{ "uniprot_canonical_ac": "O14770-1", "uniprot_ac": "O14770", "uniprot_id": "MEIS2_HUMAN", "mass": { "chemical_mass": 51790.0, "monoisotopic_mass": 51790.0 }, "refseq": { "ac": "NP_001207411", "name": "homeobox protein Meis2 isoform d", "summary": "This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" }, "gene_names": [ { "name": "MEIS2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14770", "id": "O14770" }, { "name": "CPCMR; HsT18361; MRG1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411", "id": "NP_001207411" }, { "name": "MEIS2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411", "id": "NP_001207411" }, { "name": "MRG1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14770", "id": "O14770" } ], "protein_names": [ { "name": "Homeobox protein Meis2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14770" }, { "name": "Meis homolog 2; TALE homeobox protein Meis2; Meis1-related gene 1; meis1-related protein 1; Meis1, myeloid ecotropic viral integration site 1 homolog 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411", "id": "NP_001207411" }, { "name": "Meis1-related protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14770" }, { "name": "homeobox protein Meis2 isoform d", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411", "id": "NP_001207411" } ], "function": [ { "annotation": "CircDHRS3 inhibits prostate cancer cell proliferation and metastasis through the circDHRS3/miR-421/MEIS2 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" }, { "database": "PubMed", "id": "36840946", "url": "https://glygen.org/publication/PubMed/36840946" } ] }, { "annotation": "Expression of ISL1 and its partners in prostate cancer progression and neuroendocrine differentiation.", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" }, { "database": "PubMed", "id": "33864110", "url": "https://glygen.org/publication/PubMed/33864110" } ] }, { "annotation": "IGF2BP2 promotes the progression of ovarian endometriosis by regulating m6A-modified MEIS2 and GATA6.", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" }, { "database": "PubMed", "id": "36113831", "url": "https://glygen.org/publication/PubMed/36113831" } ] }, { "annotation": "Intellectual disability associated with craniofacial dysmorphism, cleft palate, and congenital heart defect due to a de novo MEIS2 mutation: A clinical longitudinal study.", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" }, { "database": "PubMed", "id": "33427397", "url": "https://glygen.org/publication/PubMed/33427397" } ] }, { "annotation": "Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform 3 is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoform 3 and isoform 4 can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription; isoform 5 cannot activate DRD1 transcription.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770#function" }, { "database": "PubMed", "id": "21746878", "url": "https://glygen.org/publication/PubMed/21746878" }, { "database": "PubMed", "id": "10764806", "url": "https://glygen.org/publication/PubMed/10764806" }, { "database": "PubMed", "id": "11279116", "url": "https://glygen.org/publication/PubMed/11279116" } ] }, { "annotation": "Meis homeobox 2 (MEIS2) inhibits the proliferation and promotes apoptosis of thyroid cancer cell and through the NF-kappaB signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" }, { "database": "PubMed", "id": "33975520", "url": "https://glygen.org/publication/PubMed/33975520" } ] }, { "annotation": "This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" } ] } ], "disease": [ { "disease_id": "DOID:0111697", "recommended_name": { "id": "DOID:0111697", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111697", "name": "cleft palate, cardiac defects, and intellectual disabillity", "description": "A syndrome characterized by a combination of congenital heart defects, variable cleft lip/palate, short stature, microcephaly, and digital anomalies that has_material_basis_in heterozygous mutation in the MEIS2 gene on chromosome 15q14." }, "synonyms": [ { "id": "DOID:0111697", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111697", "name": "CPCMR", "description": "" }, { "id": "DOID:0111697", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111697", "name": "cleft palate, cardiac defects, and mental retardation", "description": "" }, { "id": "DOID:0111697", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111697", "name": "cardiac malformation, cleft lip/palate, microcephaly, and digital anomalies", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "cardiac malformation, cleft lip/palate, microcephaly, and digital anomalies", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "cardiac malformation, cleft lip/palate, microcephaly, and digital anomalies", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "CPCMR", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "cleft palate, CARDIAC defects, and intellectual disability", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "cleft palate, CARDIAC defects, and mental retardation", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "cleft palate, Cardiac defects, and intellectual disability", "description": "" }, { "id": "MONDO:0010970", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010970", "name": "cleft palate, Cardiac defects, and mental retardation", "description": "" }, { "id": "MIM:600987", "resource": "MIM", "url": "https://www.omim.org/entry/600987", "name": "Cleft palate, cardiac defects, and impaired intellectual development", "description": "Cleft palate, cardiac defects, and impaired intellectual development" } ], "evidence": [ { "id": "600987", "database": "MIM", "url": "https://www.omim.org/entry/600987" } ] } ], "snv": [ { "evidence": [ { "id": "O14770", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14770" } ], "glycoeffect": [], "start_pos": 55, "end_pos": 55, "subjects_tested": "57", "subjects_positive": "1", "frequency": "1.8", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.8%). In dbSNP: rs773159665.", "chr_id": "15", "chr_pos": "37098049", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A55", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 151, "end_pos": 151, "sequence_org": "I", "sequence_mut": "A", "comment": "Impairs interaction with PBX1; when associated with A-154.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "start_pos": 154, "end_pos": 154, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs interaction with PBX1; when associated with A-151.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "start_pos": 158, "end_pos": 159, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Impairs interaction with PBX1; when associated with A-161.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "start_pos": 161, "end_pos": 161, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs interaction with PBX1; when associated with 158-A-A-159.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "start_pos": 332, "end_pos": 332, "sequence_org": "R", "sequence_mut": "M", "comment": "Impairs DNA binding and PBX1-dependent transcriptional activation. No effect on interaction with PBX1.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" }, { "database": "PubMed", "id": "21746878", "url": "https://glygen.org/publication/PubMed/21746878" } ] }, { "start_pos": 85, "end_pos": 85, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs interaction with PBX1; when associated with A-88.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs interaction with PBX1; when associated with A-85. HELIX 285 297.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "start_pos": 94, "end_pos": 97, "sequence_org": "EKCE", "sequence_mut": "NNGT", "comment": "Impairs interaction with PBX1.", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" }, { "database": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "82.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "84.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "83.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "71.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "79.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "95.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "82.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14770" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "common_name": "Human" } ], "gene": [ { "name": "MEIS2", "url": "https://www.uniprot.org/uniprot/O14770", "locus": { "chromosome": "15", "start_pos": 36889204, "end_pos": 37101299, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000134138", "url": "https://www.ensembl.org/id/ENSG00000134138" } ] } } ], "crossref": [ { "id": "ENSG00000134138", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134138", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O14770", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14770", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "MEIS2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MEIS2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4212", "url": "https://www.ncbi.nlm.nih.gov/gene/4212", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7001", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7001", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14770", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14770*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008422", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008422", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032453", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032453", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4212", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4212", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "600987", "url": "http://www.omim.org/entry/600987", "database": "MIM", "categories": [ "Other" ] }, { "id": "601740", "url": "http://www.omim.org/entry/601740", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14770", "url": "https://www.nextprot.org/entry/NX_O14770", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14770", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14770", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FNDDIAC", "url": "https://omabrowser.org/oma/group/FNDDIAC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3180467at2759", "url": "http://www.orthodb.org/?query=3180467at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11850", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11850", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11850:SF47", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11850:SF47", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3K2A", "url": "https://www.rcsb.org/structure/3K2A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XRM", "url": "https://www.rcsb.org/structure/4XRM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BNG", "url": "https://www.rcsb.org/structure/5BNG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EG0", "url": "https://www.rcsb.org/structure/5EG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05920", "url": "http://pfam.xfam.org/family/PF05920", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16493", "url": "http://pfam.xfam.org/family/PF16493", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14770", "url": "https://pharos.nih.gov/targets/O14770", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14770", "url": "http://purl.obolibrary.org/obo/PR_O14770", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8V8TPB7", "url": "https://www.uniprot.org/uniprot/A0A8V8TPB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPB7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPB7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPM6", "url": "https://www.uniprot.org/uniprot/A0A8V8TPM6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPM6-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPM6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TQU6", "url": "https://www.uniprot.org/uniprot/A0A8V8TQU6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TQU6-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TQU6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9H3ZWV7", "url": "https://www.uniprot.org/uniprot/A0A9H3ZWV7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9H3ZWV7-1", "url": "https://www.uniprot.org/uniprot/A0A9H3ZWV7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKE5", "url": "https://www.uniprot.org/uniprot/H0YKE5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKE5-1", "url": "https://www.uniprot.org/uniprot/H0YKE5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKN2", "url": "https://www.uniprot.org/uniprot/H0YKN2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKN2-1", "url": "https://www.uniprot.org/uniprot/H0YKN2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM65", "url": "https://www.uniprot.org/uniprot/H0YM65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM65-1", "url": "https://www.uniprot.org/uniprot/H0YM65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-1", "url": "https://www.uniprot.org/uniprot/O14770-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-2", "url": "https://www.uniprot.org/uniprot/O14770-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-3", "url": "https://www.uniprot.org/uniprot/O14770-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-4", "url": "https://www.uniprot.org/uniprot/O14770-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-5", "url": "https://www.uniprot.org/uniprot/O14770-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-6", "url": "https://www.uniprot.org/uniprot/O14770-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-7", "url": "https://www.uniprot.org/uniprot/O14770-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14770-8", "url": "https://www.uniprot.org/uniprot/O14770-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQ95", "url": "https://www.uniprot.org/uniprot/U3KQ95", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQ95-1", "url": "https://www.uniprot.org/uniprot/U3KQ95-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQI2", "url": "https://www.uniprot.org/uniprot/U3KQI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQI2-1", "url": "https://www.uniprot.org/uniprot/U3KQI2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ", "length": 477, "header": "sp|O14770-1|MEIS2_HUMAN Isoform 1 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TPB7-1", "url": "", "sequence": { "sequence": "MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWSEQTALARADIYWSLEGSSFLSGSSTSSFILLTHYSEIQLLKRMRHMFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM", "length": 435, "header": "tr|A0A8V8TPB7-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37098172, "end_pos": 36894757, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699904.1", "url": "https://www.ensembl.org/id/ENST00000699904.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514680.1", "url": "https://www.ensembl.org/id/ENSP00000514680.1" } ] } }, { "isoform_ac": "A0A8V8TPM6-1", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTIQMASFLNEAVQCRG", "length": 315, "header": "tr|A0A8V8TPM6-1|A0A8V8TPM6_HUMAN Computationally mapped isoform of Meis homeobox 2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 37031278, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699955.1", "url": "https://www.ensembl.org/id/ENST00000699955.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514715.1", "url": "https://www.ensembl.org/id/ENSP00000514715.1" } ] } }, { "isoform_ac": "A0A8V8TQU6-1", "url": "", "sequence": { "sequence": "MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ", "length": 324, "header": "tr|A0A8V8TQU6-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37094577, "end_pos": 36892176, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699956.1", "url": "https://www.ensembl.org/id/ENST00000699956.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514716.1", "url": "https://www.ensembl.org/id/ENSP00000514716.1" } ] } }, { "isoform_ac": "A0A9H3ZWV7-1", "url": "", "sequence": { "sequence": "MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGSGL", "length": 72, "header": "tr|A0A9H3ZWV7-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37098172, "end_pos": 37096398, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000397624.7", "url": "https://www.ensembl.org/id/ENST00000397624.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000380749.4", "url": "https://www.ensembl.org/id/ENSP00000380749.4" } ] } }, { "isoform_ac": "H0YKE5-1", "url": "", "sequence": { "sequence": "MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGH", "length": 94, "header": "tr|H0YKE5-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37094577, "end_pos": 37083805, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560697.5", "url": "https://www.ensembl.org/id/ENST00000560697.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452770.1", "url": "https://www.ensembl.org/id/ENSP00000452770.1" } ] } }, { "isoform_ac": "H0YKN2-1", "url": "", "sequence": { "sequence": "MIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQ", "length": 105, "header": "tr|H0YKN2-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37094577, "end_pos": 37083772, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560617.5", "url": "https://www.ensembl.org/id/ENST00000560617.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452874.1", "url": "https://www.ensembl.org/id/ENSP00000452874.1" } ] } }, { "isoform_ac": "H0YM65-1", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGFAPKSHFFPQIQSWTI", "length": 98, "header": "tr|H0YM65-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 37095564, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560570.5", "url": "https://www.ensembl.org/id/ENST00000560570.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453481.1", "url": "https://www.ensembl.org/id/ENSP00000453481.1" } ] } }, { "isoform_ac": "O14770-1", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ", "length": 477, "header": "sp|O14770-1|MEIS2_HUMAN Isoform 1 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 36892176, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000561208.6", "url": "https://www.ensembl.org/id/ENST00000561208.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000453793.1", "url": "https://www.ensembl.org/id/ENSP00000453793.1" } ] } }, { "isoform_ac": "O14770-2", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM", "length": 401, "header": "sp|O14770-2|MEIS2_HUMAN Isoform 2 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 36894757, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000424352.6", "url": "https://www.ensembl.org/id/ENST00000424352.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000404185.2", "url": "https://www.ensembl.org/id/ENSP00000404185.2" } ] } }, { "isoform_ac": "O14770-3", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM", "length": 394, "header": "sp|O14770-3|MEIS2_HUMAN Isoform 3 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 36894757, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559561.5", "url": "https://www.ensembl.org/id/ENST00000559561.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453497.1", "url": "https://www.ensembl.org/id/ENSP00000453497.1" } ] } }, { "isoform_ac": "O14770-4", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ", "length": 470, "header": "sp|O14770-4|MEIS2_HUMAN Isoform 4 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 36892176, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000338564.9", "url": "https://www.ensembl.org/id/ENST00000338564.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000341400.4", "url": "https://www.ensembl.org/id/ENSP00000341400.4" } ] } }, { "isoform_ac": "O14770-5", "url": "", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTVY", "length": 302, "header": "sp|O14770-5|MEIS2_HUMAN Isoform 5 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37099466, "end_pos": 36896681, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000314177.12", "url": "https://www.ensembl.org/id/ENST00000314177.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000326296.8", "url": "https://www.ensembl.org/id/ENSP00000326296.8" } ] } }, { "isoform_ac": "O14770-6", "url": "", "sequence": { "sequence": "MALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM", "length": 306, "header": "sp|O14770-6|MEIS2_HUMAN Isoform 6 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": {} }, { "isoform_ac": "O14770-7", "url": "", "sequence": { "sequence": "MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM", "length": 381, "header": "sp|O14770-7|MEIS2_HUMAN Isoform 7 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37098172, "end_pos": 36894757, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699903.1", "url": "https://www.ensembl.org/id/ENST00000699903.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514679.1", "url": "https://www.ensembl.org/id/ENSP00000514679.1" } ] } }, { "isoform_ac": "O14770-8", "url": "", "sequence": { "sequence": "MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM", "length": 388, "header": "sp|O14770-8|MEIS2_HUMAN Isoform 8 of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37098172, "end_pos": 36894757, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559085.5", "url": "https://www.ensembl.org/id/ENST00000559085.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453390.1", "url": "https://www.ensembl.org/id/ENSP00000453390.1" } ] } }, { "isoform_ac": "U3KQ95-1", "url": "", "sequence": { "sequence": "IQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQEFFRFIPIFQMKWLGLGEGQLLDCHDRKRKQKNEDKAI", "length": 139, "header": "tr|U3KQ95-1|MEIS2_HUMAN Computationally mapped isoform of Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37094565, "end_pos": 37066425, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000606653.5", "url": "https://www.ensembl.org/id/ENST00000606653.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000475660.1", "url": "https://www.ensembl.org/id/ENSP00000475660.1" } ] } }, { "isoform_ac": "U3KQI2-1", "url": "", "sequence": { "sequence": "EGFRWMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAG", "length": 235, "header": "tr|U3KQI2-1|U3KQI2_HUMAN Computationally mapped isoform of Meis homeobox 2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=1 CANONICAL=O14770-1" }, "locus": { "chromosome": "15", "start_pos": 37095021, "end_pos": 36895149, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000607277.5", "url": "https://www.ensembl.org/id/ENST00000607277.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000475899.1", "url": "https://www.ensembl.org/id/ENSP00000475899.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14770", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14770" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" } ] } ], "phosphorylation": [ { "start_pos": 198, "end_pos": 198, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14770", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14770" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser198" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Three-amino acid extension loop homeodomain proteins Meis2 and TGIF differentially regulate transcription.", "journal": "The Journal of biological chemistry", "date": "2000-07-07", "authors": "Yang Y, Hwang C K, D'Souza U M, Lee S H, Junn E, Mouradian M M", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "10764806", "url": "https://glygen.org/publication/PubMed/10764806" } ] }, { "title": "DNA binding and transcriptional activation by a PDX1.PBX1b.MEIS2b trimer and cooperation with a pancreas-specific basic helix-loop-helix complex.", "journal": "The Journal of biological chemistry", "date": "2001-05-25", "authors": "Liu Y, MacDonald R J, Swift G H", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "11279116", "url": "https://glygen.org/publication/PubMed/11279116" } ] }, { "title": "MEIS proteins as partners of the TLX1/HOX11 oncoprotein.", "journal": "Leuk. Res.", "date": "2010", "authors": "Milech Nadia, Gottardo Nicholas G, Ford Jette, D'Souza Darryl, Greene Wayne K, Kees Ursula R, Watt Paul M", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "19559479", "url": "https://glygen.org/publication/PubMed/19559479" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O14770-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14770-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Spatiotemporal distribution of PAX6 and MEIS2 expression and total cell numbers in the ganglionic eminence in the early developing human forebrain.", "journal": "Dev. Neurosci.", "date": "2010", "authors": "Larsen Karen B, Lutterodt Melissa C, Laursen Henning, Graem Niels, Pakkenberg Bente, M\u00f8llg\u00e5rd Kjeld, M\u00f8ller Morten", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "20523026", "url": "https://glygen.org/publication/PubMed/20523026" } ] }, { "title": "An autoinhibitory effect of the homothorax domain of Meis2.", "journal": "The FEBS journal", "date": "2010", "authors": "Hyman-Walsh C, Bjerke GA, Wotton D", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "20553494", "url": "https://glygen.org/publication/PubMed/20553494" } ] }, { "title": "Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Bjerke GA, Hyman-Walsh C, Wotton D", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "21746878", "url": "https://glygen.org/publication/PubMed/21746878" } ] }, { "title": "Haploinsufficiency of MEIS2 is associated with orofacial clefting and learning disability.", "journal": "Am. J. Med. Genet. A", "date": "2014", "authors": "Johansson Stefan, Berland Siren, Gradek Gyri Aasland, Bongers Ernie, de Leeuw Nicole, Pfundt Rolph, Fannemel Madeleine, R\u00f8dningen Olaug, Brendehaug Atle, Haukanes Bj\u00f8rn Ivar, Hovland Randi, Helland Gunnar, Houge Gunnar", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "24678003", "url": "https://glygen.org/publication/PubMed/24678003" } ] }, { "title": "MEIS2 involvement in cardiac development, cleft palate, and intellectual disability.", "journal": "American journal of medical genetics. Part A", "date": "2015", "authors": "Louw JJ, Corveleyn A, Jia Y, Hens G, Gewillig M, Devriendt K", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "25712757", "url": "https://glygen.org/publication/PubMed/25712757" } ] }, { "title": "DNA-dependent formation of transcription factor pairs alters their binding specificity.", "journal": "Nature", "date": "2015", "authors": "Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "26550823", "url": "https://glygen.org/publication/PubMed/26550823" } ] }, { "title": "De novo MEIS2 mutation causes syndromic developmental delay with persistent gastro-esophageal reflux.", "journal": "Journal of human genetics", "date": "2016", "authors": "Fujita A, Isidor B, Piloquet H, Corre P, Okamoto N, Nakashima M, Tsurusaki Y, Saitsu H, Miyake N, Matsumoto N", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "27225850", "url": "https://glygen.org/publication/PubMed/27225850" } ] }, { "title": "O-GlcNAc Transferase Recognizes Protein Substrates Using an Asparagine Ladder in the Tetratricopeptide Repeat (TPR) Superhelix.", "journal": "Journal of the American Chemical Society", "date": "2018", "authors": "Levine ZG, Fan C, Melicher MS, Orman M, Benjamin T, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14770", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14770" } ], "reference": [ { "type": "PubMed", "id": "29485866", "url": "https://glygen.org/publication/PubMed/29485866" } ] }, { "title": "Intellectual disability associated with craniofacial dysmorphism, cleft palate, and congenital heart defect due to a de novo MEIS2 mutation: A clinical longitudinal study.", "journal": "American journal of medical genetics. Part A", "date": "2021", "authors": "Gangfuss A, Yigit G, Altmuller J, Nurnberg P, Czeschik JC, Wollnik B, Bogershausen N, Burfeind P, Wieczorek D, Kaiser F, Roos A, Kolbel H, Schara-Schmidt U, Kuechler A", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" } ], "reference": [ { "type": "PubMed", "id": "33427397", "url": "https://glygen.org/publication/PubMed/33427397" } ] }, { "title": "Expression of ISL1 and its partners in prostate cancer progression and neuroendocrine differentiation.", "journal": "Journal of cancer research and clinical oncology", "date": "2021", "authors": "Alshalalfa M, Abou-Ouf H, Davicioni E, Karnes RJ, Alhajj R, Bismar TA", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" } ], "reference": [ { "type": "PubMed", "id": "33864110", "url": "https://glygen.org/publication/PubMed/33864110" } ] }, { "title": "Meis homeobox 2 (MEIS2) inhibits the proliferation and promotes apoptosis of thyroid cancer cell and through the NF-kappaB signaling pathway.", "journal": "Bioengineered", "date": "2021", "authors": "Wen X, Liu M, Du J, Wang X", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" } ], "reference": [ { "type": "PubMed", "id": "33975520", "url": "https://glygen.org/publication/PubMed/33975520" } ] }, { "title": "IGF2BP2 promotes the progression of ovarian endometriosis by regulating m6A-modified MEIS2 and GATA6.", "journal": "The international journal of biochemistry & cell biology", "date": "2022-11", "authors": "Zhao Shaojie, Zhang Bing, Yuan Hua, Yin Yongxiang, Qi Suwan, Li Wenjuan, Wu Xiadi, Yaling Feng", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" } ], "reference": [ { "type": "PubMed", "id": "36113831", "url": "https://glygen.org/publication/PubMed/36113831" } ] }, { "title": "CircDHRS3 inhibits prostate cancer cell proliferation and metastasis through the circDHRS3/miR-421/MEIS2 axis.", "journal": "Epigenetics", "date": "2023-12", "authors": "Dai Xiyu, Chen Xinan, Chen Wensun, Ou Yuxi, Chen Yiling, Wu Siqi, Zhou Quan, Yang Chen, Zhang Limin, Jiang Haowen", "evidence": [ { "database": "RefSeq", "id": "NP_001207411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001207411" } ], "reference": [ { "type": "PubMed", "id": "36840946", "url": "https://glygen.org/publication/PubMed/36840946" } ] }, { "title": "Chromosomal mapping to 15q14 and expression analysis of the human MEIS2 homeobox gene.", "journal": "Mamm. Genome", "date": "1997", "authors": "Smith JE, Afonja O, Yee HT, Inghirami G, Takeshita K", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "reference": [ { "type": "PubMed", "id": "9383298", "url": "https://glygen.org/publication/PubMed/9383298" } ] } ], "pathway": [ { "id": "hsa:4212", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4212", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A2T5-1", "protein_name": "Meis homeobox 2", "gene_name": "Meis2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFLYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPVGMGMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ", "length": 469 }, "evidence": [ { "id": "45916728", "url": "http://www.informatics.jax.org/homology/45916728", "database": "MGI" }, { "id": "O14770", "url": "https://omabrowser.org/oma/group/O14770/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P97367-1", "protein_name": "Homeobox protein Meis2", "gene_name": "Meis2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMGMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMVMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ", "length": 477 }, "evidence": [ { "id": "45916728", "url": "http://www.informatics.jax.org/homology/45916728", "database": "MGI" }, { "id": "O14770", "url": "https://omabrowser.org/oma/group/O14770/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "transcription factor binding", "id": "GO:0008134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008134", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "visual learning", "id": "GO:0008542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "positive regulation of mitotic cell cycle", "id": "GO:0045931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045931", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "response to mechanical stimulus", "id": "GO:0009612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009612", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "animal organ morphogenesis", "id": "GO:0009887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009887", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "pancreas development", "id": "GO:0031016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031016", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "response to growth factor", "id": "GO:0070848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070848", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "positive regulation of cardiac muscle myoblast proliferation", "id": "GO:0110024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110024", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "negative regulation of myeloid cell differentiation", "id": "GO:0045638", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045638", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "eye development", "id": "GO:0001654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001654", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" }, { "name": "embryonic pattern specification", "id": "GO:0009880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009880", "evidence": [ { "database": "UniProtKB", "id": "O14770", "url": "https://www.uniprot.org/uniprot/O14770" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 247, "end_pos": 249, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 55 ], "glycation_sites": [], "phosphorylation_sites": [ 198 ], "sequon_annotation_sites": [ { "start_pos": 247, "end_pos": 249 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }