{
    "uniprot_canonical_ac": "O14603-1",
    "uniprot_ac": "O14603",
    "uniprot_id": "PRY_HUMAN",
    "mass": {
        "chemical_mass": 16512.0,
        "monoisotopic_mass": 16512.0
    },
    "refseq": {
        "ac": "NP_001002758",
        "name": "PTPN13-like protein, Y-linked",
        "summary": "This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. It encodes a protein which has a low degree of similarity to protein tyrosine phosphatase, non-receptor type 13. Two nearly identical copies of this gene exist within a palindromic region. This record represents the more centromeric copy. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758"
    },
    "gene_names": [
        {
            "name": "PRY2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        },
        {
            "name": "PRYP3",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        },
        {
            "name": "PRYP4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        },
        {
            "name": "PRY",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        },
        {
            "name": "PRY1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        },
        {
            "name": "PRY2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758",
            "id": "NP_001002758"
        },
        {
            "name": "PTPN13LY2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758",
            "id": "NP_001002758"
        },
        {
            "name": "PTPN13LY2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        },
        {
            "name": "PTPN13LY",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "id": "O14603"
        }
    ],
    "protein_names": [
        {
            "name": "PTPN13-like protein, Y-linked",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O14603"
        },
        {
            "name": "PTPN13-like protein, Y-linked",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758",
            "id": "NP_001002758"
        },
        {
            "name": "PTPN13-like, Y-linked, centromeric; testis-specific PTP-BL-related protein on Y; testis-specific PTP-BL-related Y protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758",
            "id": "NP_001002758"
        },
        {
            "name": "Testis-specific PTP-BL-related Y protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O14603"
        }
    ],
    "function": [
        {
            "annotation": "This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. It encodes a protein which has a low degree of similarity to protein tyrosine phosphatase, non-receptor type 13. Two nearly identical copies of this gene exist within a palindromic region. This record represents the more centromeric copy. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001002758",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14603",
                    "url": "https://www.uniprot.org/uniprot/O14603"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "PRY",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "locus": {
                "chromosome": "Y",
                "start_pos": 22514637,
                "end_pos": 22490397,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000169789",
                        "url": "https://www.ensembl.org/id/ENSG00000169789"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000169763",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169763",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "PRY",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRY",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "PRY2",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRY2",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "PRYP3",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRYP3",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "PRYP4",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRYP4",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "442862",
            "url": "https://www.ncbi.nlm.nih.gov/gene/442862",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "9081",
            "url": "https://www.ncbi.nlm.nih.gov/gene/9081",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "14024",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=14024",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "21504",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=21504",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "34020",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=34020",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "34021",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=34021",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "hsa:442862",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:442862",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "hsa:9081",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9081",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "400019",
            "url": "http://www.omim.org/entry/400019",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "400041",
            "url": "http://www.omim.org/entry/400041",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_O14603",
            "url": "https://www.nextprot.org/entry/NX_O14603",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "HGMGSEI",
            "url": "https://omabrowser.org/oma/group/HGMGSEI/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4689805at2759",
            "url": "http://www.orthodb.org/?query=4689805at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "O14603",
            "url": "https://pharos.nih.gov/targets/O14603",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_O14603",
            "url": "http://purl.obolibrary.org/obo/PR_O14603",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001002758",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002758",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O14603",
            "url": "https://www.uniprot.org/uniprot/O14603",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O14603-1",
            "url": "https://www.uniprot.org/uniprot/O14603-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O14603-2",
            "url": "https://www.uniprot.org/uniprot/O14603-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRALGDICGHVHEED",
        "length": 147,
        "header": "sp|O14603-1|PRY_HUMAN Isoform 1 of PTPN13-like protein, Y-linked  OS=Homo sapiens OX=9606 GN=PRY PE=1 SV=2 CANONICAL=O14603-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O14603-1",
            "url": "",
            "sequence": {
                "sequence": "MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRALGDICGHVHEED",
                "length": 147,
                "header": "sp|O14603-1|PRY_HUMAN Isoform 1 of PTPN13-like protein, Y-linked  OS=Homo sapiens OX=9606 GN=PRY PE=1 SV=2 CANONICAL=O14603-1"
            },
            "locus": {
                "chromosome": "Y",
                "start_pos": 22084839,
                "end_pos": 22072326,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000303804.5",
                        "url": "https://www.ensembl.org/id/ENST00000303804.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000303300.1",
                        "url": "https://www.ensembl.org/id/ENSP00000303300.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "O14603-2",
            "url": "",
            "sequence": {
                "sequence": "MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRDGVSPCLPC",
                "length": 71,
                "header": "sp|O14603-2|PRY_HUMAN Isoform 2 of PTPN13-like protein, Y-linked  OS=Homo sapiens OX=9606 GN=PRY PE=1 SV=2 CANONICAL=O14603-1"
            },
            "locus": {
                "chromosome": "Y",
                "start_pos": 22084839,
                "end_pos": 22073731,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000472391.1",
                        "url": "https://www.ensembl.org/id/ENST00000472391.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000474545.1",
                        "url": "https://www.ensembl.org/id/ENSP00000474545.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Characterization of the genomic organization, localization and expression of four PRY genes (PRY1, PRY2, PRY3 and PRY4).",
            "journal": "Mol. Hum. Reprod.",
            "date": "2001",
            "authors": "Stouffs K, Lissens W, Van Landuyt L, Tournaye H, Van Steirteghem A, Liebaers I",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14603",
                    "url": "https://www.uniprot.org/uniprot/O14603"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11420382",
                    "url": "https://glygen.org/publication/PubMed/11420382"
                }
            ]
        },
        {
            "title": "Expression pattern of the Y-linked PRY gene suggests a function in apoptosis but not in spermatogenesis.",
            "journal": "Mol. Hum. Reprod.",
            "date": "2004",
            "authors": "Stouffs Katrien, Lissens Willy, Verheyen Greta, Van Landuyt Lisbet, Goossens Annieta, Tournaye Herman, Van Steirteghem Andr\u00e9, Liebaers Inge",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14603",
                    "url": "https://www.uniprot.org/uniprot/O14603"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14665702",
                    "url": "https://glygen.org/publication/PubMed/14665702"
                }
            ]
        },
        {
            "title": "Functional coherence of the human Y chromosome.",
            "journal": "Science",
            "date": "1997",
            "authors": "Lahn B T, Page D C",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14603",
                    "url": "https://www.uniprot.org/uniprot/O14603"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9381176",
                    "url": "https://glygen.org/publication/PubMed/9381176"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:442862",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:442862",
            "resource": "KEGG Pathway"
        },
        {
            "id": "hsa:9081",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9081",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 18,
            "end_pos": 20,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 18,
                "end_pos": 20
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}