{ "uniprot_canonical_ac": "O14558-1", "uniprot_ac": "O14558", "uniprot_id": "HSPB6_HUMAN", "mass": { "chemical_mass": 17136.0, "monoisotopic_mass": 17136.0 }, "refseq": { "ac": "NP_653218", "name": "heat shock protein beta-6", "summary": "This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. [provided by RefSeq, Jan 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, "gene_names": [ { "name": "HSPB6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14558", "id": "O14558" }, { "name": "HEL55; Hsp20; PPP1R91", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218", "id": "NP_653218" }, { "name": "HSPB6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218", "id": "NP_653218" } ], "protein_names": [ { "name": "Heat shock protein beta-6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14558" }, { "name": "Heat shock 20 kDa-like protein p20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14558" }, { "name": "HspB6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14558" }, { "name": "heat shock 20 kDa-like protein p20; epididymis luminal protein 55; protein phosphatase 1, regulatory subunit 91; heat shock protein, alpha-crystallin-related, B6; heat shock protein family B (small) member B6; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218", "id": "NP_653218" }, { "name": "heat shock protein beta-6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218", "id": "NP_653218" } ], "function": [ { "annotation": "Cellular functions of heat shock protein 20 (HSPB6) in cancer: A review. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, { "database": "PubMed", "id": "37844714", "url": "https://glygen.org/publication/PubMed/37844714" } ] }, { "annotation": "HSPB6 Is Depleted in Colon Cancer Patients and Its Expression Is Induced by 5-aza-2'-Deoxycytidine In Vitro. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, { "database": "PubMed", "id": "37241227", "url": "https://glygen.org/publication/PubMed/37241227" } ] }, { "annotation": "Our results suggest that a variety of oligomers composed of different proportions of different sHSPs may form in cell types expressing multiple sHSPs.", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, { "database": "PubMed", "id": "16225851", "url": "https://glygen.org/publication/PubMed/16225851" } ] }, { "annotation": "Overexpression of HSPB6 inhibits osteosarcoma progress through the ERK signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, { "database": "PubMed", "id": "37861934", "url": "https://glygen.org/publication/PubMed/37861934" } ] }, { "annotation": "Physico-chemical properties of two point mutants of small heat shock protein HspB6 (Hsp20) with abrogated cardioprotection.", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, { "database": "PubMed", "id": "32353387", "url": "https://glygen.org/publication/PubMed/32353387" } ] }, { "annotation": "Prevalence of HSPB6 gene variants in peripartum cardiomyopathy: Data from the German PPCM registry.", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" }, { "database": "PubMed", "id": "36918127", "url": "https://glygen.org/publication/PubMed/36918127" } ] }, { "annotation": "Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558#function" }, { "database": "PubMed", "id": "22794279", "url": "https://glygen.org/publication/PubMed/22794279" }, { "database": "PubMed", "id": "20843828", "url": "https://glygen.org/publication/PubMed/20843828" }, { "database": "PubMed", "id": "14717697", "url": "https://glygen.org/publication/PubMed/14717697" }, { "database": "PubMed", "id": "22427880", "url": "https://glygen.org/publication/PubMed/22427880" }, { "database": "PubMed", "id": "19845507", "url": "https://glygen.org/publication/PubMed/19845507" } ] }, { "annotation": "This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. [provided by RefSeq, Jan 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 134, "end_pos": 134, "sequence_org": "S", "sequence_mut": "Q", "comment": "Decreases heteromer formation with CRYAB.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ] }, { "start_pos": 3, "end_pos": 3, "sequence_org": "I", "sequence_mut": "G", "comment": "Increases homodimer-based self-association properties; increases chaperone activity; when associated with G-5.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "PubMed", "id": "24382496", "url": "https://glygen.org/publication/PubMed/24382496" } ] }, { "start_pos": 5, "end_pos": 5, "sequence_org": "V", "sequence_mut": "G", "comment": "Increases homodimer-based self-association properties; increases chaperone activity; when associated with G-3.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "PubMed", "id": "24382496", "url": "https://glygen.org/publication/PubMed/24382496" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "V", "sequence_mut": "G", "comment": "No effect on homodimer-based self-association properties; no effect on chaperone activity.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "PubMed", "id": "24382496", "url": "https://glygen.org/publication/PubMed/24382496" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "81.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "61.07", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "96.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "77.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "91.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "74.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "74.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14558", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14558" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "common_name": "Human" } ], "gene": [ { "name": "HSPB6", "url": "https://www.uniprot.org/uniprot/O14558", "locus": { "chromosome": "19", "start_pos": 35754566, "end_pos": 35758079, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000004776", "url": "https://www.ensembl.org/id/ENSG00000004776" } ] } } ], "crossref": [ { "id": "ENSG00000004776", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004776", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06478", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06478", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "HSPB6", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HSPB6", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "126393", "url": "https://www.ncbi.nlm.nih.gov/gene/126393", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26511", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26511", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14558", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14558*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002068", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002068", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003090", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003090", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008978", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008978", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:126393", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:126393", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "610695", "url": "http://www.omim.org/entry/610695", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14558", "url": "https://www.nextprot.org/entry/NX_O14558", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PVQPTWL", "url": "https://omabrowser.org/oma/group/PVQPTWL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3014506at2759", "url": "http://www.orthodb.org/?query=3014506at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45640", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45640", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45640:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45640:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4JUS", "url": "https://www.rcsb.org/structure/4JUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JUT", "url": "https://www.rcsb.org/structure/4JUT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LTW", "url": "https://www.rcsb.org/structure/5LTW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LU1", "url": "https://www.rcsb.org/structure/5LU1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LU2", "url": "https://www.rcsb.org/structure/5LU2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LUM", "url": "https://www.rcsb.org/structure/5LUM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OK9", "url": "https://www.rcsb.org/structure/5OK9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OKF", "url": "https://www.rcsb.org/structure/5OKF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00011", "url": "http://pfam.xfam.org/family/PF00011", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00525", "url": "http://pfam.xfam.org/family/PF00525", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14558", "url": "https://pharos.nih.gov/targets/O14558", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14558", "url": "http://purl.obolibrary.org/obo/PR_O14558", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1X7SC65", "url": "https://www.uniprot.org/uniprot/A0A1X7SC65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SC65-1", "url": "https://www.uniprot.org/uniprot/A0A1X7SC65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EP04", "url": "https://www.uniprot.org/uniprot/K7EP04", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EP04-1", "url": "https://www.uniprot.org/uniprot/K7EP04-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14558-1", "url": "https://www.uniprot.org/uniprot/O14558-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK", "length": 160, "header": "sp|O14558-1|HSPB6_HUMAN Isoform 1 of Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2 CANONICAL=O14558-1" }, "isoforms": [ { "isoform_ac": "A0A1X7SC65-1", "url": "", "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYR", "length": 122, "header": "tr|A0A1X7SC65-1|HSPB6_HUMAN Computationally mapped isoform of Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=1 CANONICAL=O14558-1" }, "locus": { "chromosome": "19", "start_pos": 35757008, "end_pos": 35755639, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592984.6", "url": "https://www.ensembl.org/id/ENST00000592984.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000468057.2", "url": "https://www.ensembl.org/id/ENSP00000468057.2" } ] } }, { "isoform_ac": "K7EP04-1", "url": "", "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPVSRGVGRGWSGYARRRAGGAGPLKPPSPPG", "length": 137, "header": "tr|K7EP04-1|HSPB6_HUMAN Computationally mapped isoform of Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=1 CANONICAL=O14558-1" }, "locus": { "chromosome": "19", "start_pos": 35757008, "end_pos": 35755682, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587965.1", "url": "https://www.ensembl.org/id/ENST00000587965.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000467169.1", "url": "https://www.ensembl.org/id/ENSP00000467169.1" } ] } }, { "isoform_ac": "O14558-1", "url": "", "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK", "length": 160, "header": "sp|O14558-1|HSPB6_HUMAN Isoform 1 of Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2 CANONICAL=O14558-1" }, "locus": { "chromosome": "19", "start_pos": 35757008, "end_pos": 35755525, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000004982.6", "url": "https://www.ensembl.org/id/ENST00000004982.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000004982.3", "url": "https://www.ensembl.org/id/ENSP00000004982.3" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" }, { "database": "PubMed", "id": "10196226", "url": "https://glygen.org/publication/PubMed/10196226" } ], "site_lbl": "Ser16" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "10196226", "url": "https://glygen.org/publication/PubMed/10196226" }, { "database": "PubMed", "id": "12738803", "url": "https://glygen.org/publication/PubMed/12738803" }, { "database": "PubMed", "id": "18790732", "url": "https://glygen.org/publication/PubMed/18790732" }, { "database": "PubMed", "id": "19850943", "url": "https://glygen.org/publication/PubMed/19850943" }, { "database": "PubMed", "id": "20869365", "url": "https://glygen.org/publication/PubMed/20869365" }, { "database": "PubMed", "id": "21334344", "url": "https://glygen.org/publication/PubMed/21334344" }, { "database": "PubMed", "id": "22731613", "url": "https://glygen.org/publication/PubMed/22731613" }, { "database": "PubMed", "id": "22794279", "url": "https://glygen.org/publication/PubMed/22794279" }, { "database": "PubMed", "id": "23473803", "url": "https://glygen.org/publication/PubMed/23473803" }, { "database": "PubMed", "id": "24400135", "url": "https://glygen.org/publication/PubMed/24400135" }, { "database": "PubMed", "id": "24859569", "url": "https://glygen.org/publication/PubMed/24859569" }, { "database": "PubMed", "id": "26443497", "url": "https://glygen.org/publication/PubMed/26443497" }, { "database": "PubMed", "id": "27046040", "url": "https://glygen.org/publication/PubMed/27046040" }, { "database": "PubMed", "id": "28097089", "url": "https://glygen.org/publication/PubMed/28097089" }, { "database": "PubMed", "id": "31628352", "url": "https://glygen.org/publication/PubMed/31628352" }, { "database": "PubMed", "id": "33339131", "url": "https://glygen.org/publication/PubMed/33339131" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "Ser16" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" }, { "database": "PubMed", "id": "22794279", "url": "https://glygen.org/publication/PubMed/22794279" } ], "site_lbl": "Ser59" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The small heat shock-related protein, HSP20, is phosphorylated on serine 16 during cyclic nucleotide-dependent relaxation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Beall A, Bagwell D, Woodrum D, Stoming TA, Kato K, Suzuki A, Rasmussen H, Brophy CM", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "10196226", "url": "https://glygen.org/publication/PubMed/10196226" } ] }, { "title": "Transduction of biologically active motifs of the small heat shock-related protein HSP20 leads to relaxation of vascular smooth muscle.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2003", "authors": "Flynn CR, Komalavilas P, Tessier D, Thresher J, Niederkofler EE, Dreiza CM, Nelson RW, Panitch A, Joshi L, Brophy CM", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "12738803", "url": "https://glygen.org/publication/PubMed/12738803" } ] }, { "title": "Some properties of human small heat shock protein Hsp20 (HspB6).", "journal": "European journal of biochemistry", "date": "2004", "authors": "Bukach OV, Seit-Nebi AS, Marston SB, Gusev NB", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "14717697", "url": "https://glygen.org/publication/PubMed/14717697" } ] }, { "title": "Interactions of HSP22 (HSPB8) with HSP20, alphaB-crystallin, and HSPB3.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Fontaine JM, Sun X, Benndorf R, Welsh MJ", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ], "reference": [ { "type": "PubMed", "id": "16225851", "url": "https://glygen.org/publication/PubMed/16225851" } ] }, { "title": "Human mutation in the anti-apoptotic heat shock protein 20 abrogates its cardioprotective effects.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Nicolaou P, Knoll R, Haghighi K, Fan GC, Dorn GW 2nd, Hasenfub G, Kranias EG", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "18790732", "url": "https://glygen.org/publication/PubMed/18790732" } ] }, { "title": "HSPB7 is a SC35 speckle resident small heat shock protein.", "journal": "Biochim. Biophys. Acta", "date": "2009", "authors": "Vos MJ, Kanon B, Kampinga HH", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "19464326", "url": "https://glygen.org/publication/PubMed/19464326" } ] }, { "title": "The small heat shock protein, HSPB6, in muscle function and disease.", "journal": "Cell Stress Chaperones", "date": "2010", "authors": "Dreiza Catherine M, Komalavilas Padmini, Furnish Elizabeth J, Flynn Charles R, Sheller Michael R, Smoke Christopher C, Lopes Luciana B, Brophy Colleen M", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "19568960", "url": "https://glygen.org/publication/PubMed/19568960" } ] }, { "title": "Versatility of the small heat shock protein HSPB6 (Hsp20).", "journal": "Cell Stress Chaperones", "date": "2010", "authors": "Seit-Nebi Alim S, Gusev Nikolai B", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "19777375", "url": "https://glygen.org/publication/PubMed/19777375" } ] }, { "title": "Identification of the key structural motifs involved in HspB8/HspB6-Bag3 interaction.", "journal": "The Biochemical journal", "date": "2009-12-14", "authors": "Fuchs Margit, Poirier Dominic J, Seguin Samuel J, Lambert Herman, Carra Serena, Charette Steve J, Landry Jacques", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "19845507", "url": "https://glygen.org/publication/PubMed/19845507" } ] }, { "title": "Blockade of Hsp20 phosphorylation exacerbates cardiac ischemia/reperfusion injury by suppressed autophagy and increased cell death.", "journal": "Circulation research", "date": "2009", "authors": "Qian J, Ren X, Wang X, Zhang P, Jones WK, Molkentin JD, Fan GC, Kranias EG", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "19850943", "url": "https://glygen.org/publication/PubMed/19850943" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "HSPB7 is the most potent polyQ aggregation suppressor within the HSPB family of molecular chaperones.", "journal": "Human molecular genetics", "date": "2010-12-01", "authors": "Vos Michel J, Zijlstra Marianne P, Kanon Bart, van Waarde-Verhagen Maria A W H, Brunt Ewout R P, Oosterveld-Hut Hendrika M J, Carra Serena, Sibon Ody C M, Kampinga Harm H", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "20843828", "url": "https://glygen.org/publication/PubMed/20843828" } ] }, { "title": "Small heat shock protein 20 (HspB6) in cardiac hypertrophy and failure.", "journal": "Journal of molecular and cellular cardiology", "date": "2011", "authors": "Fan GC, Kranias EG", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "20869365", "url": "https://glygen.org/publication/PubMed/20869365" } ] }, { "title": "Disruption of the cyclic AMP phosphodiesterase-4 (PDE4)-HSP20 complex attenuates the beta-agonist induced hypertrophic response in cardiac myocytes.", "journal": "Journal of molecular and cellular cardiology", "date": "2011", "authors": "Sin YY, Edwards HV, Li X, Day JP, Christian F, Dunlop AJ, Adams DR, Zaccolo M, Houslay MD, Baillie GS", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "21334344", "url": "https://glygen.org/publication/PubMed/21334344" } ] }, { "title": "Three-dimensional structure of alpha-crystallin domain dimers of human small heat shock proteins HSPB1 and HSPB6.", "journal": "J. Mol. Biol.", "date": "2011", "authors": "Baranova E V, Weeks S D, Beelen S, Bukach O V, Gusev N B, Strelkov S V", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "21641913", "url": "https://glygen.org/publication/PubMed/21641913" } ] }, { "title": "Heterooligomeric complexes of human small heat shock proteins.", "journal": "Cell Stress Chaperones", "date": "2012", "authors": "Mymrikov Evgeny V, Seit-Nebi Alim S, Gusev Nikolai B", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "22002549", "url": "https://glygen.org/publication/PubMed/22002549" } ] }, { "title": "Hsp20 functions as a novel cardiokine in promoting angiogenesis via activation of VEGFR2.", "journal": "PloS one", "date": "2012", "authors": "Zhang Xiaowei, Wang Xiaohong, Zhu Hongyan, Kranias Evangelia G, Tang Yaoliang, Peng Tianqing, Chang Jiang, Fan Guo-Chang", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "22427880", "url": "https://glygen.org/publication/PubMed/22427880" } ] }, { "title": "The A-kinase-anchoring protein AKAP-Lbc facilitates cardioprotective PKA phosphorylation of Hsp20 on Ser(16).", "journal": "The Biochemical journal", "date": "2012", "authors": "Edwards HV, Scott JD, Baillie GS", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "22731613", "url": "https://glygen.org/publication/PubMed/22731613" } ] }, { "title": "Monomeric 14-3-3zeta has a chaperone-like activity and is stabilized by phosphorylated HspB6.", "journal": "Biochemistry", "date": "2012", "authors": "Sluchanko NN, Artemova NV, Sudnitsyna MV, Safenkova IV, Antson AA, Levitsky DI, Gusev NB", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "22794279", "url": "https://glygen.org/publication/PubMed/22794279" } ] }, { "title": "Chemical informatics uncovers a new role for moexipril as a novel inhibitor of cAMP phosphodiesterase-4 (PDE4).", "journal": "Biochemical pharmacology", "date": "2013", "authors": "Cameron RT, Coleman RG, Day JP, Yalla KC, Houslay MD, Adams DR, Shoichet BK, Baillie GS", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "23473803", "url": "https://glygen.org/publication/PubMed/23473803" } ] }, { "title": "Structure and properties of G84R and L99M mutants of human small heat shock protein HspB1 correlating with motor neuropathy.", "journal": "Arch. Biochem. Biophys.", "date": "2013", "authors": "Nefedova VV, Sudnitsyna MV, Strelkov SV, Gusev NB", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "23948568", "url": "https://glygen.org/publication/PubMed/23948568" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6.", "journal": "Journal of structural biology", "date": "2014", "authors": "Weeks SD, Baranova EV, Heirbaut M, Beelen S, Shkumatov AV, Gusev NB, Strelkov SV", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "24382496", "url": "https://glygen.org/publication/PubMed/24382496" } ] }, { "title": "Lysine deacetylase inhibition promotes relaxation of arterial tone and C-terminal acetylation of HSPB6 (Hsp20) in vascular smooth muscle cells.", "journal": "Physiological reports", "date": "2013", "authors": "Chen A, Karolczak-Bayatti M, Sweeney M, Treumann A, Morrissey K, Ulrich SM, Europe-Finner GN, Taggart MJ", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "24400135", "url": "https://glygen.org/publication/PubMed/24400135" } ] }, { "title": "The phosphorylation of Hsp20 enhances its association with amyloid-beta to increase protection against neuronal cell death.", "journal": "Molecular and cellular neurosciences", "date": "2014", "authors": "Cameron RT, Quinn SD, Cairns LS, MacLeod R, Samuel ID, Smith BO, Carlos Penedo J, Baillie GS", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "24859569", "url": "https://glygen.org/publication/PubMed/24859569" } ] }, { "title": "A mechanism of subunit recruitment in human small heat shock protein oligomers.", "journal": "Biochemistry", "date": "2015", "authors": "Delbecq Scott P, Rosenbaum Joel C, Klevit Rachel E", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "26098708", "url": "https://glygen.org/publication/PubMed/26098708" } ] }, { "title": "Heat shock protein 20 (HSP20) is a novel substrate for protein kinase D1 (PKD1).", "journal": "Cell biochemistry and function", "date": "2015", "authors": "Sin YY, Baillie GS", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "26443497", "url": "https://glygen.org/publication/PubMed/26443497" } ] }, { "title": "Phosphorylated Heat Shock Protein 20 (HSPB6) Regulates Transforming Growth Factor-alpha-Induced Migration and Invasion of Hepatocellular Carcinoma Cells.", "journal": "PloS one", "date": "2016", "authors": "Matsushima-Nishiwaki R, Toyoda H, Nagasawa T, Yasuda E, Chiba N, Okuda S, Maeda A, Kaneoka Y, Kumada T, Kozawa O", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "27046040", "url": "https://glygen.org/publication/PubMed/27046040" } ] }, { "title": "The preferential heterodimerization of human small heat shock proteins HSPB1 and HSPB6 is dictated by the N-terminal domain.", "journal": "Arch. Biochem. Biophys.", "date": "2016", "authors": "Heirbaut Michelle, Lermyte Frederik, Martin Esther M, Beelen Steven, Verschueren Tim, Sobott Frank, Strelkov Sergei V, Weeks Stephen D", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "27717639", "url": "https://glygen.org/publication/PubMed/27717639" } ] }, { "title": "Selective inhibition of phosphodiesterases 4, 5 and 9 induces HSP20 phosphorylation and attenuates amyloid beta 1-42-mediated cytotoxicity.", "journal": "FEBS open bio", "date": "2017", "authors": "Cameron RT, Whiteley E, Day JP, Parachikova AI, Baillie GS", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "28097089", "url": "https://glygen.org/publication/PubMed/28097089" } ] }, { "title": "Concatenation of 14-3-3 with partner phosphoproteins as a tool to study their interaction.", "journal": "Scientific reports", "date": "2019-10-18", "authors": "Tugaeva Kristina V, Kalacheva Daria I, Cooley Richard B, Strelkov Sergei V, Sluchanko Nikolai N", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "31628352", "url": "https://glygen.org/publication/PubMed/31628352" } ] }, { "title": "Physico-chemical properties of two point mutants of small heat shock protein HspB6 (Hsp20) with abrogated cardioprotection.", "journal": "Biochimie", "date": "2020", "authors": "Shatov VM, Gusev NB", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ], "reference": [ { "type": "PubMed", "id": "32353387", "url": "https://glygen.org/publication/PubMed/32353387" } ] }, { "title": "The Cardioprotective PKA-Mediated Hsp20 Phosphorylation Modulates Protein Associations Regulating Cytoskeletal Dynamics.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "Vafiadaki E, Arvanitis DA, Eliopoulos AG, Kranias EG, Sanoudou D", "evidence": [ { "database": "iPTMnet", "id": "O14558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14558" } ], "reference": [ { "type": "PubMed", "id": "33339131", "url": "https://glygen.org/publication/PubMed/33339131" } ] }, { "title": "Prevalence of HSPB6 gene variants in peripartum cardiomyopathy: Data from the German PPCM registry.", "journal": "International journal of cardiology", "date": "2023-05-15", "authors": "Pfeffer Tobias J, Auber Bernd, Pabst Brigitte, Agca Kuebra C, Berliner Dominik, K\u00f6nig Tobias, Hilfiker-Kleiner Denise, Bauersachs Johann, Ricke-Hoch Melanie", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ], "reference": [ { "type": "PubMed", "id": "36918127", "url": "https://glygen.org/publication/PubMed/36918127" } ] }, { "title": "HSPB6 Is Depleted in Colon Cancer Patients and Its Expression Is Induced by 5-aza-2'-Deoxycytidine In Vitro.", "journal": "Medicina (Kaunas, Lithuania)", "date": "2023-05-21", "authors": "Almutairi Bader O, Almutairi Mikhlid H, Alrefaei Abdulwahed F, Alkahtani Saad, Alarifi Saud", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ], "reference": [ { "type": "PubMed", "id": "37241227", "url": "https://glygen.org/publication/PubMed/37241227" } ] }, { "title": "Cellular functions of heat shock protein 20 (HSPB6) in cancer: A review.", "journal": "Cellular signalling", "date": "2023-12", "authors": "Wu Yifeng, Zhao Jinjin, Tian Yun, Jin Hongdou", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ], "reference": [ { "type": "PubMed", "id": "37844714", "url": "https://glygen.org/publication/PubMed/37844714" } ] }, { "title": "Overexpression of HSPB6 inhibits osteosarcoma progress through the ERK signaling pathway.", "journal": "Clinical and experimental medicine", "date": "2023-12", "authors": "Guo Liangyu, Xiao Kangwen, Xie Yuanlong, Yang Zhiqiang, Lei Jun, Cai Lin", "evidence": [ { "database": "RefSeq", "id": "NP_653218", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_653218" } ], "reference": [ { "type": "PubMed", "id": "37861934", "url": "https://glygen.org/publication/PubMed/37861934" } ] }, { "title": "Purification and characterization of a 20-kDa protein that is highly homologous to alpha B crystallin.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Kato K, Goto S, Inaguma Y, Hasegawa K, Morishita R, Asano T", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "reference": [ { "type": "PubMed", "id": "8195168", "url": "https://glygen.org/publication/PubMed/8195168" } ] } ], "pathway": [ { "id": "hsa:126393", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:126393", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P82147-1", "protein_name": "Protein lethal(2)essential for life", "gene_name": "l(2)efl", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKEDNAKKVETSTA", "length": 187 }, "evidence": [ { "id": "O14558", "url": "https://omabrowser.org/oma/group/O14558/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P97541-1", "protein_name": "Heat shock protein beta-6", "gene_name": "Hspb6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK", "length": 162 }, "evidence": [ { "id": "45922112", "url": "http://www.informatics.jax.org/homology/45922112", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5EBG6-1", "protein_name": "Heat shock protein beta-6", "gene_name": "Hspb6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGFSAPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVSTDSGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQAQLPSPPAAK", "length": 162 }, "evidence": [ { "id": "45922112", "url": "http://www.informatics.jax.org/homology/45922112", "database": "MGI" }, { "id": "O14558", "url": "https://omabrowser.org/oma/group/O14558/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "structural constituent of eye lens", "id": "GO:0005212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005212", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "protein-folding chaperone binding", "id": "GO:0051087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "protein folding chaperone", "id": "GO:0044183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044183", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "response to heat", "id": "GO:0009408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009408", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "protein refolding", "id": "GO:0042026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042026", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" }, { "name": "chaperone-mediated protein folding", "id": "GO:0061077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061077", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated at Ser-16 by PKA and probably PKD1K; required to protect cardiomyocytes from apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "PubMed", "id": "26443497", "url": "https://glygen.org/publication/PubMed/26443497" } ] }, { "annotation": "The N-terminus is blocked.", "evidence": [ { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558" }, { "database": "PubMed", "id": "8195168", "url": "https://glygen.org/publication/PubMed/8195168" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 16, 59 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }