{
    "uniprot_canonical_ac": "O14598-1",
    "uniprot_ac": "O14598",
    "uniprot_id": "VCY1_HUMAN",
    "mass": {
        "chemical_mass": 12917.0,
        "monoisotopic_mass": 12917.0
    },
    "refseq": {
        "ac": "NP_004670",
        "name": "testis-specific basic protein Y 1",
        "summary": "The protein encoded by this gene is a member of a family of human VCX/Y genes. This gene family has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. Members of the VCX/Y family share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. VCX/Y genes encode small and highly charged proteins of unknown function. This gene encodes a small, positively charged protein. The presence of a putative bipartite nuclear localization signal suggests that this gene encodes a nuclear protein. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670"
    },
    "gene_names": [
        {
            "name": "VCY1B",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "id": "O14598"
        },
        {
            "name": "VCY",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "id": "O14598"
        },
        {
            "name": "BPY1; VCY1; VCY1A",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670",
            "id": "NP_004670"
        },
        {
            "name": "BPY1B",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "id": "O14598"
        },
        {
            "name": "BPY1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "id": "O14598"
        },
        {
            "name": "VCY1A",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "id": "O14598"
        },
        {
            "name": "VCY",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670",
            "id": "NP_004670"
        }
    ],
    "protein_names": [
        {
            "name": "Testis-specific basic protein Y 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O14598"
        },
        {
            "name": "Basic charge, Y-linked 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O14598"
        },
        {
            "name": "Variably charged protein Y",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O14598"
        },
        {
            "name": "testis-specific basic protein Y 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670",
            "id": "NP_004670"
        },
        {
            "name": "variable charge, Y chromosome; basic protein on Y chromosome, 1; testis-specific basic protein on Y, 1; basic charge, Y-linked 1; variably charged protein Y",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670",
            "id": "NP_004670"
        }
    ],
    "function": [
        {
            "annotation": "Human VCX/Y, SPANX, and CSAG2 gene families together with the murine SPANX gene and the CYPT family may share a common ancestor.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004670",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670"
                },
                {
                    "database": "PubMed",
                    "id": "17342728",
                    "url": "https://glygen.org/publication/PubMed/17342728"
                }
            ]
        },
        {
            "annotation": "Identified members of the VCX/Y gene family as novel CT antigens.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004670",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670"
                },
                {
                    "database": "PubMed",
                    "id": "24970476",
                    "url": "https://glygen.org/publication/PubMed/24970476"
                }
            ]
        },
        {
            "annotation": "May mediate a process in spermatogenesis or may play a role in sex ratio distortion.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14598",
                    "url": "https://www.uniprot.org/uniprot/O14598#function"
                }
            ]
        },
        {
            "annotation": "The protein encoded by this gene is a member of a family of human VCX/Y genes. This gene family has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. Members of the VCX/Y family share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. VCX/Y genes encode small and highly charged proteins of unknown function. This gene encodes a small, positively charged protein. The presence of a putative bipartite nuclear localization signal suggests that this gene encodes a nuclear protein. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004670",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [
        {
            "tissue": {
                "name": "Adult mammalian kidney",
                "namespace": "UBERON",
                "id": "0000082",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000082"
            },
            "score": "18.51",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Stomach",
                "namespace": "UBERON",
                "id": "0000945",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000945"
            },
            "score": "16.41",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Esophagus",
                "namespace": "UBERON",
                "id": "0001043",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001043"
            },
            "score": "17.43",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Rectum",
                "namespace": "UBERON",
                "id": "0001052",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001052"
            },
            "score": "16.94",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Urinary bladder",
                "namespace": "UBERON",
                "id": "0001255",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001255"
            },
            "score": "28.55",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thyroid gland",
                "namespace": "UBERON",
                "id": "0002046",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002046"
            },
            "score": "20",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Liver",
                "namespace": "UBERON",
                "id": "0002107",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002107"
            },
            "score": "16.88",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Prostate gland",
                "namespace": "UBERON",
                "id": "0002367",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002367"
            },
            "score": "16.12",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thoracic mammary gland",
                "namespace": "UBERON",
                "id": "0005200",
                "url": "http://purl.obolibrary.org/obo/UBERON_0005200"
            },
            "score": "14.63",
            "present": "ABSENT",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000129862",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862"
                }
            ]
        }
    ],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14598",
                    "url": "https://www.uniprot.org/uniprot/O14598"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "VCY1B",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "locus": {
                "chromosome": "Y",
                "start_pos": 14056958,
                "end_pos": 14056227,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000129862",
                        "url": "https://www.ensembl.org/id/ENSG00000129862"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000129862",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129862",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "VCY",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=VCY",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "VCY1B",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=VCY1B",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "353513",
            "url": "https://www.ncbi.nlm.nih.gov/gene/353513",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "9084",
            "url": "https://www.ncbi.nlm.nih.gov/gene/9084",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "12668",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12668",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "31751",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31751",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "O14598",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:O14598*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR026653",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR026653",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:353513",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:353513",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "hsa:9084",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9084",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "400012",
            "url": "http://www.omim.org/entry/400012",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "400050",
            "url": "http://www.omim.org/entry/400050",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_O14598",
            "url": "https://www.nextprot.org/entry/NX_O14598",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "CQVPVME",
            "url": "https://omabrowser.org/oma/group/CQVPVME/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15251",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15251",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15251:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15251:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF15231",
            "url": "http://pfam.xfam.org/family/PF15231",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "O14598",
            "url": "https://pharos.nih.gov/targets/O14598",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_O14598",
            "url": "http://purl.obolibrary.org/obo/PR_O14598",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_004670",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O14598",
            "url": "https://www.uniprot.org/uniprot/O14598",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O14598-1",
            "url": "https://www.uniprot.org/uniprot/O14598-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP",
        "length": 125,
        "header": "sp|O14598-1|VCY1_HUMAN Isoform 1 of Testis-specific basic protein Y 1  OS=Homo sapiens OX=9606 GN=VCY1B PE=1 SV=1 CANONICAL=O14598-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O14598-1",
            "url": "",
            "sequence": {
                "sequence": "MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP",
                "length": 125,
                "header": "sp|O14598-1|VCY1_HUMAN Isoform 1 of Testis-specific basic protein Y 1  OS=Homo sapiens OX=9606 GN=VCY1B PE=1 SV=1 CANONICAL=O14598-1"
            },
            "locus": {
                "chromosome": "Y",
                "start_pos": 14056856,
                "end_pos": 14056290,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000250823.5",
                        "url": "https://www.ensembl.org/id/ENST00000250823.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000250823.4",
                        "url": "https://www.ensembl.org/id/ENSP00000250823.4"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.",
            "journal": "Molecular reproduction and development",
            "date": "2008",
            "authors": "Hansen MA, Nielsen JE, Retelska D, Larsen N, Leffers H",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004670",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17342728",
                    "url": "https://glygen.org/publication/PubMed/17342728"
                }
            ]
        },
        {
            "title": "A search for novel cancer/testis antigens in lung cancer identifies VCX/Y genes, expanding the repertoire of potential immunotherapeutic targets.",
            "journal": "Cancer research",
            "date": "2014",
            "authors": "Taguchi A, Taylor AD, Rodriguez J, Celiktas M, Liu H, Ma X, Zhang Q, Wong CH, Chin A, Girard L, Behrens C, Lam WL, Lam S, Minna JD, Wistuba II, Gazdar AF, Hanash SM",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_004670",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004670"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24970476",
                    "url": "https://glygen.org/publication/PubMed/24970476"
                }
            ]
        },
        {
            "title": "Functional coherence of the human Y chromosome.",
            "journal": "Science",
            "date": "1997",
            "authors": "Lahn B T, Page D C",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O14598",
                    "url": "https://www.uniprot.org/uniprot/O14598"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9381176",
                    "url": "https://glygen.org/publication/PubMed/9381176"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:353513",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:353513",
            "resource": "KEGG Pathway"
        },
        {
            "id": "hsa:9084",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9084",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "brain development",
                        "id": "GO:0007420",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O14598",
                                "url": "https://www.uniprot.org/uniprot/O14598"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}