot_ac": "Q5GLZ8",
"gene_name": "HERC4",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5GLZ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5GLZ8"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q5GLZ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5GLZ8"
}
]
}
]
},
{
"uniprot_ac": "Q5T447",
"gene_name": "HECTD3",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5T447",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T447"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q5T447",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T447"
}
]
}
]
},
{
"uniprot_ac": "Q5T4S7",
"gene_name": "UBR4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5T4S7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T4S7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5T4S7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T4S7"
}
]
}
]
},
{
"uniprot_ac": "Q5U5Q3",
"gene_name": "MEX3C",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5U5Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5Q3"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5U5Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5Q3"
}
]
}
]
},
{
"uniprot_ac": "Q5U5R9",
"gene_name": "HECTD2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5U5R9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5R9"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q5U5R9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5R9"
}
]
}
]
},
{
"uniprot_ac": "Q5VTB9",
"gene_name": "RNF220",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5VTB9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VTB9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5VTB9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VTB9"
}
]
}
]
},
{
"uniprot_ac": "Q5VVX9",
"gene_name": "UBE2U",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q5VVX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VVX9"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q5VVX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VVX9"
}
]
}
]
},
{
"uniprot_ac": "Q5XPI4",
"gene_name": "RNF123",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5XPI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5XPI4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5XPI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5XPI4"
}
]
}
]
},
{
"uniprot_ac": "Q63HN8",
"gene_name": "RNF213",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
},
{
"ec_number": "3.6.4.-",
"activity": "",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
}
]
},
{
"uniprot_ac": "Q6Q0C0",
"gene_name": "TRAF7",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q6Q0C0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6Q0C0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q6Q0C0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6Q0C0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q6Q0C0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6Q0C0"
}
]
}
]
},
{
"uniprot_ac": "Q6UWE0",
"gene_name": "LRSAM1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q6UWE0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6UWE0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q6UWE0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6UWE0"
}
]
}
]
},
{
"uniprot_ac": "Q6ZMZ0",
"gene_name": "RNF19B",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q6ZMZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZMZ0"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q6ZMZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZMZ0"
}
]
}
]
},
{
"uniprot_ac": "Q6ZNA4",
"gene_name": "RNF111",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q6ZNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZNA4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q6ZNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZNA4"
}
]
}
]
},
{
"uniprot_ac": "Q712K3",
"gene_name": "UBE2R2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q712K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q712K3"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q712K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q712K3"
}
]
}
]
},
{
"uniprot_ac": "Q7Z3V4",
"gene_name": "UBE3B",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z3V4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z3V4"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z3V4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z3V4"
}
]
}
]
},
{
"uniprot_ac": "Q7Z419",
"gene_name": "RNF144B",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q7Z419",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z419"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q7Z419",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z419"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6E9",
"gene_name": "RBBP6",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6E9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6E9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q7Z6E9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6E9"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6J0",
"gene_name": "SH3RF1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q7Z6J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J0"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6J8",
"gene_name": "UBE3D",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6J8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J8"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z6J8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J8"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6Z7",
"gene_name": "HUWE1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6Z7"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6Z7"
}
]
}
]
},
{
"uniprot_ac": "Q7Z7E8",
"gene_name": "UBE2Q1",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q7Z7E8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z7E8"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q7Z7E8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z7E8"
}
]
}
]
},
{
"uniprot_ac": "Q86WT6",
"gene_name": "TRIM69",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86WT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86WT6"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86WT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86WT6"
}
]
}
]
},
{
"uniprot_ac": "Q86XS8",
"gene_name": "RNF130",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86XS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XS8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86XS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XS8"
}
]
}
]
},
{
"uniprot_ac": "Q86XT4",
"gene_name": "TRIM50",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86XT4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XT4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86XT4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XT4"
}
]
}
]
},
{
"uniprot_ac": "Q86Y13",
"gene_name": "DZIP3",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86Y13",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86Y13"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86Y13",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86Y13"
}
]
}
]
},
{
"uniprot_ac": "Q8IUQ4",
"gene_name": "SIAH1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IUQ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IUQ4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8IUQ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IUQ4"
}
]
}
]
},
{
"uniprot_ac": "Q8IVU3",
"gene_name": "HERC6",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IVU3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IVU3"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q8IVU3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IVU3"
}
]
}
]
},
{
"uniprot_ac": "Q8IWV7",
"gene_name": "UBR1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IWV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8IWV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV7"
}
]
}
]
},
{
"uniprot_ac": "Q8IWV8",
"gene_name": "UBR2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IWV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8IWV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV8"
}
]
}
]
},
{
"uniprot_ac": "Q8IYU2",
"gene_name": "HACE1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IYU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IYU2"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q8IYU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IYU2"
}
]
}
]
},
{
"uniprot_ac": "Q8N2K1",
"gene_name": "UBE2J2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q8N2K1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N2K1"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q8N2K1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N2K1"
}
]
}
]
},
{
"uniprot_ac": "Q8N6D2",
"gene_name": "RNF182",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8N6D2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N6D2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8N6D2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N6D2"
}
]
}
]
},
{
"uniprot_ac": "Q8N7E2",
"gene_name": "CBLL2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8N7E2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N7E2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8N7E2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N7E2"
}
]
}
]
},
{
"uniprot_ac": "Q8ND25",
"gene_name": "ZNRF1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8ND25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8ND25"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8ND25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8ND25"
}
]
}
]
},
{
"uniprot_ac": "Q8NG27",
"gene_name": "PJA1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8NG27",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NG27"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8NG27",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NG27"
}
]
}
]
},
{
"uniprot_ac": "Q8NHG8",
"gene_name": "ZNRF2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8NHG8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NHG8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8NHG8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NHG8"
}
]
}
]
},
{
"uniprot_ac": "Q8TBB1",
"gene_name": "LNX1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8TBB1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBB1"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8TBB1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBB1"
}
]
}
]
},
{
"uniprot_ac": "Q8TBC4",
"gene_name": "UBA3",
"activity": [
{
"ec_number": "6.2.1.64",
"activity": "ATP + [NEDD8 protein] + [E1 NEDD8-activating enzyme]-L-cysteine = AMP + diphosphate + [E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine.",
"evidence": [
{
"id": "Q8TBC4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBC4"
}
]
},
{
"ec_number": "6.2.1.64",
"activity": "",
"evidence": [
{
"id": "Q8TBC4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBC4"
}
]
}
]
},
{
"uniprot_ac": "Q8TC41",
"gene_name": "RNF217",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q8TC41",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TC41"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q8TC41",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TC41"
}
]
}
]
},
{
"uniprot_ac": "Q8TDB6",
"gene_name": "DTX3L",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8TDB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TDB6"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8TDB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TDB6"
}
]
}
]
},
{
"uniprot_ac": "Q8WV44",
"gene_name": "TRIM41",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8WV44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WV44"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8WV44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WV44"
}
]
}
]
},
{
"uniprot_ac": "Q8WVD3",
"gene_name": "RNF138",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8WVD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVD3"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8WVD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVD3"
}
]
}
]
},
{
"uniprot_ac": "Q8WVN8",
"gene_name": "UBE2Q2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q8WVN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVN8"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q8WVN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVN8"
}
]
}
]
},
{
"uniprot_ac": "Q8WY64",
"gene_name": "MYLIP",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8WY64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WY64"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8WY64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WY64"
}
]
}
]
},
{
"uniprot_ac": "Q969K3",
"gene_name": "RNF34",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q969K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969K3"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q969K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969K3"
}
]
}
]
},
{
"uniprot_ac": "Q969M7",
"gene_name": "UBE2F",
"activity": [
{
"ec_number": "2.3.2.32",
"activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.",
"evidence": [
{
"id": "Q969M7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969M7"
}
]
},
{
"ec_number": "2.3.2.32",
"activity": "",
"evidence": [
{
"id": "Q969M7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969M7"
}
]
}
]
},
{
"uniprot_ac": "Q969Q1",
"gene_name": "TRIM63",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q969Q1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969Q1"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q969Q1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969Q1"
}
]
}
]
},
{
"uniprot_ac": "Q969T4",
"gene_name": "UBE2E3",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q969T4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969T4"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q969T4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969T4"
}
]
}
]
},
{
"uniprot_ac": "Q96AX9",
"gene_name": "MIB2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96AX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AX9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96AX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AX9"
}
]
}
]
},
{
"uniprot_ac": "Q96B02",
"gene_name": "UBE2W",
"activity": [
{
"ec_number": "2.3.2.25",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-N-terminal-amino acid = [E1 ubiquitin-activating enzyme]-L-cysteine + N-terminal-ubiquitinyl-[acceptor protein].",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
},
{
"ec_number": "2.3.2.25",
"activity": "",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
}
]
},
{
"uniprot_ac": "Q96BH1",
"gene_name": "RNF25",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96BH1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96BH1"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96BH1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96BH1"
}
]
}
]
},
{
"uniprot_ac": "Q96C10",
"gene_name": "DHX58",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q96C10",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96C10"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "Q96C10",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96C10"
}
]
}
]
},
{
"uniprot_ac": "Q96EQ8",
"gene_name": "RNF125",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96EQ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96EQ8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96EQ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96EQ8"
}
]
}
]
},
{
"uniprot_ac": "Q96F44",
"gene_name": "TRIM11",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96F44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96F44"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96F44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96F44"
}
]
}
]
},
{
"uniprot_ac": "Q96J02",
"gene_name": "ITCH",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96J02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96J02"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q96J02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96J02"
}
]
}
]
},
{
"uniprot_ac": "Q96LR5",
"gene_name": "UBE2E2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q96LR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96LR5"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q96LR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96LR5"
}
]
}
]
},
{
"uniprot_ac": "Q96PM5",
"gene_name": "RCHY1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96PM5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PM5"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96PM5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PM5"
}
]
}
]
},
{
"uniprot_ac": "Q96PU5",
"gene_name": "NEDD4L",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
},
{
"ec_number": "2.3.2.36",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
},
{
"ec_number": "2.3.2.36",
"activity": "",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
}
]
},
{
"uniprot_ac": "Q9BV68",
"gene_name": "RNF126",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9BV68",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BV68"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9BV68",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BV68"
}
]
}
]
},
{
"uniprot_ac": "Q9BWF2",
"gene_name": "TRAIP",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9BWF2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BWF2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9BWF2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BWF2"
}
]
}
]
},
{
"uniprot_ac": "Q9BYM8",
"gene_name": "RBCK1",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9BYM8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BYM8"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9BYM8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BYM8"
}
]
}
]
},
{
"uniprot_ac": "Q9BYX4",
"gene_name": "IFIH1",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q9BYX4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BYX4"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "Q9BYX4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BYX4"
}
]
}
]
},
{
"uniprot_ac": "Q9C026",
"gene_name": "TRIM9",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9C026",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C026"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9C026",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C026"
}
]
}
]
},
{
"uniprot_ac": "Q9C037",
"gene_name": "TRIM4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9C037",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C037"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9C037",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C037"
}
]
}
]
},
{
"uniprot_ac": "Q9C0C9",
"gene_name": "UBE2O",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9C0C9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C0C9"
}
]
},
{
"ec_number": "2.3.2.24",
"activity": "",
"evidence": [
{
"id": "Q9C0C9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C0C9"
}
]
}
]
},
{
"uniprot_ac": "Q9H0M0",
"gene_name": "WWP1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9H0M0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H0M0"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9H0M0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H0M0"
}
]
}
]
},
{
"uniprot_ac": "Q9H4P4",
"gene_name": "RNF41",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9H4P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4P4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9H4P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4P4"
}
]
}
]
},
{
"uniprot_ac": "Q9H832",
"gene_name": "UBE2Z",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q9H832",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H832"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q9H832",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H832"
}
]
}
]
},
{
"uniprot_ac": "Q9H9P5",
"gene_name": "UNKL",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q9H9P5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H9P5"
}
]
}
]
},
{
"uniprot_ac": "Q9HAU4",
"gene_name": "SMURF2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9HAU4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HAU4"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9HAU4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HAU4"
}
]
}
]
},
{
"uniprot_ac": "Q9HCE7",
"gene_name": "SMURF1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9HCE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCE7"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9HCE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCE7"
}
]
}
]
},
{
"uniprot_ac": "Q9HCM9",
"gene_name": "TRIM39",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9HCM9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCM9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9HCM9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCM9"
}
]
}
]
},
{
"uniprot_ac": "Q9NQ86",
"gene_name": "TRIM36",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9NQ86",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQ86"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9NQ86",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQ86"
}
]
}
]
},
{
"uniprot_ac": "Q9NV58",
"gene_name": "RNF19A",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9NV58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NV58"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9NV58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NV58"
}
]
}
]
},
{
"uniprot_ac": "Q9NVW2",
"gene_name": "RLIM",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9NVW2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NVW2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9NVW2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NVW2"
}
]
}
]
},
{
"uniprot_ac": "Q9P2P5",
"gene_name": "HECW2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9P2P5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P2P5"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9P2P5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P2P5"
}
]
}
]
},
{
"uniprot_ac": "Q9UBS8",
"gene_name": "RNF14",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9UBS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBS8"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9UBS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBS8"
}
]
}
]
},
{
"uniprot_ac": "Q9UBT6",
"gene_name": "POLK",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9UBT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBT6"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9UBT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBT6"
}
]
}
]
},
{
"uniprot_ac": "Q9UBZ9",
"gene_name": "REV1",
"activity": [
{
"ec_number": "2.7.7.-",
"activity": "",
"evidence": [
{
"id": "Q9UBZ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBZ9"
}
]
}
]
},
{
"uniprot_ac": "Q9UHC7",
"gene_name": "MKRN1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9UHC7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UHC7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9UHC7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UHC7"
}
]
}
]
},
{
"uniprot_ac": "Q9UII4",
"gene_name": "HERC5",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q9UII4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UII4"
}
]
}
]
},
{
"uniprot_ac": "Q9ULT8",
"gene_name": "HECTD1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9ULT8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULT8"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9ULT8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULT8"
}
]
}
]
},
{
"uniprot_ac": "Q9UNA4",
"gene_name": "POLI",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9UNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNA4"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9UNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNA4"
}
]
}
]
},
{
"uniprot_ac": "Q9UNE7",
"gene_name": "STUB1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9UNE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNE7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9UNE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNE7"
}
]
}
]
},
{
"uniprot_ac": "Q9Y252",
"gene_name": "RNF6",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9Y252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y252"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9Y252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y252"
}
]
}
]
},
{
"uniprot_ac": "Q9Y253",
"gene_name": "POLH",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9Y253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y253"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9Y253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y253"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2X8",
"gene_name": "UBE2D4",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q9Y2X8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2X8"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q9Y2X8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2X8"
}
]
}
]
},
{
"uniprot_ac": "Q9Y385",
"gene_name": "UBE2J1",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q9Y385",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y385"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q9Y385",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y385"
}
]
}
]
},
{
"uniprot_ac": "Q9Y4B6",
"gene_name": "DCAF1",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9Y4B6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4B6"
}
]
}
]
},
{
"uniprot_ac": "Q9Y4L5",
"gene_name": "RNF115",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9Y4L5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4L5"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9Y4L5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4L5"
}
]
}
]
},
{
"uniprot_ac": "Q9Y4X5",
"gene_name": "ARIH1",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9Y4X5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4X5"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9Y4X5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4X5"
}
]
}
]
},
{
"uniprot_ac": "Q9Y508",
"gene_name": "RNF114",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9Y508",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y508"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9Y508",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y508"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [
133
],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": [
{
"start_pos": 24,
"end_pos": 26
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 311
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}