{ "uniprot_canonical_ac": "O14543-1", "uniprot_ac": "O14543", "uniprot_id": "SOCS3_HUMAN", "mass": { "chemical_mass": 24770.0, "monoisotopic_mass": 24770.0 }, "refseq": { "ac": "NP_003946", "name": "suppressor of cytokine signaling 3", "summary": "This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" }, "gene_names": [ { "name": "SOCS3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14543", "id": "O14543" }, { "name": "ATOD4; CIS3; Cish3; SOCS-3; SSI-3; SSI3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946", "id": "NP_003946" }, { "name": "CIS3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14543", "id": "O14543" }, { "name": "SOCS3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946", "id": "NP_003946" }, { "name": "SSI3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14543", "id": "O14543" } ], "protein_names": [ { "name": "Suppressor of cytokine signaling 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14543" }, { "name": "CIS-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14543" }, { "name": "Cytokine-inducible SH2 protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14543" }, { "name": "SOCS-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14543" }, { "name": "SSI-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14543" }, { "name": "STAT-induced STAT inhibitor 3; cytokine-inducible SH2 protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946", "id": "NP_003946" }, { "name": "STAT-induced STAT inhibitor 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14543" }, { "name": "suppressor of cytokine signaling 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946", "id": "NP_003946" } ], "function": [ { "annotation": "DNA methylation at the suppressor of cytokine signaling 3 (SOCS3) gene influences height in childhood. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" }, { "database": "PubMed", "id": "37626025", "url": "https://glygen.org/publication/PubMed/37626025" } ] }, { "annotation": "Enterovirus D68 infection upregulates SOCS3 expression to inhibit JAK-STAT3 signaling and antagonize the innate interferon response of the host.", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" }, { "database": "PubMed", "id": "37657555", "url": "https://glygen.org/publication/PubMed/37657555" } ] }, { "annotation": "Resistin stimulates PC-3 prostate cancer cell growth through stimulation of SOCS3 and SOCS5 genes.", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" }, { "database": "PubMed", "id": "37646261", "url": "https://glygen.org/publication/PubMed/37646261" } ] }, { "annotation": "SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity and regulates IL6 signaling. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells (By similarity). Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15601820).", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543#function" }, { "database": "UniProtKB", "id": "O35718", "url": "https://www.uniprot.org/uniprot/O35718#function" }, { "database": "PubMed", "id": "15601820", "url": "https://glygen.org/publication/PubMed/15601820" } ] }, { "annotation": "Suppressor of Cytokine Signaling-3 Gene Polymorphisms and the Risk of Hepatocellular Carcinoma in Chronic Hepatitis C Patients in Egypt. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" }, { "database": "PubMed", "id": "38156861", "url": "https://glygen.org/publication/PubMed/38156861" } ] }, { "annotation": "This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" } ] }, { "annotation": "Unleashing Breast Cancer Progression: miR-455-5p's Targeting of SOCS3 Drives Proliferation, Migration, and Invasion.", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" }, { "database": "PubMed", "id": "38013437", "url": "https://glygen.org/publication/PubMed/38013437" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs868456388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868456388" }, { "id": "rs868456388", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs868456388" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 13, "end_pos": 13, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "78359059", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S13", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O14543", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14543" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 13, "end_pos": 13, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "78359058", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S13", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 22, "end_pos": 22, "sequence_org": "L", "sequence_mut": "A", "comment": "Little effect on EPO-induced STAT5 signaling suppression.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 22, "end_pos": 22, "sequence_org": "L", "sequence_mut": "D", "comment": "Complete loss of EPO-induced STAT5 signaling suppression. No suppression of JAK2 phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 22, "end_pos": 22, "sequence_org": "L", "sequence_mut": "F", "comment": "Little effect on EPO-induced STAT5 signaling suppression.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 25, "end_pos": 25, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete loss of EPO-induced STAT5 signaling suppression. Abolishes binding to JH1.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 30, "end_pos": 30, "sequence_org": "E", "sequence_mut": "R", "comment": "Partial loss of EPO-induced STAT5 signaling suppression. No effect on LIF-induced signaling suppression. Abolishes binding to JH1. Inhibits JAK2 phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 31, "end_pos": 31, "sequence_org": "Y", "sequence_mut": "A", "comment": "Complete loss of EPO-induced STAT5 signaling suppression. No effect on LIF-induced STAT3 signaling. Abolishes binding to JH1.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 31, "end_pos": 31, "sequence_org": "Y", "sequence_mut": "F", "comment": "Little effect on EPO-induced signaling suppression.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 34, "end_pos": 34, "sequence_org": "V", "sequence_mut": "E", "comment": "Complete loss of EPO/LIF-induced signaling suppression.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 41, "end_pos": 41, "sequence_org": "L", "sequence_mut": "R", "comment": "Complete loss of EPO/LIF-induced signaling inhibition. Abolishes binding to JH1.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 45, "end_pos": 45, "sequence_org": "G", "sequence_mut": "A", "comment": "Little effect on EPO/LIF signaling.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "G", "sequence_mut": "V", "comment": "No effect on binding to Y429/Y431 phosphorylated EPOR.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "12027890", "url": "https://glygen.org/publication/PubMed/12027890" } ] }, { "start_pos": 58, "end_pos": 58, "sequence_org": "L", "sequence_mut": "A", "comment": "Impaired binding to Y429/Y431 phosphorylated EPOR.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "12027890", "url": "https://glygen.org/publication/PubMed/12027890" } ] }, { "start_pos": 71, "end_pos": 71, "sequence_org": "R", "sequence_mut": "E", "comment": "Complete loss of EPO/LIF-induced signaling suppression. No inhibition of JAK2 phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" }, { "database": "PubMed", "id": "14559241", "url": "https://glygen.org/publication/PubMed/14559241" } ] }, { "start_pos": 71, "end_pos": 71, "sequence_org": "R", "sequence_mut": "K", "comment": "No effect on EPO/LIF-induced signaling suppression. Partial suppression of JAK2 phosphorylation. No effect on binding to JH1. Loss of binding to IL12RB2.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" }, { "database": "PubMed", "id": "14559241", "url": "https://glygen.org/publication/PubMed/14559241" } ] }, { "start_pos": 93, "end_pos": 93, "sequence_org": "L", "sequence_mut": "A", "comment": "Impaired binding to Y429/Y431 phosphorylated EPOR.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "12027890", "url": "https://glygen.org/publication/PubMed/12027890" } ] }, { "start_pos": 94, "end_pos": 94, "sequence_org": "R", "sequence_mut": "E", "comment": "Greatly impaired binding to Y429/Y431 phosphorylated EPOR.", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "PubMed", "id": "12027890", "url": "https://glygen.org/publication/PubMed/12027890" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "80.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "70.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "77.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "74.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "88.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "60.47", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "75.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "78.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "88.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14543" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "common_name": "Human" } ], "gene": [ { "name": "SOCS3", "url": "https://www.uniprot.org/uniprot/O14543", "locus": { "chromosome": "17", "start_pos": 8301, "end_pos": 4999, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_619", "url": "https://www.ensembl.org/id/LRG_619" } ] } } ], "crossref": [ { "id": "ENSG00000184557", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184557", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O14543", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14543", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd03737", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03737", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10384", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10384", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "SOCS3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SOCS3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9021", "url": "https://www.ncbi.nlm.nih.gov/gene/9021", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "19391", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=19391", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14543", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14543*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000980", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000980", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001496", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001496", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028414", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028414", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036036", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036036", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9021", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9021", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604176", "url": "http://www.omim.org/entry/604176", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14543", "url": "https://www.nextprot.org/entry/NX_O14543", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14543", "url": "https://oglcnac.org/atlas/detail/O14543", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O14543", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14543", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "KLVHYYM", "url": "https://omabrowser.org/oma/group/KLVHYYM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5362214at2759", "url": "http://www.orthodb.org/?query=5362214at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10155", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10155", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10155:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10155:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00017", "url": "http://pfam.xfam.org/family/PF00017", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14543", "url": "https://pharos.nih.gov/targets/O14543", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14543", "url": "http://purl.obolibrary.org/obo/PR_O14543", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-877312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8939242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939242", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "K7EIF6", "url": "https://www.uniprot.org/uniprot/K7EIF6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EIF6-1", "url": "https://www.uniprot.org/uniprot/K7EIF6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14543-1", "url": "https://www.uniprot.org/uniprot/O14543-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL", "length": 225, "header": "sp|O14543-1|SOCS3_HUMAN Isoform 1 of Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1 CANONICAL=O14543-1" }, "isoforms": [ { "isoform_ac": "K7EIF6-1", "url": "", "sequence": { "sequence": "MVTHSKFPAAGMSRP", "length": 15, "header": "tr|K7EIF6-1|K7EIF6_HUMAN Computationally mapped isoform of Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=4 SV=8 CANONICAL=O14543-1" }, "locus": { "chromosome": "17", "start_pos": 78359095, "end_pos": 78359051, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587578.1", "url": "https://www.ensembl.org/id/ENST00000587578.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464727.1", "url": "https://www.ensembl.org/id/ENSP00000464727.1" } ] } }, { "isoform_ac": "O14543-1", "url": "", "sequence": { "sequence": "MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL", "length": 225, "header": "sp|O14543-1|SOCS3_HUMAN Isoform 1 of Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1 CANONICAL=O14543-1" }, "locus": { "chromosome": "17", "start_pos": 78359095, "end_pos": 78358421, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000330871.3", "url": "https://www.ensembl.org/id/ENST00000330871.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000330341.2", "url": "https://www.ensembl.org/id/ENSP00000330341.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 13, "start_aa": "Ser", "end_pos": 13, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser13", "evidence": [ { "id": "O14543", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14543" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "O14543", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14543" } ] } ], "phosphorylation": [ { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "P06239-1", "kinase_gene_name": "LCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O14543", "url": "http://phospho.elm.eu.org/byAccession/O14543.html" }, { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" }, { "database": "PubMed", "id": "12783885", "url": "https://glygen.org/publication/PubMed/12783885" } ], "site_lbl": "Tyr204" }, { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" }, { "database": "PubMed", "id": "12783885", "url": "https://glygen.org/publication/PubMed/12783885" } ], "site_lbl": "Tyr204" }, { "start_pos": 221, "end_pos": 221, "kinase_uniprot_canonical_ac": "P06239-1", "kinase_gene_name": "LCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O14543", "url": "http://phospho.elm.eu.org/byAccession/O14543.html" }, { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" }, { "database": "PubMed", "id": "15173187", "url": "https://glygen.org/publication/PubMed/15173187" } ], "site_lbl": "Tyr221" }, { "start_pos": 221, "end_pos": 221, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "O14543", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14543*" }, { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" }, { "database": "PubMed", "id": "11331873", "url": "https://glygen.org/publication/PubMed/11331873" }, { "database": "phospho.ELM", "id": "O14543", "url": "http://phospho.elm.eu.org/byAccession/O14543.html" }, { "database": "PubMed", "id": "12783885", "url": "https://glygen.org/publication/PubMed/12783885" } ], "site_lbl": "Tyr221" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Shp-2 tyrosine phosphatase functions as a negative regulator of the interferon-stimulated Jak/STAT pathway.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "You M, Yu DH, Feng GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "10022928", "url": "https://glygen.org/publication/PubMed/10022928" } ] }, { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "The JAK-binding protein JAB inhibits Janus tyrosine kinase activity through binding in the activation loop.", "journal": "The EMBO journal", "date": "1999", "authors": "Yasukawa H, Misawa H, Sakamoto H, Masuhara M, Sasaki A, Wakioka T, Ohtsuka S, Imaizumi T, Matsuda T, Ihle JN, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-877312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312" } ], "reference": [ { "type": "PubMed", "id": "10064597", "url": "https://glygen.org/publication/PubMed/10064597" } ] }, { "title": "Inhibition of transforming growth factor-beta/SMAD signalling by the interferon-gamma/STAT pathway.", "journal": "Nature", "date": "1999", "authors": "Ulloa L, Doody J, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10067896", "url": "https://glygen.org/publication/PubMed/10067896" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Determination of residues involved in ligand binding and signal transmission in the human IFN-alpha receptor 2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Chuntharapai A, Gibbs V, Lu J, Ow A, Marsters S, Ashkenazi A, De Vos A, Jin Kim K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10395669", "url": "https://glygen.org/publication/PubMed/10395669" } ] }, { "title": "Cytokine-inducible SH2 protein-3 (CIS3/SOCS3) inhibits Janus tyrosine kinase by binding through the N-terminal kinase inhibitory region as well as SH2 domain.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "1999", "authors": "Sasaki A, Yasukawa H, Suzuki A, Kamizono S, Syoda T, Kinjyo I, Sasaki M, Johnston JA, Yoshimura A", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "Reactome", "id": "R-HSA-877312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312" } ], "reference": [ { "type": "PubMed", "id": "10421843", "url": "https://glygen.org/publication/PubMed/10421843" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "The role of SOCS-3 in leptin signaling and leptin resistance.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Bjorbaek C, El-Haschimi K, Frantz JD, Flier JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "10514492", "url": "https://glygen.org/publication/PubMed/10514492" } ] }, { "title": "Identification of the von Hippel-lindau tumor-suppressor protein as part of an active E3 ubiquitin ligase complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Iwai K, Yamanaka K, Kamura T, Minato N, Conaway RC, Conaway JW, Klausner RD, Pause A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10535940", "url": "https://glygen.org/publication/PubMed/10535940" } ] }, { "title": "Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.", "journal": "Nature", "date": "1999", "authors": "Aritomi M, Kunishima N, Okamoto T, Kuroki R, Ota Y, Morikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "10537111", "url": "https://glygen.org/publication/PubMed/10537111" } ] }, { "title": "Catalytically active TYK2 is essential for interferon-beta-mediated phosphorylation of STAT3 and interferon-alpha receptor-1 (IFNAR-1) but not for activation of phosphoinositol 3-kinase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rani MR, Leaman DW, Han Y, Leung S, Croze E, Fish EN, Wolfman A, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10542297", "url": "https://glygen.org/publication/PubMed/10542297" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Covalent modification of all members of human cullin family proteins by NEDD8.", "journal": "Oncogene", "date": "1999", "authors": "Hori T, Osaka F, Chiba T, Miyamoto C, Okabayashi K, Shimbara N, Kato S, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10597293", "url": "https://glygen.org/publication/PubMed/10597293" } ] }, { "title": "Association of src-kinase Lyn and non-src-kinase Syk with the granulocyte colony-stimulating factor receptor (G-CSFR) is not abrogated in neutrophils from severe congenital neutropenia patients with point mutations in the G-CSFR mRNA.", "journal": "International journal of hematology", "date": "1999", "authors": "Kasper B, Tidow N, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "10643150", "url": "https://glygen.org/publication/PubMed/10643150" } ] }, { "title": "Selective interaction between leptin and insulin signaling pathways in a hepatic cell line.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Szanto I, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "10688912", "url": "https://glygen.org/publication/PubMed/10688912" } ] }, { "title": "SOCS3 exerts its inhibitory function on interleukin-6 signal transduction through the SHP2 recruitment site of gp130.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Schmitz J, Weissenbach M, Haan S, Heinrich PC, Schaper F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "10777583", "url": "https://glygen.org/publication/PubMed/10777583" } ] }, { "title": "Distinct roles of the NH2- and COOH-terminal domains of the protein inhibitor of activated signal transducer and activator of transcription (STAT) 1 (PIAS1) in cytokine-induced PIAS1-Stat1 interaction.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Liao J, Fu Y, Shuai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-877312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312" } ], "reference": [ { "type": "PubMed", "id": "10805787", "url": "https://glygen.org/publication/PubMed/10805787" } ] }, { "title": "A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.", "journal": "The EMBO journal", "date": "2000", "authors": "Meyer HH, Shorter JG, Seemann J, Pappin D, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10811609", "url": "https://glygen.org/publication/PubMed/10811609" } ] }, { "title": "Serine phosphorylation of STATs.", "journal": "Oncogene", "date": "2000", "authors": "Decker T, Kovarik P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "10851062", "url": "https://glygen.org/publication/PubMed/10851062" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "Ubiquitination of hypoxia-inducible factor requires direct binding to the beta-domain of the von Hippel-Lindau protein.", "journal": "Nature cell biology", "date": "2000", "authors": "Ohh M, Park CW, Ivan M, Hoffman MA, Kim TY, Huang LE, Pavletich N, Chau V, Kaelin WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10878807", "url": "https://glygen.org/publication/PubMed/10878807" } ] }, { "title": "Homology modeling of human leptin/leptin receptor complex.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Hiroike T, Higo J, Jingami H, Toh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "10944457", "url": "https://glygen.org/publication/PubMed/10944457" } ] }, { "title": "Activation of HIF1alpha ubiquitination by a reconstituted von Hippel-Lindau (VHL) tumor suppressor complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Kamura T, Sato S, Iwai K, Czyzyk-Krzeska M, Conaway RC, Conaway JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10973499", "url": "https://glygen.org/publication/PubMed/10973499" } ] }, { "title": "Regulation of STAT1 nuclear export by Jak1.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mowen K, David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10982844", "url": "https://glygen.org/publication/PubMed/10982844" } ] }, { "title": "Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "Thiel DJ, le Du MH, Walter RL, D'Arcy A, Chene C, Fountoulakis M, Garotta G, Winkler FK, Ealick SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10986460", "url": "https://glygen.org/publication/PubMed/10986460" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "Two new proteases in the MHC class I processing pathway.", "journal": "Nature immunology", "date": "2000", "authors": "Stoltze L, Schirle M, Schwarz G, Schroter C, Thompson MW, Hersh LB, Kalbacher H, Stevanovic S, Rammensee HG, Schild H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11062501", "url": "https://glygen.org/publication/PubMed/11062501" } ] }, { "title": "The ubiquitin-proteasome pathway regulates survivin degradation in a cell cycle-dependent manner.", "journal": "Journal of cell science", "date": "2000", "authors": "Zhao J, Tenev T, Martins LM, Downward J, Lemoine NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11069780", "url": "https://glygen.org/publication/PubMed/11069780" } ] }, { "title": "Suppressor of cytokine signaling (SOCS)-3 protein interacts with the insulin-like growth factor-I receptor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Dey B R, Furlanetto R W, Nissley P", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "11071852", "url": "https://glygen.org/publication/PubMed/11071852" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Gene structure and function of the 2'-5'-oligoadenylate synthetase family.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2000", "authors": "Justesen J, Hartmann R, Kjeldgaard NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11092454", "url": "https://glygen.org/publication/PubMed/11092454" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Soluble gp130 is the natural inhibitor of soluble interleukin-6 receptor transsignaling responses.", "journal": "European journal of biochemistry", "date": "2001", "authors": "Jostock T, Mullberg J, Ozbek S, Atreya R, Blinn G, Voltz N, Fischer M, Neurath MF, Rose-John S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "11121117", "url": "https://glygen.org/publication/PubMed/11121117" } ] }, { "title": "NUB1, a NEDD8-interacting protein, is induced by interferon and down-regulates the NEDD8 expression.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kito K, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11259415", "url": "https://glygen.org/publication/PubMed/11259415" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "Targeting of HIF-alpha to the von Hippel-Lindau ubiquitylation complex by O2-regulated prolyl hydroxylation.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Jaakkola P, Mole DR, Tian YM, Wilson MI, Gielbert J, Gaskell SJ, von Kriegsheim A, Hebestreit HF, Mukherji M, Schofield CJ, Maxwell PH, Pugh CW, Ratcliffe PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11292861", "url": "https://glygen.org/publication/PubMed/11292861" } ] }, { "title": "HIFalpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O2 sensing.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Ivan M, Kondo K, Yang H, Kim W, Valiando J, Ohh M, Salic A, Asara JM, Lane WS, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11292862", "url": "https://glygen.org/publication/PubMed/11292862" } ] }, { "title": "Tyrosine-phosphorylated SOCS-3 inhibits STAT activation but binds to p120 RasGAP and activates Ras.", "journal": "Nature cell biology", "date": "2001", "authors": "Cacalano NA, Sanden D, Johnston JA", "evidence": [ { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" } ], "reference": [ { "type": "PubMed", "id": "11331873", "url": "https://glygen.org/publication/PubMed/11331873" } ] }, { "title": "Inositol hexakisphosphate kinase 2 mediates growth suppressive and apoptotic effects of interferon-beta in ovarian carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Morrison BH, Bauer JA, Kalvakolanu DV, Lindner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11337497", "url": "https://glygen.org/publication/PubMed/11337497" } ] }, { "title": "26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide.", "journal": "The EMBO journal", "date": "2001", "authors": "Cascio P, Hilton C, Kisselev AF, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11350924", "url": "https://glygen.org/publication/PubMed/11350924" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Effect of early interferon treatment on conversion to definite multiple sclerosis: a randomised study.", "journal": "Lancet (London, England)", "date": "2001", "authors": "Comi G, Filippi M, Barkhof F, Durelli L, Edan G, Fernandez O, Hartung H, Seeldrayers P, Sorensen PS, Rovaris M, Martinelli V, Hommes OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11377645", "url": "https://glygen.org/publication/PubMed/11377645" } ] }, { "title": "Functional classification of interferon-stimulated genes identified using microarrays.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "de Veer MJ, Holko M, Frevel M, Walker E, Der S, Paranjape JM, Silverman RH, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11404376", "url": "https://glygen.org/publication/PubMed/11404376" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Leptin receptor long-form signalling in a human liver cell line.", "journal": "Cytokine", "date": "2001", "authors": "Briscoe CP, Hanif S, Arch JR, Tadayyon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "11448122", "url": "https://glygen.org/publication/PubMed/11448122" } ] }, { "title": "Hypoxia-inducible factor-1 alpha (HIF-1 alpha) escapes O(2)-driven proteasomal degradation irrespective of its subcellular localization: nucleus or cytoplasm.", "journal": "EMBO reports", "date": "2001", "authors": "Berra E, Roux D, Richard DE, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11454738", "url": "https://glygen.org/publication/PubMed/11454738" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "The 2-5A/RNase L/RNase L inhibitor (RLI) [correction of (RNI)] pathway regulates mitochondrial mRNAs stability in interferon alpha-treated H9 cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Le Roy F, Bisbal C, Silhol M, Martinand C, Lebleu B, Salehzada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11585831", "url": "https://glygen.org/publication/PubMed/11585831" } ] }, { "title": "Targeting of NEDD8 and its conjugates for proteasomal degradation by NUB1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kamitani T, Kito K, Fukuda-Kamitani T, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11585840", "url": "https://glygen.org/publication/PubMed/11585840" } ] }, { "title": "TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Myers MP, Andersen JN, Cheng A, Tremblay ML, Horvath CM, Parisien JP, Salmeen A, Barford D, Tonks NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "11694501", "url": "https://glygen.org/publication/PubMed/11694501" } ] }, { "title": "Mobilization of processed, membrane-tethered SPT23 transcription factor by CDC48(UFD1/NPL4), a ubiquitin-selective chaperone.", "journal": "Cell", "date": "2001", "authors": "Rape M, Hoppe T, Gorr I, Kalocay M, Richly H, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11733065", "url": "https://glygen.org/publication/PubMed/11733065" } ] }, { "title": "Human leptin activates PI3K and MAPK pathways in human peripheral blood mononuclear cells: possible role of Sam68.", "journal": "Cellular immunology", "date": "2001", "authors": "Martin-Romero C, Sanchez-Margalet V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "11748924", "url": "https://glygen.org/publication/PubMed/11748924" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.", "journal": "Nature", "date": "2002", "authors": "Zheng N, Schulman BA, Song L, Miller JJ, Jeffrey PD, Wang P, Chu C, Koepp DM, Elledge SJ, Pagano M, Conaway RC, Conaway JW, Harper JW, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11961546", "url": "https://glygen.org/publication/PubMed/11961546" } ] }, { "title": "Requirement of Ca2+ and CaMKII for Stat1 Ser-727 phosphorylation in response to IFN-gamma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Nair JS, DaFonseca CJ, Tjernberg A, Sun W, Darnell JE Jr, Chait BT, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "11972023", "url": "https://glygen.org/publication/PubMed/11972023" } ] }, { "title": "A new high affinity binding site for suppressor of cytokine signaling-3 on the erythropoietin receptor.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Hortner M, Nielsch U, Mayr LM, Heinrich PC, Haan S", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "12027890", "url": "https://glygen.org/publication/PubMed/12027890" } ] }, { "title": "Identification of X-linked inhibitor of apoptosis-associated factor-1 as an interferon-stimulated gene that augments TRAIL Apo2L-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Leaman DW, Chawla-Sarkar M, Vyas K, Reheman M, Tamai K, Toji S, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12029096", "url": "https://glygen.org/publication/PubMed/12029096" } ] }, { "title": "A road map for those who don't know JAK-STAT.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Aaronson DS, Horvath CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12040185", "url": "https://glygen.org/publication/PubMed/12040185" } ] }, { "title": "Oxygen-dependent ubiquitination and degradation of hypoxia-inducible factor requires nuclear-cytoplasmic trafficking of the von Hippel-Lindau tumor suppressor protein.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Groulx I, Lee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12101228", "url": "https://glygen.org/publication/PubMed/12101228" } ] }, { "title": "Suppressor of cytokine signaling-3 is recruited to the activated granulocyte-colony stimulating factor receptor and modulates its signal transduction.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Hortner M, Nielsch U, Mayr LM, Johnston JA, Heinrich PC, Haan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "12133942", "url": "https://glygen.org/publication/PubMed/12133942" } ] }, { "title": "Analysis of the adenovirus E1B-55K-anchored proteome reveals its link to ubiquitination machinery.", "journal": "Journal of virology", "date": "2002", "authors": "Harada JN, Shevchenko A, Shevchenko A, Pallas DC, Berk AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12186903", "url": "https://glygen.org/publication/PubMed/12186903" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "Seeing the light: preassembly and ligand-induced changes of the interferon gamma receptor complex in cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2002", "authors": "Krause CD, Mei E, Xie J, Jia Y, Bopp MA, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12438563", "url": "https://glygen.org/publication/PubMed/12438563" } ] }, { "title": "Y-box-binding protein YB-1 mediates transcriptional repression of human alpha 2(I) collagen gene expression by interferon-gamma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Suzuki N, Mitsui S, Mauviel A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12446674", "url": "https://glygen.org/publication/PubMed/12446674" } ] }, { "title": "Therapeutic benefit of blocking interleukin-6 activity with an anti-interleukin-6 receptor monoclonal antibody in rheumatoid arthritis: a randomized, double-blind, placebo-controlled, dose-escalation trial.", "journal": "Arthritis and rheumatism", "date": "2002", "authors": "Choy EH, Isenberg DA, Garrood T, Farrow S, Ioannou Y, Bird H, Cheung N, Williams B, Hazleman B, Price R, Yoshizaki K, Nishimoto N, Kishimoto T, Panayi GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "12483717", "url": "https://glygen.org/publication/PubMed/12483717" } ] }, { "title": "NEDD8 modification of CUL1 dissociates p120(CAND1), an inhibitor of CUL1-SKP1 binding and SCF ligases.", "journal": "Molecular cell", "date": "2002", "authors": "Liu J, Furukawa M, Matsumoto T, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12504025", "url": "https://glygen.org/publication/PubMed/12504025" } ] }, { "title": "CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.", "journal": "Molecular cell", "date": "2002", "authors": "Zheng J, Yang X, Harrell JM, Ryzhikov S, Shim EH, Lykke-Andersen K, Wei N, Sun H, Kobayashi R, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12504026", "url": "https://glygen.org/publication/PubMed/12504026" } ] }, { "title": "Inhibition of the cysteine proteinases cathepsins K and L by the serpin headpin (SERPINB13): a kinetic analysis.", "journal": "Archives of biochemistry and biophysics", "date": "2003", "authors": "Jayakumar A, Kang Y, Frederick MJ, Pak SC, Henderson Y, Holton PR, Mitsudo K, Silverman GA, EL-Naggar AK, Bromme D, Clayman GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939242" } ], "reference": [ { "type": "PubMed", "id": "12504904", "url": "https://glygen.org/publication/PubMed/12504904" } ] }, { "title": "Parc: a cytoplasmic anchor for p53.", "journal": "Cell", "date": "2003", "authors": "Nikolaev AY, Li M, Puskas N, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12526791", "url": "https://glygen.org/publication/PubMed/12526791" } ] }, { "title": "Multiple splice variants of the human HIF-3 alpha locus are targets of the von Hippel-Lindau E3 ubiquitin ligase complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Maynard MA, Qi H, Chung J, Lee EH, Kondo Y, Hara S, Conaway RC, Conaway JW, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12538644", "url": "https://glygen.org/publication/PubMed/12538644" } ] }, { "title": "STAP-2/BKS, an adaptor/docking protein, modulates STAT3 activation in acute-phase response through its YXXQ motif.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Minoguchi M, Minoguchi S, Aki D, Joo A, Yamamoto T, Yumioka T, Matsuda T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "12540842", "url": "https://glygen.org/publication/PubMed/12540842" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "TIP120A associates with cullins and modulates ubiquitin ligase activity.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Min KW, Hwang JW, Lee JS, Park Y, Tamura TA, Yoon JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12609982", "url": "https://glygen.org/publication/PubMed/12609982" } ] }, { "title": "U-box proteins as a new family of ubiquitin ligases.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hatakeyama S, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "12646216", "url": "https://glygen.org/publication/PubMed/12646216" } ] }, { "title": "Keap1-dependent proteasomal degradation of transcription factor Nrf2 contributes to the negative regulation of antioxidant response element-driven gene expression.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "McMahon M, Itoh K, Yamamoto M, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12682069", "url": "https://glygen.org/publication/PubMed/12682069" } ] }, { "title": "Activation of the leptin receptor by a ligand-induced conformational change of constitutive receptor dimers.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Couturier C, Jockers R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "12734179", "url": "https://glygen.org/publication/PubMed/12734179" } ] }, { "title": "DEN1 is a dual function protease capable of processing the C terminus of Nedd8 and deconjugating hyper-neddylated CUL1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu K, Yamoah K, Dolios G, Gan-Erdene T, Tan P, Chen A, Lee CG, Wei N, Wilkinson KD, Wang R, Pan ZQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12759363", "url": "https://glygen.org/publication/PubMed/12759363" } ] }, { "title": "Apoptosis and interferons: role of interferon-stimulated genes as mediators of apoptosis.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2003", "authors": "Chawla-Sarkar M, Lindner DJ, Liu YF, Williams BR, Sen GC, Silverman RH, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12766484", "url": "https://glygen.org/publication/PubMed/12766484" } ] }, { "title": "Tyrosine phosphorylation disrupts elongin interaction and accelerates SOCS3 degradation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Haan S, Ferguson P, Sommer U, Hiremath M, McVicar DW, Heinrich PC, Johnston JA, Cacalano NA", "evidence": [ { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" } ], "reference": [ { "type": "PubMed", "id": "12783885", "url": "https://glygen.org/publication/PubMed/12783885" } ] }, { "title": "Hurpin is a selective inhibitor of lysosomal cathepsin L and protects keratinocytes from ultraviolet-induced apoptosis.", "journal": "Biochemistry", "date": "2003", "authors": "Welss T, Sun J, Irving JA, Blum R, Smith AI, Whisstock JC, Pike RN, von Mikecz A, Ruzicka T, Bird PI, Abts HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939242" } ], "reference": [ { "type": "PubMed", "id": "12809493", "url": "https://glygen.org/publication/PubMed/12809493" } ] }, { "title": "Regulation of the NEDD8 conjugation system by a splicing variant, NUB1L.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tanaka T, Kawashima H, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12816948", "url": "https://glygen.org/publication/PubMed/12816948" } ] }, { "title": "Hexameric structure and assembly of the interleukin-6/IL-6 alpha-receptor/gp130 complex.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Boulanger MJ, Chow DC, Brevnova EE, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "12829785", "url": "https://glygen.org/publication/PubMed/12829785" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "The human type I interferon receptor: NMR structure reveals the molecular basis of ligand binding.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Chill JH, Quadt SR, Levy R, Schreiber G, Anglister J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12842042", "url": "https://glygen.org/publication/PubMed/12842042" } ] }, { "title": "PIAS proteins promote SUMO-1 conjugation to STAT1.", "journal": "Blood", "date": "2003", "authors": "Ungureanu D, Vanhatupa S, Kotaja N, Yang J, Aittomaki S, Janne OA, Palvimo JJ, Silvennoinen O", "evidence": [ { "database": "Reactome", "id": "R-HSA-877312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312" } ], "reference": [ { "type": "PubMed", "id": "12855578", "url": "https://glygen.org/publication/PubMed/12855578" } ] }, { "title": "A peptide derived from the human leptin molecule is a potent inhibitor of the leptin receptor function in rabbit endometrial cells.", "journal": "Endocrine", "date": "2003", "authors": "Gonzalez RR, Leavis PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "12897384", "url": "https://glygen.org/publication/PubMed/12897384" } ] }, { "title": "Identification of protein tyrosine phosphatases with specificity for the ligand-activated growth hormone receptor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003", "authors": "Pasquali C, Curchod ML, Walchli S, Espanel X, Guerrier M, Arigoni F, Strous G, Hooft van Huijsduijnen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "12907755", "url": "https://glygen.org/publication/PubMed/12907755" } ] }, { "title": "The ins and outs of STAT1 nuclear transport.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2003", "authors": "McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12915721", "url": "https://glygen.org/publication/PubMed/12915721" } ] }, { "title": "Stoichiometry of interaction between interferon gamma and its receptor.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Fountoulakis M, Zulauf M, Lustig A, Garotta G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1396683", "url": "https://glygen.org/publication/PubMed/1396683" } ] }, { "title": "Receptor activation and 2 distinct COOH-terminal motifs control G-CSF receptor distribution and internalization kinetics.", "journal": "Blood", "date": "2004", "authors": "Aarts LH, Roovers O, Ward AC, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "14512302", "url": "https://glygen.org/publication/PubMed/14512302" } ] }, { "title": "SOCS-3 inhibits IL-12-induced STAT4 activation by binding through its SH2 domain to the STAT4 docking site in the IL-12 receptor beta2 subunit.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Yamamoto K, Yamaguchi M, Miyasaka N, Miura O", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "14559241", "url": "https://glygen.org/publication/PubMed/14559241" } ] }, { "title": "Interferon-gamma suppresses transforming growth factor-beta-induced invasion of gastric carcinoma cells through cross-talk of Smad pathway in a three-dimensional culture model.", "journal": "Oncogene", "date": "2003", "authors": "Kuga H, Morisaki T, Nakamura K, Onishi H, Noshiro H, Uchiyama A, Tanaka M, Katano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14586410", "url": "https://glygen.org/publication/PubMed/14586410" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.", "journal": "Molecular cell", "date": "2003", "authors": "Walden H, Podgorski MS, Huang DT, Miller DW, Howard RJ, Minor DL Jr, Holton JM, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "14690597", "url": "https://glygen.org/publication/PubMed/14690597" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Interferon-gamma inhibits transforming growth factor-beta production in human airway epithelial cells by targeting Smads.", "journal": "American journal of respiratory cell and molecular biology", "date": "2004", "authors": "Wen FQ, Liu X, Kobayashi T, Abe S, Fang Q, Kohyama T, Ertl R, Terasaki Y, Manouilova L, Rennard SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14722222", "url": "https://glygen.org/publication/PubMed/14722222" } ] }, { "title": "Proteasome and peptidase function in MHC-class-I-mediated antigen presentation.", "journal": "Current opinion in immunology", "date": "2004", "authors": "Kloetzel PM, Ossendorp F", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "14734113", "url": "https://glygen.org/publication/PubMed/14734113" } ] }, { "title": "NEDD8 ultimate buster-1L interacts with the ubiquitin-like protein FAT10 and accelerates its degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Hipp MS, Raasi S, Groettrup M, Schmidtke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "14757770", "url": "https://glygen.org/publication/PubMed/14757770" } ] }, { "title": "Novel growth and death related interferon-stimulated genes (ISGs) in melanoma: greater potency of IFN-beta compared with IFN-alpha2.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2003", "authors": "Leaman DW, Chawla-Sarkar M, Jacobs B, Vyas K, Sun Y, Ozdemir A, Yi T, Williams BR, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "14769151", "url": "https://glygen.org/publication/PubMed/14769151" } ] }, { "title": "Human MxA protein inhibits the replication of Crimean-Congo hemorrhagic fever virus.", "journal": "Journal of virology", "date": "2004", "authors": "Andersson I, Bladh L, Mousavi-Jazi M, Magnusson KE, Lundkvist A, Haller O, Mirazimi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15047845", "url": "https://glygen.org/publication/PubMed/15047845" } ] }, { "title": "BiaCore analysis of leptin-leptin receptor interaction: evidence for 1:1 stoichiometry.", "journal": "Analytical biochemistry", "date": "2004", "authors": "Mistrik P, Moreau F, Allen JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "15051545", "url": "https://glygen.org/publication/PubMed/15051545" } ] }, { "title": "Involvement of casein kinase Iepsilon in cytokine-induced granulocytic differentiation.", "journal": "Blood", "date": "2004", "authors": "Okamura Atsuo, Iwata Nobuko, Nagata Aki, Tamekane Akira, Shimoyama Manabu, Gomyo Hiroshi, Yakushijin Kimikazu, Urahama Norinaga, Hamaguchi Miyuki, Fukui Chie, Chihara Kazuo, Ito Mitsuhiro, Matsui Toshimitsu", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "15070676", "url": "https://glygen.org/publication/PubMed/15070676" } ] }, { "title": "Transcriptional induction of IFN-gamma-responsive genes is modulated by DNA surrounding the interferon stimulation response element.", "journal": "Nucleic acids research", "date": "1992", "authors": "Strehlow I, Decker T", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1508672", "url": "https://glygen.org/publication/PubMed/1508672" } ] }, { "title": "Distinct activities of suppressor of cytokine signaling (SOCS) proteins and involvement of the SOCS box in controlling G-CSF signaling.", "journal": "Journal of leukocyte biology", "date": "2004", "authors": "van de Geijn GJ, Gits J, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "15107455", "url": "https://glygen.org/publication/PubMed/15107455" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Argetsinger LS, Kouadio JL, Steen H, Stensballe A, Jensen ON, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15143187", "url": "https://glygen.org/publication/PubMed/15143187" } ] }, { "title": "Tyrosine-phosphorylated SOCS3 interacts with the Nck and Crk-L adapter proteins and regulates Nck activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sitko JC, Guevara CI, Cacalano NA", "evidence": [ { "database": "iPTMnet", "id": "O14543", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14543" } ], "reference": [ { "type": "PubMed", "id": "15173187", "url": "https://glygen.org/publication/PubMed/15173187" } ] }, { "title": "Generation of major histocompatibility complex class I antigens: functional interplay between proteasomes and TPPII.", "journal": "Nature immunology", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224091", "url": "https://glygen.org/publication/PubMed/15224091" } ] }, { "title": "Post-proteasomal antigen processing for major histocompatibility complex class I presentation.", "journal": "Nature immunology", "date": "2004", "authors": "Rock KL, York IA, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224092", "url": "https://glygen.org/publication/PubMed/15224092" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Oxidative stress sensor Keap1 functions as an adaptor for Cul3-based E3 ligase to regulate proteasomal degradation of Nrf2.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kobayashi A, Kang MI, Okawa H, Ohtsuji M, Zenke Y, Chiba T, Igarashi K, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15282312", "url": "https://glygen.org/publication/PubMed/15282312" } ] }, { "title": "Ligand-induced assembling of the type I interferon receptor on supported lipid bilayers.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Lamken P, Lata S, Gavutis M, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15312780", "url": "https://glygen.org/publication/PubMed/15312780" } ] }, { "title": "SH2-B promotes insulin receptor substrate 1 (IRS1)- and IRS2-mediated activation of the phosphatidylinositol 3-kinase pathway in response to leptin.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Duan C, Li M, Rui L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "15316008", "url": "https://glygen.org/publication/PubMed/15316008" } ] }, { "title": "Protein kinase Cdelta regulates apoptosis via activation of STAT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "DeVries TA, Kalkofen RL, Matassa AA, Reyland ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15322115", "url": "https://glygen.org/publication/PubMed/15322115" } ] }, { "title": "A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Huang DT, Miller DW, Mathew R, Cassell R, Holton JM, Roussel MF, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15361859", "url": "https://glygen.org/publication/PubMed/15361859" } ] }, { "title": "The Keap1-BTB protein is an adaptor that bridges Nrf2 to a Cul3-based E3 ligase: oxidative stress sensing by a Cul3-Keap1 ligase.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cullinan SB, Gordan JD, Jin J, Harper JW, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15367669", "url": "https://glygen.org/publication/PubMed/15367669" } ] }, { "title": "Three-dimensional structures of a humanized anti-IFN-gamma Fab (HuZAF) in two crystal forms.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2004", "authors": "Bourne PC, Terzyan SS, Cloud G, Landolfi NF, Vasquez M, Edmundson AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15388922", "url": "https://glygen.org/publication/PubMed/15388922" } ] }, { "title": "Identification of residues of the IFNAR1 chain of the type I human interferon receptor critical for ligand binding and biological activity.", "journal": "Biochemistry", "date": "2004", "authors": "Cajean-Feroldi C, Nosal F, Nardeux PC, Gallet X, Guymarho J, Baychelier F, Sempe P, Tovey MG, Escary JL, Eid P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15449939", "url": "https://glygen.org/publication/PubMed/15449939" } ] }, { "title": "Human growth hormone and extracellular domain of its receptor: crystal structure of the complex.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "de Vos AM, Ultsch M, Kossiakoff AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "1549776", "url": "https://glygen.org/publication/PubMed/1549776" } ] }, { "title": "Determination of the transphosphorylation sites of Jak2 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Matsuda T, Feng J, Witthuhn BA, Sekine Y, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15530433", "url": "https://glygen.org/publication/PubMed/15530433" } ] }, { "title": "Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases.", "journal": "Cell", "date": "2004", "authors": "Goldenberg SJ, Cascio TC, Shumway SD, Garbutt KC, Liu J, Xiong Y, Zheng N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15537541", "url": "https://glygen.org/publication/PubMed/15537541" } ] }, { "title": "The proteasome and MHC class I antigen processing.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15571818", "url": "https://glygen.org/publication/PubMed/15571818" } ] }, { "title": "Keap1 is a redox-regulated substrate adaptor protein for a Cul3-dependent ubiquitin ligase complex.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zhang DD, Lo SC, Cross JV, Templeton DJ, Hannink M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15572695", "url": "https://glygen.org/publication/PubMed/15572695" } ] }, { "title": "Phosphorylation of a novel SOCS-box regulates assembly of the HIV-1 Vif-Cul5 complex that promotes APOBEC3G degradation.", "journal": "Genes & development", "date": "2004", "authors": "Mehle A, Goncalves J, Santa-Marta M, McPike M, Gabuzda D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15574592", "url": "https://glygen.org/publication/PubMed/15574592" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.", "journal": "Genes & development", "date": "2004", "authors": "Kamura T, Maenaka K, Kotoshiba S, Matsumoto M, Kohda D, Conaway RC, Conaway JW, Nakayama KI", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" }, { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "15601820", "url": "https://glygen.org/publication/PubMed/15601820" } ] }, { "title": "BTB protein Keap1 targets antioxidant transcription factor Nrf2 for ubiquitination by the Cullin 3-Roc1 ligase.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Furukawa M, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15601839", "url": "https://glygen.org/publication/PubMed/15601839" } ] }, { "title": "A series of ubiquitin binding factors connects CDC48/p97 to substrate multiubiquitylation and proteasomal targeting.", "journal": "Cell", "date": "2005", "authors": "Richly H, Rape M, Braun S, Rumpf S, Hoege C, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15652483", "url": "https://glygen.org/publication/PubMed/15652483" } ] }, { "title": "Function and regulation of cullin-RING ubiquitin ligases.", "journal": "Nature reviews. Molecular cell biology", "date": "2005", "authors": "Petroski MD, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15688063", "url": "https://glygen.org/publication/PubMed/15688063" } ] }, { "title": "Structural basis for recruitment of Ubc12 by an E2 binding domain in NEDD8's E1.", "journal": "Molecular cell", "date": "2005", "authors": "Huang DT, Paydar A, Zhuang M, Waddell MB, Holton JM, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15694336", "url": "https://glygen.org/publication/PubMed/15694336" } ] }, { "title": "Kinase activation through dimerization by human SH2-B.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Nishi M, Werner ED, Oh BC, Frantz JD, Dhe-Paganon S, Hansen L, Lee J, Shoelson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "15767667", "url": "https://glygen.org/publication/PubMed/15767667" } ] }, { "title": "Lateral ligand-receptor interactions on membranes probed by simultaneous fluorescence-interference detection.", "journal": "Biophysical journal", "date": "2005", "authors": "Gavutis M, Lata S, Lamken P, Muller P, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15778442", "url": "https://glygen.org/publication/PubMed/15778442" } ] }, { "title": "COMMD proteins, a novel family of structural and functional homologs of MURR1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Burstein E, Hoberg JE, Wilkinson AS, Rumble JM, Csomos RA, Komarck CM, Maine GN, Wilkinson JC, Mayo MW, Duckett CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15799966", "url": "https://glygen.org/publication/PubMed/15799966" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16009940", "url": "https://glygen.org/publication/PubMed/16009940" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Interaction of NUB1 with the proteasome subunit S5a.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Tanji K, Tanaka T, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16171779", "url": "https://glygen.org/publication/PubMed/16171779" } ] }, { "title": "Mutational analysis of the IFNAR1 binding site on IFNalpha2 reveals the architecture of a weak ligand-receptor binding-site.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Roisman LC, Jaitin DA, Baker DP, Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16171819", "url": "https://glygen.org/publication/PubMed/16171819" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Signaling through a mutant IFN-gamma receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Costa-Pereira AP, Hermanns HM, Is'harc H, Williams TM, Watling D, Arulampalam V, Newman SJ, Heinrich PC, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16237089", "url": "https://glygen.org/publication/PubMed/16237089" } ] }, { "title": "STAT3-mediated constitutive expression of SOCS3 in an undifferentiated rat trophoblast-like cell line.", "journal": "Placenta", "date": "2006", "authors": "Isobe A, Takeda T, Sakata M, Yamamoto T, Minekawa R, Hayashi M, Auernhammer CJ, Tasaka K, Murata Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "16300827", "url": "https://glygen.org/publication/PubMed/16300827" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "Targeted silencing of Jab1/Csn5 in human cells downregulates SCF activity through reduction of F-box protein levels.", "journal": "BMC biochemistry", "date": "2006", "authors": "Cope GA, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16401342", "url": "https://glygen.org/publication/PubMed/16401342" } ] }, { "title": "Suppressors of cytokine signaling (SOCS) 1 and SOCS3 interact with and modulate fibroblast growth factor receptor signaling.", "journal": "J. Cell Sci.", "date": "2006", "authors": "Ben-Zvi T, Yayon A, Gertler A, Monsonego-Ornan E", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "16410555", "url": "https://glygen.org/publication/PubMed/16410555" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Preassembly and ligand-induced restructuring of the chains of the IFN-gamma receptor complex: the roles of Jak kinases, Stat1 and the receptor chains.", "journal": "Cell research", "date": "2006", "authors": "Krause CD, Lavnikova N, Xie J, Mei E, Mirochnitchenko OV, Jia Y, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16467876", "url": "https://glygen.org/publication/PubMed/16467876" } ] }, { "title": "Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Tamada T, Honjo E, Maeda Y, Okamoto T, Ishibashi M, Tokunaga M, Kuroki R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "16492764", "url": "https://glygen.org/publication/PubMed/16492764" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Cytoplasmic localized ubiquitin ligase cullin 7 binds to p53 and promotes cell growth by antagonizing p53 function.", "journal": "Oncogene", "date": "2006", "authors": "Andrews P, He YJ, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16547496", "url": "https://glygen.org/publication/PubMed/16547496" } ] }, { "title": "Identification of STAT3 as a specific substrate of breast tumor kinase.", "journal": "Oncogene", "date": "2006", "authors": "Liu L, Gao Y, Qiu H, Miller WT, Poli V, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "16568091", "url": "https://glygen.org/publication/PubMed/16568091" } ] }, { "title": "Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tokgoz Z, Bohnsack RN, Haas AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16595681", "url": "https://glygen.org/publication/PubMed/16595681" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Ubiquitin and SUMO systems in the regulation of mitotic checkpoints.", "journal": "Trends in biochemical sciences", "date": "2006", "authors": "Gutierrez GJ, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16647857", "url": "https://glygen.org/publication/PubMed/16647857" } ] }, { "title": "Elevated expression and genetic association links the SOCS3 gene to atopic dermatitis.", "journal": "Am. J. Hum. Genet.", "date": "2006", "authors": "Ekelund E, Saaf A, Tengvall-Linder M, Melen E, Link J, Barker J, Reynolds N J, Meggitt S J, Kere J, Wahlgren C-F, Pershagen G, Wickman M, Nordenskjold M, Kockum I, Bradley M", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "16685656", "url": "https://glygen.org/publication/PubMed/16685656" } ] }, { "title": "The UBA domains of NUB1L are required for binding but not for accelerated degradation of the ubiquitin-like modifier FAT10.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Schmidtke G, Kalveram B, Weber E, Bochtler P, Lukasiak S, Hipp MS, Groettrup M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16707496", "url": "https://glygen.org/publication/PubMed/16707496" } ] }, { "title": "UBP43 is a novel regulator of interferon signaling independent of its ISG15 isopeptidase activity.", "journal": "The EMBO journal", "date": "2006", "authors": "Malakhova OA, Kim KI, Luo JK, Zou W, Kumar KG, Fuchs SY, Shuai K, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "16710296", "url": "https://glygen.org/publication/PubMed/16710296" } ] }, { "title": "The interaction of G-CSF with its receptor.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2006", "authors": "Layton JE, Hall NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "16720384", "url": "https://glygen.org/publication/PubMed/16720384" } ] }, { "title": "Dimerization of substrate adaptors can facilitate cullin-mediated ubiquitylation of proteins by a `tethering` mechanism: a two-site interaction model for the Nrf2-Keap1 complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "McMahon M, Thomas N, Itoh K, Yamamoto M, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16790436", "url": "https://glygen.org/publication/PubMed/16790436" } ] }, { "title": "Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16849449", "url": "https://glygen.org/publication/PubMed/16849449" } ] }, { "title": "Tracking STAT nuclear traffic.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Reich NC, Liu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "16868551", "url": "https://glygen.org/publication/PubMed/16868551" } ] }, { "title": "The COP9 signalosome regulates Skp2 levels and proliferation of human cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Denti S, Fernandez-Sanchez ME, Rogge L, Bianchi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16943200", "url": "https://glygen.org/publication/PubMed/16943200" } ] }, { "title": "A novel family of membrane-bound E3 ubiquitin ligases.", "journal": "Journal of biochemistry", "date": "2006", "authors": "Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16954532", "url": "https://glygen.org/publication/PubMed/16954532" } ] }, { "title": "The Epstein-Barr virus-encoded LMP-1 oncoprotein negatively affects Tyk2 phosphorylation and interferon signaling in human B cells.", "journal": "Journal of virology", "date": "2006", "authors": "Geiger TR, Martin JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16987978", "url": "https://glygen.org/publication/PubMed/16987978" } ] }, { "title": "Three different mRNAs encoding human granulocyte colony-stimulating factor receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Fukunaga R, Seto Y, Mizushima S, Nagata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "1701053", "url": "https://glygen.org/publication/PubMed/1701053" } ] }, { "title": "Two-site substrate recognition model for the Keap1-Nrf2 system: a hinge and latch mechanism.", "journal": "Biological chemistry", "date": "2006", "authors": "Tong KI, Kobayashi A, Katsuoka F, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17081101", "url": "https://glygen.org/publication/PubMed/17081101" } ] }, { "title": "IFN-gamma abrogates profibrogenic TGF-beta signaling in liver by targeting expression of inhibitory and receptor Smads.", "journal": "Journal of hepatology", "date": "2007", "authors": "Weng H, Mertens PR, Gressner AM, Dooley S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "17125875", "url": "https://glygen.org/publication/PubMed/17125875" } ] }, { "title": "Role of the NEDD8 modification of Cul2 in the sequential activation of ECV complex.", "journal": "Neoplasia (New York, N.Y.)", "date": "2006", "authors": "Sufan RI, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17132228", "url": "https://glygen.org/publication/PubMed/17132228" } ] }, { "title": "COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.", "journal": "The EMBO journal", "date": "2007", "authors": "Maine GN, Mao X, Komarck CM, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17183367", "url": "https://glygen.org/publication/PubMed/17183367" } ] }, { "title": "Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.", "journal": "Nature", "date": "2007", "authors": "Huang DT, Hunt HW, Zhuang M, Ohi MD, Holton JM, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17220875", "url": "https://glygen.org/publication/PubMed/17220875" } ] }, { "title": "Respiratory syncytial virus NS1 protein degrades STAT2 by using the Elongin-Cullin E3 ligase.", "journal": "Journal of virology", "date": "2007-04", "authors": "Elliott Joanne, Lynch Oonagh T, Suessmuth Yvonne, Qian Ping, Boyd Caroline R, Burrows James F, Buick Richard, Stevenson Nigel J, Touzelet Olivier, Gadina Massimo, Power Ultan F, Johnston James A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17251292", "url": "https://glygen.org/publication/PubMed/17251292" } ] }, { "title": "Regulation of the Egr-1 gene by tumor necrosis factor and interferons in primary human fibroblasts.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Cao XM, Guy GR, Sukhatme VP, Tan YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "1730654", "url": "https://glygen.org/publication/PubMed/1730654" } ] }, { "title": "PARC and CUL7 form atypical cullin RING ligase complexes.", "journal": "Cancer research", "date": "2007", "authors": "Skaar JR, Florens L, Tsutsumi T, Arai T, Tron A, Swanson SK, Washburn MP, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17332328", "url": "https://glygen.org/publication/PubMed/17332328" } ] }, { "title": "STAT activation and differential complex formation dictate selectivity of interferon responses.", "journal": "Acta biochimica Polonica", "date": "2007", "authors": "Wesoly J, Szweykowska-Kulinska Z, Bluyssen HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17351669", "url": "https://glygen.org/publication/PubMed/17351669" } ] }, { "title": "Suppressor of cytokine signaling 3 controls lysosomal routing of G-CSF receptor.", "journal": "The EMBO journal", "date": "2007", "authors": "Irandoust MI, Aarts LH, Roovers O, Gits J, Erkeland SJ, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "17363902", "url": "https://glygen.org/publication/PubMed/17363902" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "COMMD proteins: COMMing to the scene.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2007", "authors": "Maine GN, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17497243", "url": "https://glygen.org/publication/PubMed/17497243" } ] }, { "title": "SH2B1 enhances leptin signaling by both Janus kinase 2 Tyr813 phosphorylation-dependent and -independent mechanisms.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Li Z, Zhou Y, Carter-Su C, Myers MG Jr, Rui L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "17565041", "url": "https://glygen.org/publication/PubMed/17565041" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Different electrostatic potentials define ETGE and DLG motifs as hinge and latch in oxidative stress response.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Tong KI, Padmanabhan B, Kobayashi A, Shang C, Hirotsu Y, Yokoyama S, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17785452", "url": "https://glygen.org/publication/PubMed/17785452" } ] }, { "title": "The granulocyte colony stimulating factor (G-CSF) activates Jak/STAT and MAPK pathways in a trophoblastic cell line.", "journal": "Journal of cellular biochemistry", "date": "2008", "authors": "Marino VJ, Roguin LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "17879956", "url": "https://glygen.org/publication/PubMed/17879956" } ] }, { "title": "The receptor of the type I interferon family.", "journal": "Current topics in microbiology and immunology", "date": "2007", "authors": "Uze G, Schreiber G, Piehler J, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17969444", "url": "https://glygen.org/publication/PubMed/17969444" } ] }, { "title": "PIAS proteins as regulators of small ubiquitin-related modifier (SUMO) modifications and transcription.", "journal": "Biochemical Society transactions", "date": "2007", "authors": "Palvimo JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-877312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312" } ], "reference": [ { "type": "PubMed", "id": "18031232", "url": "https://glygen.org/publication/PubMed/18031232" } ] }, { "title": "Full results of the Evidence of Interferon Dose-Response-European North American Comparative Efficacy (EVIDENCE) study: a multicenter, randomized, assessor-blinded comparison of low-dose weekly versus high-dose, high-frequency interferon beta-1a for relapsing multiple sclerosis.", "journal": "Clinical therapeutics", "date": "2007", "authors": "Schwid SR, Panitch HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18035202", "url": "https://glygen.org/publication/PubMed/18035202" } ] }, { "title": "Downregulation of COP9 signalosome subunits differentially affects the CSN complex and target protein stability.", "journal": "BMC biochemistry", "date": "2007", "authors": "Peth A, Berndt C, Henke W, Dubiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18093314", "url": "https://glygen.org/publication/PubMed/18093314" } ] }, { "title": "Dcn1 functions as a scaffold-type E3 ligase for cullin neddylation.", "journal": "Molecular cell", "date": "2008", "authors": "Kurz T, Chou YC, Willems AR, Meyer-Schaller N, Hecht ML, Tyers M, Peter M, Sicheri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18206966", "url": "https://glygen.org/publication/PubMed/18206966" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Induction of guanylate binding protein 5 by gamma interferon increases susceptibility to Salmonella enterica serovar Typhimurium-induced pyroptosis in RAW 264.7 cells.", "journal": "Infection and immunity", "date": "2008", "authors": "Rupper AC, Cardelli JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18362138", "url": "https://glygen.org/publication/PubMed/18362138" } ] }, { "title": "Acute effects of leptin require PI3K signaling in hypothalamic proopiomelanocortin neurons in mice.", "journal": "The Journal of clinical investigation", "date": "2008", "authors": "Hill JW, Williams KW, Ye C, Luo J, Balthasar N, Coppari R, Cowley MA, Cantley LC, Lowell BB, Elmquist JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "18382766", "url": "https://glygen.org/publication/PubMed/18382766" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "An agonist-induced conformational change in the growth hormone receptor determines the choice of signalling pathway.", "journal": "Nature cell biology", "date": "2008", "authors": "Rowlinson SW, Yoshizato H, Barclay JL, Brooks AJ, Behncken SN, Kerr LM, Millard K, Palethorpe K, Nielsen K, Clyde-Smith J, Hancock JF, Waters MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "18488018", "url": "https://glygen.org/publication/PubMed/18488018" } ] }, { "title": "Protein tyrosine phosphatases in the JAK/STAT pathway.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2008", "authors": "Xu D, Qu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "18508557", "url": "https://glygen.org/publication/PubMed/18508557" } ] }, { "title": "Leptin controls adipose tissue lipogenesis via central, STAT3-independent mechanisms.", "journal": "Nature medicine", "date": "2008", "authors": "Buettner C, Muse ED, Cheng A, Chen L, Scherer T, Pocai A, Su K, Cheng B, Li X, Harvey-White J, Schwartz GJ, Kunos G, Rossetti L, Buettner C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "18516053", "url": "https://glygen.org/publication/PubMed/18516053" } ] }, { "title": "c-Cbl-dependent monoubiquitination and lysosomal degradation of gp130.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Tanaka Y, Tanaka N, Saeki Y, Tanaka K, Murakami M, Hirano T, Ishii N, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "18519587", "url": "https://glygen.org/publication/PubMed/18519587" } ] }, { "title": "Interferon-inducible antiviral effectors.", "journal": "Nature reviews. Immunology", "date": "2008", "authors": "Sadler AJ, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18575461", "url": "https://glygen.org/publication/PubMed/18575461" } ] }, { "title": "Tyrosine phosphorylation regulates the partitioning of STAT1 between different dimer conformations.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wenta N, Strauss H, Meyer S, Vinkemeier U", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18591661", "url": "https://glygen.org/publication/PubMed/18591661" } ] }, { "title": "G-CSF stimulates Jak2-dependent Gab2 phosphorylation leading to Erk1/2 activation and cell proliferation.", "journal": "Cellular signalling", "date": "2008", "authors": "Wang L, Xue J, Zadorozny EV, Robinson LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "18644434", "url": "https://glygen.org/publication/PubMed/18644434" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.", "journal": "Cell", "date": "2008", "authors": "Lee I, Schindelin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "18662542", "url": "https://glygen.org/publication/PubMed/18662542" } ] }, { "title": "UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.", "journal": "Cell", "date": "2008", "authors": "Alexandru G, Graumann J, Smith GT, Kolawa NJ, Fang R, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18775313", "url": "https://glygen.org/publication/PubMed/18775313" } ] }, { "title": "Comparative analysis of mRNA targets for human PUF-family proteins suggests extensive interaction with the miRNA regulatory system.", "journal": "PloS one", "date": "2008", "authors": "Galgano A, Forrer M, Jaskiewicz L, Kanitz A, Zavolan M, Gerber AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18776931", "url": "https://glygen.org/publication/PubMed/18776931" } ] }, { "title": "Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.", "journal": "Cell", "date": "2008", "authors": "Duda DM, Borg LA, Scott DC, Hunt HW, Hammel M, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18805092", "url": "https://glygen.org/publication/PubMed/18805092" } ] }, { "title": "SCCRO (DCUN1D1) is an essential component of the E3 complex for neddylation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kim AY, Bommelje CC, Lee BE, Yonekawa Y, Choi L, Morris LG, Huang G, Kaufman A, Ryan RJ, Hao B, Ramanathan Y, Singh B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18826954", "url": "https://glygen.org/publication/PubMed/18826954" } ] }, { "title": "Multimodal activation of the ubiquitin ligase SCF by Nedd8 conjugation.", "journal": "Molecular cell", "date": "2008", "authors": "Saha A, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18851830", "url": "https://glygen.org/publication/PubMed/18851830" } ] }, { "title": "The COP9 signalosome: more than a protease.", "journal": "Trends in biochemical sciences", "date": "2008", "authors": "Wei N, Serino G, Deng XW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18926707", "url": "https://glygen.org/publication/PubMed/18926707" } ] }, { "title": "Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19028597", "url": "https://glygen.org/publication/PubMed/19028597" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.", "journal": "Molecular cell", "date": "2009", "authors": "Huang DT, Ayrault O, Hunt HW, Taherbhoy AM, Duda DM, Scott DC, Borg LA, Neale G, Murray PJ, Roussel MF, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19250909", "url": "https://glygen.org/publication/PubMed/19250909" } ] }, { "title": "NRF2 and KEAP1 mutations: permanent activation of an adaptive response in cancer.", "journal": "Trends in biochemical sciences", "date": "2009", "authors": "Hayes JD, McMahon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19321346", "url": "https://glygen.org/publication/PubMed/19321346" } ] }, { "title": "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Schulman BA, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19352404", "url": "https://glygen.org/publication/PubMed/19352404" } ] }, { "title": "STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Ikeda O, Miyasaka Y, Sekine Y, Mizushima A, Muromoto R, Nanbo A, Yoshimura A, Matsuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "19393627", "url": "https://glygen.org/publication/PubMed/19393627" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?", "journal": "Journal of molecular evolution", "date": "2009", "authors": "Michelle C, Vourc'h P, Mignon L, Andres CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19452197", "url": "https://glygen.org/publication/PubMed/19452197" } ] }, { "title": "Site-specific ubiquitination determines lysosomal sorting and signal attenuation of the granulocyte colony-stimulating factor receptor.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2009", "authors": "Wolfler A, Irandoust M, Meenhuis A, Gits J, Roovers O, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "19453968", "url": "https://glygen.org/publication/PubMed/19453968" } ] }, { "title": "Dimerization of the extracellular domain of the human growth hormone receptor by a single hormone molecule.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Cunningham BC, Ultsch M, De Vos AM, Mulkerrin MG, Clauser KR, Wells JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "1948064", "url": "https://glygen.org/publication/PubMed/1948064" } ] }, { "title": "RING domain E3 ubiquitin ligases.", "journal": "Annual review of biochemistry", "date": "2009", "authors": "Deshaies RJ, Joazeiro CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19489725", "url": "https://glygen.org/publication/PubMed/19489725" } ] }, { "title": "The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Meyer-Schaller N, Chou YC, Sumara I, Martin DD, Kurz T, Katheder N, Hofmann K, Berthiaume LG, Sicheri F, Peter M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19617556", "url": "https://glygen.org/publication/PubMed/19617556" } ] }, { "title": "F-box-directed CRL complex assembly and regulation by the CSN and CAND1.", "journal": "Molecular cell", "date": "2009", "authors": "Schmidt MW, McQuary PR, Wee S, Hofmann K, Wolf DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19748355", "url": "https://glygen.org/publication/PubMed/19748355" } ] }, { "title": "Building ubiquitin chains: E2 enzymes at work.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Ye Y, Rape M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19851334", "url": "https://glygen.org/publication/PubMed/19851334" } ] }, { "title": "Mechanisms of ubiquitin transfer by the anaphase-promoting complex.", "journal": "Journal of biology", "date": "2009", "authors": "Matyskiela ME, Rodrigo-Brenni MC, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19874575", "url": "https://glygen.org/publication/PubMed/19874575" } ] }, { "title": "Turning the growth hormone receptor on: evidence that hormone binding induces subunit rotation.", "journal": "Proteins", "date": "2010", "authors": "Poger D, Mark AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "19927328", "url": "https://glygen.org/publication/PubMed/19927328" } ] }, { "title": "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "van Wijk SJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19940261", "url": "https://glygen.org/publication/PubMed/19940261" } ] }, { "title": "Neutralization of IFNgamma defeats haemophagocytosis in LCMV-infected perforin- and Rab27a-deficient mice.", "journal": "EMBO molecular medicine", "date": "2009", "authors": "Pachlopnik Schmid J, Ho CH, Chretien F, Lefebvre JM, Pivert G, Kosco-Vilbois M, Ferlin W, Geissmann F, Fischer A, de Saint Basile G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20049711", "url": "https://glygen.org/publication/PubMed/20049711" } ] }, { "title": "Preclinical characterization of the selective JAK1/2 inhibitor INCB018424: therapeutic implications for the treatment of myeloproliferative neoplasms.", "journal": "Blood", "date": "2010", "authors": "Quintas-Cardama A, Vaddi K, Liu P, Manshouri T, Li J, Scherle PA, Caulder E, Wen X, Li Y, Waeltz P, Rupar M, Burn T, Lo Y, Kelley J, Covington M, Shepard S, Rodgers JD, Haley P, Kantarjian H, Fridman JS, Verstovsek S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20130243", "url": "https://glygen.org/publication/PubMed/20130243" } ] }, { "title": "Tyrosines 868, 966, and 972 in the kinase domain of JAK2 are autophosphorylated and required for maximal JAK2 kinase activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Argetsinger LS, Stuckey JA, Robertson SA, Koleva RI, Cline JM, Marto JA, Myers MG Jr, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20304997", "url": "https://glygen.org/publication/PubMed/20304997" } ] }, { "title": "Selective inhibition of JAK1 and JAK2 is efficacious in rodent models of arthritis: preclinical characterization of INCB028050.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Fridman JS, Scherle PA, Collins R, Burn TC, Li Y, Li J, Covington MB, Thomas B, Collier P, Favata MF, Wen X, Shi J, McGee R, Haley PJ, Shepard S, Rodgers JD, Yeleswaram S, Hollis G, Newton RC, Metcalf B, Friedman SM, Vaddi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20363976", "url": "https://glygen.org/publication/PubMed/20363976" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Molecular basis for the recognition of phosphorylated STAT1 by importin alpha5.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Nardozzi J, Wenta N, Yasuhara N, Vinkemeier U, Cingolani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20643137", "url": "https://glygen.org/publication/PubMed/20643137" } ] }, { "title": "Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ikeda O, Sekine Y, Mizushima A, Nakasuji M, Miyasaka Y, Yamamoto C, Muromoto R, Nanbo A, Oritani K, Yoshimura A, Matsuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "20929863", "url": "https://glygen.org/publication/PubMed/20929863" } ] }, { "title": "Reversible methylation of promoter-bound STAT3 by histone-modifying enzymes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Yang J, Huang J, Dasgupta M, Sears N, Miyagi M, Wang B, Chance MR, Chen X, Du Y, Wang Y, An L, Wang Q, Lu T, Zhang X, Wang Z, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "21098664", "url": "https://glygen.org/publication/PubMed/21098664" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Temporal and spatial regulation of targeting aurora B to the inner centromere.", "journal": "Cold Spring Harbor symposia on quantitative biology", "date": "2010", "authors": "Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21447816", "url": "https://glygen.org/publication/PubMed/21447816" } ] }, { "title": "Neddylation-induced conformational control regulates cullin RING ligase activity in vivo.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Boh BK, Smith PG, Hagen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21463634", "url": "https://glygen.org/publication/PubMed/21463634" } ] }, { "title": "Expression cloning of a human granulocyte colony-stimulating factor receptor: a structural mosaic of hematopoietin receptor, immunoglobulin, and fibronectin domains.", "journal": "The Journal of experimental medicine", "date": "1990", "authors": "Larsen A, Davis T, Curtis BM, Gimpel S, Sims JE, Cosman D, Park L, Sorensen E, March CJ, Smith CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "2147944", "url": "https://glygen.org/publication/PubMed/2147944" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "SERPINB13 is a novel RUNX1 target gene.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Boyapati A, Ren B, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939242" } ], "reference": [ { "type": "PubMed", "id": "21723253", "url": "https://glygen.org/publication/PubMed/21723253" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mao X, Gluck N, Chen B, Starokadomskyy P, Li H, Maine GN, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21778237", "url": "https://glygen.org/publication/PubMed/21778237" } ] }, { "title": "RINGs of good and evil: RING finger ubiquitin ligases at the crossroads of tumour suppression and oncogenesis.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Lipkowitz S, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21863050", "url": "https://glygen.org/publication/PubMed/21863050" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Scott DC, Monda JK, Bennett EJ, Harper JW, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21940857", "url": "https://glygen.org/publication/PubMed/21940857" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Differential expression and distinct structure of 69- and 100-kDa forms of 2-5A synthetase in human cells treated with interferon.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Marie I, Svab J, Robert N, Galabru J, Hovanessian AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "2211721", "url": "https://glygen.org/publication/PubMed/2211721" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "Inhibition of NEDD8-conjugation pathway by novel molecules: potential approaches to anticancer therapy.", "journal": "Molecular oncology", "date": "2012", "authors": "Tanaka T, Nakatani T, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22306028", "url": "https://glygen.org/publication/PubMed/22306028" } ] }, { "title": "Extracellular signal-regulated kinase mitogen-activated protein kinase-dependent SOCS-3 gene induction requires c-Jun, signal transducer and activator of transcription 3, and specificity protein 3 transcription factors.", "journal": "Molecular pharmacology", "date": "2012", "authors": "Wiejak J, Dunlop J, Gao S, Borland G, Yarwood SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "22311708", "url": "https://glygen.org/publication/PubMed/22311708" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "NEDD8 links cullin-RING ubiquitin ligase function to the p97 pathway.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "den Besten W, Verma R, Kleiger G, Oania RS, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22466964", "url": "https://glygen.org/publication/PubMed/22466964" } ] }, { "title": "UBXN7 docks on neddylated cullin complexes using its UIM motif and causes HIF1alpha accumulation.", "journal": "BMC biology", "date": "2012", "authors": "Bandau S, Knebel A, Gage ZO, Wood NT, Alexandru G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22537386", "url": "https://glygen.org/publication/PubMed/22537386" } ] }, { "title": "Suppressor of cytokine signaling 3 inhibits breast tumor kinase activation of STAT3.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Gao Y, Cimica V, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8849474", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474" } ], "reference": [ { "type": "PubMed", "id": "22547065", "url": "https://glygen.org/publication/PubMed/22547065" } ] }, { "title": "Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.", "journal": "Biochemistry", "date": "1990", "authors": "Pierotti A, Dong KW, Glucksman MJ, Orlowski M, Roberts JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "2261476", "url": "https://glygen.org/publication/PubMed/2261476" } ] }, { "title": "Molecular cloning and expression of an IL-6 signal transducer, gp130.", "journal": "Cell", "date": "1990", "authors": "Hibi M, Murakami M, Saito M, Hirano T, Taga T, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "2261637", "url": "https://glygen.org/publication/PubMed/2261637" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "Structural basis for a reciprocal regulation between SCF and CSN.", "journal": "Cell reports", "date": "2012", "authors": "Enchev RI, Scott DC, da Fonseca PC, Schreiber A, Monda JK, Schulman BA, Peter M, Morris EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22959436", "url": "https://glygen.org/publication/PubMed/22959436" } ] }, { "title": "Proteasomal degradation of Nod2 protein mediates tolerance to bacterial cell wall components.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Lee KH, Biswas A, Liu YJ, Kobayashi KS", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "23019338", "url": "https://glygen.org/publication/PubMed/23019338" } ] }, { "title": "Defining a tissue stem cell-driven Runx1/Stat3 signalling axis in epithelial cancer.", "journal": "The EMBO journal", "date": "2012", "authors": "Scheitz CJ, Lee TS, McDermitt DJ, Tumbar T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939242" } ], "reference": [ { "type": "PubMed", "id": "23034403", "url": "https://glygen.org/publication/PubMed/23034403" } ] }, { "title": "Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2012", "authors": "Hanan EJ, van Abbema A, Barrett K, Blair WS, Blaney J, Chang C, Eigenbrot C, Flynn S, Gibbons P, Hurley CA, Kenny JR, Kulagowski J, Lee L, Magnuson SR, Morris C, Murray J, Pastor RM, Rawson T, Siu M, Ultsch M, Zhou A, Sampath D, Lyssikatos JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23061660", "url": "https://glygen.org/publication/PubMed/23061660" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "Distinct and overlapping genomic profiles and antiviral effects of Interferon-lambda and -alpha on HCV-infected and noninfected hepatoma cells.", "journal": "Journal of viral hepatitis", "date": "2012", "authors": "Kohli A, Zhang X, Yang J, Russell RS, Donnelly RP, Sheikh F, Sherman A, Young H, Imamichi T, Lempicki RA, Masur H, Kottilil S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23121362", "url": "https://glygen.org/publication/PubMed/23121362" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.", "journal": "Structure (London, England : 1993)", "date": "2013", "authors": "Monda JK, Scott DC, Miller DJ, Lydeard J, King D, Harper JW, Bennett EJ, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23201271", "url": "https://glygen.org/publication/PubMed/23201271" } ] }, { "title": "FAT10ylation as a signal for proteasomal degradation.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Schmidtke G, Aichem A, Groettrup M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23333871", "url": "https://glygen.org/publication/PubMed/23333871" } ] }, { "title": "DCNL1 functions as a substrate sensor and activator of cullin 2-RING ligase.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Heir P, Sufan RI, Greer SN, Poon BP, Lee JE, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23401859", "url": "https://glygen.org/publication/PubMed/23401859" } ] }, { "title": "Cand1 promotes assembly of new SCF complexes through dynamic exchange of F box proteins.", "journal": "Cell", "date": "2013", "authors": "Pierce NW, Lee JE, Liu X, Sweredoski MJ, Graham RL, Larimore EA, Rome M, Zheng N, Clurman BE, Hess S, Shan SO, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23453757", "url": "https://glygen.org/publication/PubMed/23453757" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "CSN- and CAND1-dependent remodelling of the budding yeast SCF complex.", "journal": "Nature communications", "date": "2013", "authors": "Zemla A, Thomas Y, Kedziora S, Knebel A, Wood NT, Rabut G, Kurz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23535662", "url": "https://glygen.org/publication/PubMed/23535662" } ] }, { "title": "CAND1 controls in vivo dynamics of the cullin 1-RING ubiquitin ligase repertoire.", "journal": "Nature communications", "date": "2013", "authors": "Wu S, Zhu W, Nhan T, Toth JI, Petroski MD, Wolf DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23535663", "url": "https://glygen.org/publication/PubMed/23535663" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "CCDC22 deficiency in humans blunts activation of proinflammatory NF-kappaB signaling.", "journal": "The Journal of clinical investigation", "date": "2013", "authors": "Starokadomskyy P, Gluck N, Li H, Chen B, Wallis M, Maine GN, Mao X, Zaidi IW, Hein MY, McDonald FJ, Lenzner S, Zecha A, Ropers HH, Kuss AW, McGaughran J, Gecz J, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23563313", "url": "https://glygen.org/publication/PubMed/23563313" } ] }, { "title": "Deregulation of the COP9 signalosome-cullin-RING ubiquitin-ligase pathway: mechanisms and roles in urological cancers.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Gummlich L, Rabien A, Jung K, Dubiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23583660", "url": "https://glygen.org/publication/PubMed/23583660" } ] }, { "title": "The emerging family of CULLIN3-RING ubiquitin ligases (CRL3s): cellular functions and disease implications.", "journal": "The EMBO journal", "date": "2013", "authors": "Genschik P, Sumara I, Lechner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23912815", "url": "https://glygen.org/publication/PubMed/23912815" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "Regulatory flexibility in the Nrf2-mediated stress response is conferred by conformational cycling of the Keap1-Nrf2 protein complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Baird L, Lleres D, Swift S, Dinkova-Kostova AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23986495", "url": "https://glygen.org/publication/PubMed/23986495" } ] }, { "title": "TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.", "journal": "The EMBO journal", "date": "2013", "authors": "Kelsall IR, Duda DM, Olszewski JL, Hofmann K, Knebel A, Langevin F, Wood N, Wightman M, Schulman BA, Alpi AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24076655", "url": "https://glygen.org/publication/PubMed/24076655" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Granulocyte colony-stimulating factor receptor signalling via Janus kinase 2/signal transducer and activator of transcription 3 in ovarian cancer.", "journal": "British journal of cancer", "date": "2014", "authors": "Kumar J, Fraser FW, Riley C, Ahmed N, McCulloch DR, Ward AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "24220695", "url": "https://glygen.org/publication/PubMed/24220695" } ] }, { "title": "Kinetic, thermodynamic, and structural characterizations of the association between Nrf2-DLGex degron and Keap1.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Fukutomi T, Takagi K, Mizushima T, Ohuchi N, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24366543", "url": "https://glygen.org/publication/PubMed/24366543" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "Hrd1 suppresses Nrf2-mediated cellular protection during liver cirrhosis.", "journal": "Genes & development", "date": "2014", "authors": "Wu T, Zhao F, Gao B, Tan C, Yagishita N, Nakajima T, Wong PK, Chapman E, Fang D, Zhang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24636985", "url": "https://glygen.org/publication/PubMed/24636985" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "The 3M complex maintains microtubule and genome integrity.", "journal": "Molecular cell", "date": "2014", "authors": "Yan J, Yan F, Li Z, Sinnott B, Cappell KM, Yu Y, Mo J, Duncan JA, Chen X, Cormier-Daire V, Whitehurst AW, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24793695", "url": "https://glygen.org/publication/PubMed/24793695" } ] }, { "title": "CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.", "journal": "Molecular cell", "date": "2014", "authors": "Li Z, Pei XH, Yan J, Yan F, Cappell KM, Whitehurst AW, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24793696", "url": "https://glygen.org/publication/PubMed/24793696" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Cullin E3 ligases and their rewiring by viral factors.", "journal": "Biomolecules", "date": "2014", "authors": "Mahon C, Krogan NJ, Craik CS, Pick E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25314029", "url": "https://glygen.org/publication/PubMed/25314029" } ] }, { "title": "SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Huang G, Stock C, Bommelje CC, Weeda VB, Shah K, Bains S, Buss E, Shaha M, Rechler W, Ramanathan SY, Singh B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25349211", "url": "https://glygen.org/publication/PubMed/25349211" } ] }, { "title": "COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.", "journal": "Molecular biology of the cell", "date": "2015", "authors": "Phillips-Krawczak CA, Singla A, Starokadomskyy P, Deng Z, Osborne DG, Li H, Dick CJ, Gomez TS, Koenecke M, Zhang JS, Dai H, Sifuentes-Dominguez LF, Geng LN, Kaufmann SH, Hein MY, Wallis M, McGaughran J, Gecz J, Sluis Bv, Billadeau DD, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25355947", "url": "https://glygen.org/publication/PubMed/25355947" } ] }, { "title": "Evidence for the efficacy of interferon beta-1b in delaying the onset of clinically definite multiple sclerosis in individuals with clinically isolated syndrome.", "journal": "Therapeutic advances in neurological disorders", "date": "2014", "authors": "Freedman MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "25371710", "url": "https://glygen.org/publication/PubMed/25371710" } ] }, { "title": "Protein neddylation: beyond cullin-RING ligases.", "journal": "Nature reviews. Molecular cell biology", "date": "2015", "authors": "Enchev RI, Schulman BA, Peter M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25531226", "url": "https://glygen.org/publication/PubMed/25531226" } ] }, { "title": "Distinct and overlapping functions of the cullin E3 ligase scaffolding proteins CUL4A and CUL4B.", "journal": "Gene", "date": "2015", "authors": "Hannah J, Zhou P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26344709", "url": "https://glygen.org/publication/PubMed/26344709" } ] }, { "title": "The role and mechanism of CRL4 E3 ubiquitin ligase in cancer and its potential therapy implications.", "journal": "Oncotarget", "date": "2015", "authors": "Sang Y, Yan F, Ren X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26460955", "url": "https://glygen.org/publication/PubMed/26460955" } ] }, { "title": "Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.", "journal": "Nature communications", "date": "2015", "authors": "Yu C, Mao H, Novitsky EJ, Tang X, Rychnovsky SD, Zheng N, Huang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26632597", "url": "https://glygen.org/publication/PubMed/26632597" } ] }, { "title": "Characterization of the mammalian family of DCN-type NEDD8 E3 ligases.", "journal": "Journal of cell science", "date": "2016", "authors": "Keuss MJ, Thomas Y, Mcarthur R, Wood NT, Knebel A, Kurz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26906416", "url": "https://glygen.org/publication/PubMed/26906416" } ] }, { "title": "The role of cullin 5-containing ubiquitin ligases.", "journal": "Cell division", "date": "2016", "authors": "Okumura F, Joo-Okumura A, Nakatsukasa K, Kamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "27030794", "url": "https://glygen.org/publication/PubMed/27030794" } ] }, { "title": "The structure and regulation of Cullin 2 based E3 ubiquitin ligases and their biological functions.", "journal": "Cell division", "date": "2016", "authors": "Cai W, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "27222660", "url": "https://glygen.org/publication/PubMed/27222660" } ] }, { "title": "Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.", "journal": "Cell", "date": "2016", "authors": "Scott DC, Rhee DY, Duda DM, Kelsall IR, Olszewski JL, Paulo JA, de Jong A, Ovaa H, Alpi AF, Harper JW, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "27565346", "url": "https://glygen.org/publication/PubMed/27565346" } ] }, { "title": "Interleukin-6 triggers the association of its receptor with a possible signal transducer, gp130.", "journal": "Cell", "date": "1989", "authors": "Taga T, Hibi M, Hirata Y, Yamasaki K, Yasukawa K, Matsuda T, Hirano T, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "2788034", "url": "https://glygen.org/publication/PubMed/2788034" } ] }, { "title": "p97 Negatively Regulates NRF2 by Extracting Ubiquitylated NRF2 from the KEAP1-CUL3 E3 Complex.", "journal": "Molecular and cellular biology", "date": "2017", "authors": "Tao S, Liu P, Luo G, Rojo de la Vega M, Chen H, Wu T, Tillotson J, Chapman E, Zhang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "28115426", "url": "https://glygen.org/publication/PubMed/28115426" } ] }, { "title": "Growth hormone receptor and serum binding protein: purification, cloning and expression.", "journal": "Nature", "date": "1987", "authors": "Leung DW, Spencer SA, Cachianes G, Hammonds RG, Collins C, Henzel WJ, Barnard R, Waters MJ, Wood WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "2825030", "url": "https://glygen.org/publication/PubMed/2825030" } ] }, { "title": "VCP/p97-Mediated Unfolding as a Principle in Protein Homeostasis and Signaling.", "journal": "Molecular cell", "date": "2018", "authors": "van den Boom J, Meyer H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "29153394", "url": "https://glygen.org/publication/PubMed/29153394" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14543", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14543" }, { "database": "O-GlcNAc Atlas", "id": "O14543", "url": "https://oglcnac.org/atlas/detail/O14543" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Differential induction of interferon stimulated genes between type I and type III interferons is independent of interferon receptor abundance.", "journal": "PLoS pathogens", "date": "2018", "authors": "Pervolaraki K, Rastgou Talemi S, Albrecht D, Bormann F, Bamford C, Mendoza JL, Garcia KC, McLauchlan J, Hofer T, Stanifer ML, Boulant S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "30485383", "url": "https://glygen.org/publication/PubMed/30485383" } ] }, { "title": "Therapeutic targeting of the NRF2 and KEAP1 partnership in chronic diseases.", "journal": "Nature reviews. Drug discovery", "date": "2019", "authors": "Cuadrado A, Rojo AI, Wells G, Hayes JD, Cousin SP, Rumsey WL, Attucks OC, Franklin S, Levonen AL, Kensler TW, Dinkova-Kostova AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "30610225", "url": "https://glygen.org/publication/PubMed/30610225" } ] }, { "title": "Tyrosyl phosphorylation of KRAS stalls GTPase cycle via alteration of switch I and II conformation.", "journal": "Nature communications", "date": "2019", "authors": "Kano Y, Gebregiworgis T, Marshall CB, Radulovich N, Poon BPK, St-Germain J, Cook JD, Valencia-Sama I, Grant BMM, Herrera SG, Miao J, Raught B, Irwin MS, Lee JE, Yeh JJ, Zhang ZY, Tsao MS, Ikura M, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "30644389", "url": "https://glygen.org/publication/PubMed/30644389" } ] }, { "title": "Mitochondrial MUL1 E3 ubiquitin ligase regulates Hypoxia Inducible Factor (HIF-1alpha) and metabolic reprogramming by modulating the UBXN7 cofactor protein.", "journal": "Scientific reports", "date": "2020", "authors": "Cilenti L, Di Gregorio J, Ambivero CT, Andl T, Liao R, Zervos AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "32005965", "url": "https://glygen.org/publication/PubMed/32005965" } ] }, { "title": "Baricitinib as potential treatment for 2019-nCoV acute respiratory disease.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Richardson P, Griffin I, Tucker C, Smith D, Oechsle O, Phelan A, Rawling M, Savory E, Stebbing J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32032529", "url": "https://glygen.org/publication/PubMed/32032529" } ] }, { "title": "COVID-19: combining antiviral and anti-inflammatory treatments.", "journal": "The Lancet. Infectious diseases", "date": "2020", "authors": "Stebbing J, Phelan A, Griffin I, Tucker C, Oechsle O, Smith D, Richardson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32113509", "url": "https://glygen.org/publication/PubMed/32113509" } ] }, { "title": "The Molecular Mechanisms Regulating the KEAP1-NRF2 Pathway.", "journal": "Molecular and cellular biology", "date": "2020", "authors": "Baird L, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "32284348", "url": "https://glygen.org/publication/PubMed/32284348" } ] }, { "title": "Targeting IL-6 receptor in the treatment of neuromyelitis optica spectrum: a review of emerging treatment options.", "journal": "Expert review of neurotherapeutics", "date": "2020", "authors": "Rosso M, Saxena S, Chitnis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "32306778", "url": "https://glygen.org/publication/PubMed/32306778" } ] }, { "title": "Discovery of a Janus Kinase Inhibitor Bearing a Highly Three-Dimensional Spiro Scaffold: JTE-052 (Delgocitinib) as a New Dermatological Agent to Treat Inflammatory Skin Disorders.", "journal": "Journal of medicinal chemistry", "date": "2020", "authors": "Noji S, Hara Y, Miura T, Yamanaka H, Maeda K, Hori A, Yamamoto H, Obika S, Inoue M, Hase Y, Orita T, Doi S, Adachi T, Tanimoto A, Oki C, Kimoto Y, Ogawa Y, Negoro T, Hashimoto H, Shiozaki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32511913", "url": "https://glygen.org/publication/PubMed/32511913" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32574262", "url": "https://glygen.org/publication/PubMed/32574262" } ] }, { "title": "A Randomized Clinical Trial of the Efficacy and Safety of Interferon beta-1a in Treatment of Severe COVID-19.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Davoudi-Monfared E, Rahmani H, Khalili H, Hajiabdolbaghi M, Salehi M, Abbasian L, Kazemzadeh H, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32661006", "url": "https://glygen.org/publication/PubMed/32661006" } ] }, { "title": "SARS-CoV-2 clearance in COVID-19 patients with Novaferon treatment: A randomized, open-label, parallel-group trial.", "journal": "International journal of infectious diseases : IJID : official publication of the International Society for Infectious Diseases", "date": "2020", "authors": "Zheng F, Zhou Y, Zhou Z, Ye F, Huang B, Huang Y, Ma J, Zuo Q, Tan X, Xie J, Niu P, Wang W, Xu Y, Peng F, Zhou N, Cai C, Tang W, Xiao X, Li Y, Zhou Z, Jiang Y, Xie Y, Tan W, Gong G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32758689", "url": "https://glygen.org/publication/PubMed/32758689" } ] }, { "title": "Interferon beta-1b in treatment of severe COVID-19: A randomized clinical trial.", "journal": "International immunopharmacology", "date": "2020", "authors": "Rahmani H, Davoudi-Monfared E, Nourian A, Khalili H, Hajizadeh N, Jalalabadi NZ, Fazeli MR, Ghazaeian M, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32862111", "url": "https://glygen.org/publication/PubMed/32862111" } ] }, { "title": "The Role of Type I Interferons in the Pathogenesis and Treatment of COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33117408", "url": "https://glygen.org/publication/PubMed/33117408" } ] }, { "title": "Safety and efficacy of inhaled nebulised interferon beta-1a (SNG001) for treatment of SARS-CoV-2 infection: a randomised, double-blind, placebo-controlled, phase 2 trial.", "journal": "The Lancet. Respiratory medicine", "date": "2021", "authors": "Monk PD, Marsden RJ, Tear VJ, Brookes J, Batten TN, Mankowski M, Gabbay FJ, Davies DE, Holgate ST, Ho LP, Clark T, Djukanovic R, Wilkinson TMA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33189161", "url": "https://glygen.org/publication/PubMed/33189161" } ] }, { "title": "Corrigendum: Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33193462", "url": "https://glygen.org/publication/PubMed/33193462" } ] }, { "title": "Splicing factor YBX1 mediates persistence of JAK2-mutated neoplasms.", "journal": "Nature", "date": "2020-12", "authors": "Jayavelu Ashok Kumar, Schn\u00f6der Tina M, Perner Florian, Herzog Carolin, Meiler Arno, Krishnamoorthy Gurumoorthy, Huber Nicolas, Mohr Juliane, Edelmann-Stephan B\u00e4rbel, Austin Rebecca, Brandt Sabine, Palandri Francesca, Schr\u00f6der Nicolas, Isermann Berend, Edlich Frank, Sinha Amit U, Ungelenk Martin, H\u00fcbner Christian A, Zeiser Robert, Rahmig Susann, Waskow Claudia, Coldham Iain, Ernst Thomas, Hochhaus Andreas, Jilg Stefanie, Jost Philipp J, Mullally Ann, Bullinger Lars, Mertens Peter R, Lane Steven W, Mann Matthias, Heidel Florian H", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "33239784", "url": "https://glygen.org/publication/PubMed/33239784" } ] }, { "title": "Differential Binding of Sarilumab and Tocilizumab to IL-6Ralpha and Effects of Receptor Occupancy on Clinical Parameters.", "journal": "Journal of clinical pharmacology", "date": "2021", "authors": "Xu C, Rafique A, Potocky T, Paccaly A, Nolain P, Lu Q, Iglesias-Rodriguez M, St John G, Nivens MC, Kanamaluru V, Fairhurst J, Ishii T, Maldonado R, Choy E, Emery P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "33314148", "url": "https://glygen.org/publication/PubMed/33314148" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19 Is Associated with Improvements in Lung Abnormalities.", "journal": "Viruses", "date": "2020", "authors": "Zhou Q, MacArthur MR, He X, Wei X, Zarin P, Hanna BS, Wang ZH, Xiang X, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33396578", "url": "https://glygen.org/publication/PubMed/33396578" } ] }, { "title": "UBXN7 cofactor of CRL3(KEAP1) and CRL2(VHL) ubiquitin ligase complexes mediates reciprocal regulation of NRF2 and HIF-1alpha proteins.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2021", "authors": "Di Gregorio J, Cilenti L, Ambivero CT, Andl T, Liao R, Zervos AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "33444648", "url": "https://glygen.org/publication/PubMed/33444648" } ] }, { "title": "Growth hormone promoted tyrosyl phosphorylation of growth hormone receptors in murine 3T3-F442A fibroblasts and adipocytes.", "journal": "Biochemistry", "date": "1988", "authors": "Foster CM, Shafer JA, Rozsa FW, Wang XY, Lewis SD, Renken DA, Natale JE, Schwartz J, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "3349036", "url": "https://glygen.org/publication/PubMed/3349036" } ] }, { "title": "DNA methylation at the suppressor of cytokine signaling 3 (SOCS3) gene influences height in childhood.", "journal": "Nature communications", "date": "2023-08-25", "authors": "Issarapu Prachand, Arumalla Manisha, Elliott Hannah R, Nongmaithem Suraj S, Sankareswaran Alagu, Betts Modupeh, Sajjadi Sara, Kessler Noah J, Bayyana Swati, Mansuri Sohail R, Derakhshan Maria, Krishnaveni G V, Shrestha Smeeta, Kumaran Kalyanaraman, Di Gravio Chiara, Sahariah Sirazul A, Sanderson Eleanor, Relton Caroline L, Ward Kate A, Moore Sophie E, Prentice Andrew M, Lillycrop Karen A, Fall Caroline H D, Silver Matt J, Chandak Giriraj R,", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" } ], "reference": [ { "type": "PubMed", "id": "37626025", "url": "https://glygen.org/publication/PubMed/37626025" } ] }, { "title": "Resistin stimulates PC-3 prostate cancer cell growth through stimulation of SOCS3 and SOCS5 genes.", "journal": "Experimental biology and medicine (Maywood, N.J.)", "date": "2023-10", "authors": "Liu Chi-Wei, Peng Hsuan-Yu, Siao An-Ci, Tsuei Yi-Wei, Lin Yen-Yue, Shiah Shine-Gwo, Shih Li-Jane, Yeh Chien-Chih, Lee Shih-Wei, Kao Yung-Hsi", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" } ], "reference": [ { "type": "PubMed", "id": "37646261", "url": "https://glygen.org/publication/PubMed/37646261" } ] }, { "title": "Enterovirus D68 infection upregulates SOCS3 expression to inhibit JAK-STAT3 signaling and antagonize the innate interferon response of the host.", "journal": "Virologica Sinica", "date": "2023-08-30", "authors": "Zhang Yuling, Xu Leling, Zhang Zhe, Su Xin, Wang Zhiyun, Wang Tao", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" } ], "reference": [ { "type": "PubMed", "id": "37657555", "url": "https://glygen.org/publication/PubMed/37657555" } ] }, { "title": "Unleashing Breast Cancer Progression: miR-455-5p's Targeting of SOCS3 Drives Proliferation, Migration, and Invasion.", "journal": "Protein and peptide letters", "date": "2023", "authors": "Li Xin, Peng Bing, Li Jian, Tian Mi, He Lili", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" } ], "reference": [ { "type": "PubMed", "id": "38013437", "url": "https://glygen.org/publication/PubMed/38013437" } ] }, { "title": "Suppressor of Cytokine Signaling-3 Gene Polymorphisms and the Risk of Hepatocellular Carcinoma in Chronic Hepatitis C Patients in Egypt.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2023-12-01", "authors": "El Sharnoby Amal, Bedair Hanan M, Raia Gamal Yousef S, Hamed Nermeen, Sabry Aliaa, Khalaf Fatma A, Abd Elhamed Mohamed Rashed, Abdel-Samiee Mohamed", "evidence": [ { "database": "RefSeq", "id": "NP_003946", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003946" } ], "reference": [ { "type": "PubMed", "id": "38156861", "url": "https://glygen.org/publication/PubMed/38156861" } ] }, { "title": "Interferon action--sequence specificity of the ppp(A2'p)nA-dependent ribonuclease.", "journal": "Nature", "date": "1981", "authors": "Wreschner DH, McCauley JW, Skehel JJ, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6162102", "url": "https://glygen.org/publication/PubMed/6162102" } ] }, { "title": "Transcriptional and posttranscriptional regulation of interferon-induced gene expression in human cells.", "journal": "Cell", "date": "1984", "authors": "Friedman RL, Manly SP, McMahon M, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6548414", "url": "https://glygen.org/publication/PubMed/6548414" } ] }, { "title": "Interferon-associated, dsRNA-dependent enzyme activities in a mutant 3T6 cell engaged in the semiconstitutive synthesis of interferon.", "journal": "Cell", "date": "1978-08", "authors": "Jarvis A P, White C, Ball A, Gupta S L, Ratner L, Sen G C, Colby C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "688397", "url": "https://glygen.org/publication/PubMed/688397" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "Tyrosine kinase JAK1 is associated with the granulocyte-colony-stimulating factor receptor and both become tyrosine-phosphorylated after receptor activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Nicholson SE, Oates AC, Harpur AG, Ziemiecki A, Wilks AF, Layton JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "7512720", "url": "https://glygen.org/publication/PubMed/7512720" } ] }, { "title": "Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Igarashi K, Garotta G, Ozmen L, Ziemiecki A, Wilks AF, Harpur AG, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7514165", "url": "https://glygen.org/publication/PubMed/7514165" } ] }, { "title": "Rapid activation of the STAT3 transcription factor by granulocyte colony-stimulating factor.", "journal": "Blood", "date": "1994", "authors": "Tian SS, Lamb P, Seidel HM, Stein RB, Rosen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "7521688", "url": "https://glygen.org/publication/PubMed/7521688" } ] }, { "title": "Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7526154", "url": "https://glygen.org/publication/PubMed/7526154" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Cytokine-induced expression of vascular cell adhesion molecule-1 (VCAM-1) by astrocytes and astrocytoma cell lines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Rosenman SJ, Shrikant P, Dubb L, Benveniste EN, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7530745", "url": "https://glygen.org/publication/PubMed/7530745" } ] }, { "title": "Tyrosine-phosphorylated Stat1 and Stat2 plus a 48-kDa protein all contact DNA in forming interferon-stimulated-gene factor 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Qureshi SA, Salditt-Georgieff M, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7537377", "url": "https://glygen.org/publication/PubMed/7537377" } ] }, { "title": "Transcription factors in interferon signaling.", "journal": "Pharmacology & therapeutics", "date": "1995", "authors": "David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7540766", "url": "https://glygen.org/publication/PubMed/7540766" } ] }, { "title": "The Jak kinases differentially associate with the alpha and beta (accessory factor) chains of the interferon gamma receptor to form a functional receptor unit capable of activating STAT transcription factors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Sakatsume M, Igarashi K, Winestock KD, Garotta G, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7615558", "url": "https://glygen.org/publication/PubMed/7615558" } ] }, { "title": "Crystal structure of a complex between interferon-gamma and its soluble high-affinity receptor.", "journal": "Nature", "date": "1995", "authors": "Walter MR, Windsor WT, Nagabhushan TL, Lundell DJ, Lunn CA, Zauodny PJ, Narula SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7617032", "url": "https://glygen.org/publication/PubMed/7617032" } ] }, { "title": "Phosphorylation and activation of the DNA binding activity of purified Stat1 by the Janus protein-tyrosine kinases and the epidermal growth factor receptor.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Quelle FW, Thierfelder W, Witthuhn BA, Tang B, Cohen S, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7657660", "url": "https://glygen.org/publication/PubMed/7657660" } ] }, { "title": "Interaction between the components of the interferon gamma receptor complex.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kotenko SV, Izotova LS, Pollack BP, Mariano TM, Donnelly RJ, Muthukumaran G, Cook JR, Garotta G, Silvennoinen O, Ihle JN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7673114", "url": "https://glygen.org/publication/PubMed/7673114" } ] }, { "title": "A single phosphotyrosine residue of Stat91 required for gene activation by interferon-gamma.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Shuai K, Stark GR, Kerr IM, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7690989", "url": "https://glygen.org/publication/PubMed/7690989" } ] }, { "title": "Human growth hormone (GH) receptor is characterized as the 134-kilodalton tyrosine-phosphorylated protein activated by GH treatment in IM-9 cells.", "journal": "Endocrinology", "date": "1993", "authors": "Silva CM, Day RN, Weber MJ, Thorner MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "7691587", "url": "https://glygen.org/publication/PubMed/7691587" } ] }, { "title": "Requirement of serine phosphorylation for formation of STAT-promoter complexes.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Zhang X, Blenis J, Li HC, Schindler C, Chen-Kiang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "7701321", "url": "https://glygen.org/publication/PubMed/7701321" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Stat recruitment by tyrosine-phosphorylated cytokine receptors: an ordered reversible affinity-driven process.", "journal": "Immunity", "date": "1995", "authors": "Greenlund AC, Morales MO, Viviano BL, Yan H, Krolewski J, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7796299", "url": "https://glygen.org/publication/PubMed/7796299" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Evidence for the ligand-induced conversion from a dimer to a tetramer of the granulocyte colony-stimulating factor receptor.", "journal": "FEBS letters", "date": "1994", "authors": "Hiraoka O, Anaguchi H, Ota Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "7805849", "url": "https://glygen.org/publication/PubMed/7805849" } ] }, { "title": "Phosphorylation and internalization of gp130 occur after IL-6 activation of Jak2 kinase in hepatocytes.", "journal": "Molecular biology of the cell", "date": "1994", "authors": "Wang Y, Fuller GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "7812050", "url": "https://glygen.org/publication/PubMed/7812050" } ] }, { "title": "Choice of STATs and other substrates specified by modular tyrosine-based motifs in cytokine receptors.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Stahl N, Farruggella TJ, Boulton TG, Zhong Z, Darnell JE Jr, Yancopoulos GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "7871433", "url": "https://glygen.org/publication/PubMed/7871433" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Activation of JAK2 kinase mediated by the interleukin 6 signal transducer gp130.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Narazaki M, Witthuhn BA, Yoshida K, Silvennoinen O, Yasukawa K, Ihle JN, Kishimoto T, Taga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "8134389", "url": "https://glygen.org/publication/PubMed/8134389" } ] }, { "title": "Stat3: a STAT family member activated by tyrosine phosphorylation in response to epidermal growth factor and interleukin-6.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Zhong Z, Wen Z, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "8140422", "url": "https://glygen.org/publication/PubMed/8140422" } ] }, { "title": "Ligand-induced IFN gamma receptor tyrosine phosphorylation couples the receptor to its signal transduction system (p91).", "journal": "The EMBO journal", "date": "1994", "authors": "Greenlund AC, Farrar MA, Viviano BL, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8156998", "url": "https://glygen.org/publication/PubMed/8156998" } ] }, { "title": "IFN-gamma up-regulates platelet-activating factor receptor gene expression in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Ouellet S, Muller E, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8176225", "url": "https://glygen.org/publication/PubMed/8176225" } ] }, { "title": "Prolactin-induced proliferation of Nb2 cells involves tyrosine phosphorylation of the prolactin receptor and its associated tyrosine kinase JAK2.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Lebrun JJ, Ali S, Sofer L, Ullrich A, Kelly PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "8188682", "url": "https://glygen.org/publication/PubMed/8188682" } ] }, { "title": "Granulocyte colony-stimulating factor receptor signaling involves the formation of a three-component complex with Lyn and Syk protein-tyrosine kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Corey SJ, Burkhardt AL, Bolen JB, Geahlen RL, Tkatch LS, Tweardy DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "8197119", "url": "https://glygen.org/publication/PubMed/8197119" } ] }, { "title": "Transcription factor ISGF-3 formation requires phosphorylated Stat91 protein, but Stat113 protein is phosphorylated independently of Stat91 protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Improta T, Schindler C, Horvath CM, Kerr IM, Stark GR, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8197134", "url": "https://glygen.org/publication/PubMed/8197134" } ] }, { "title": "The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.", "journal": "Nature", "date": "1993", "authors": "Muller M, Briscoe J, Laxton C, Guschin D, Ziemiecki A, Silvennoinen O, Harpur AG, Barbieri G, Witthuhn BA, Schindler C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8232552", "url": "https://glygen.org/publication/PubMed/8232552" } ] }, { "title": "Association and activation of Jak-Tyk kinases by CNTF-LIF-OSM-IL-6 beta receptor components.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Stahl N, Boulton TG, Farruggella T, Ip NY, Davis S, Witthuhn BA, Quelle FW, Silvennoinen O, Barbieri G, Pellegrini S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "8272873", "url": "https://glygen.org/publication/PubMed/8272873" } ] }, { "title": "Identification of JAK2 as a growth hormone receptor-associated tyrosine kinase.", "journal": "Cell", "date": "1993", "authors": "Argetsinger LS, Campbell GS, Yang X, Witthuhn BA, Silvennoinen O, Ihle JN, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "8343952", "url": "https://glygen.org/publication/PubMed/8343952" } ] }, { "title": "Interferon gamma-induced transcription of the high-affinity Fc receptor for IgG requires assembly of a complex that includes the 91-kDa subunit of transcription factor ISGF3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Pearse RN, Feinman R, Shuai K, Darnell JE Jr, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8483949", "url": "https://glygen.org/publication/PubMed/8483949" } ] }, { "title": "Transcriptional regulation of the human intercellular adhesion molecule-1 gene: a short overview.", "journal": "Immunobiology", "date": "1995", "authors": "Stratowa C, Audette M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8530158", "url": "https://glygen.org/publication/PubMed/8530158" } ] }, { "title": "Identification of an interferon-gamma receptor alpha chain sequence required for JAK-1 binding.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kaplan DH, Greenlund AC, Tanner JW, Shaw AS, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8550631", "url": "https://glygen.org/publication/PubMed/8550631" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.", "journal": "The EMBO journal", "date": "1996", "authors": "Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8605876", "url": "https://glygen.org/publication/PubMed/8605876" } ] }, { "title": "Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Li X, Leung S, Qureshi S, Darnell JE Jr, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8621447", "url": "https://glygen.org/publication/PubMed/8621447" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Kinase-negative mutants of JAK1 can sustain interferon-gamma-inducible gene expression but not an antiviral state.", "journal": "The EMBO journal", "date": "1996", "authors": "Briscoe J, Rogers NC, Witthuhn BA, Watling D, Harpur AG, Wilks AF, Stark GR, Ihle JN, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8631301", "url": "https://glygen.org/publication/PubMed/8631301" } ] }, { "title": "Differential activation of acute phase response factor/STAT3 and STAT1 via the cytoplasmic domain of the interleukin 6 signal transducer gp130. I. Definition of a novel phosphotyrosine motif mediating STAT1 activation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gerhartz C, Heesel B, Sasse J, Hemmann U, Landgraf C, Schneider-Mergener J, Horn F, Heinrich PC, Graeve L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "8662591", "url": "https://glygen.org/publication/PubMed/8662591" } ] }, { "title": "Differential activation of acute phase response factor/Stat3 and Stat1 via the cytoplasmic domain of the interleukin 6 signal transducer gp130. II. Src homology SH2 domains define the specificity of stat factor activation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hemmann U, Gerhartz C, Heesel B, Sasse J, Kurapkat G, Grotzinger J, Wollmer A, Zhong Z, Darnell JE Jr, Graeve L, Heinrich PC, Horn F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "8662795", "url": "https://glygen.org/publication/PubMed/8662795" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Interferon-alpha-dependent activation of Tyk2 requires phosphorylation of positive regulatory tyrosines by another kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gauzzi MC, Velazquez L, McKendry R, Mogensen KE, Fellous M, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8702790", "url": "https://glygen.org/publication/PubMed/8702790" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Direct association with and dephosphorylation of Jak2 kinase by the SH2-domain-containing protein tyrosine phosphatase SHP-1.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Jiao H, Berrada K, Yang W, Tabrizi M, Platanias LC, Yi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694" } ], "reference": [ { "type": "PubMed", "id": "8943354", "url": "https://glygen.org/publication/PubMed/8943354" } ] }, { "title": "Multiple signaling pathways induced by granulocyte colony-stimulating factor involving activation of JAKs, STAT5, and/or STAT3 are required for regulation of three distinct classes of immediate early genes.", "journal": "Blood", "date": "1996", "authors": "Tian SS, Tapley P, Sincich C, Stein RB, Rosen J, Lamb P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "8977235", "url": "https://glygen.org/publication/PubMed/8977235" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Leptin receptor (OB-R) signaling. Cytoplasmic domain mutational analysis and evidence for receptor homo-oligomerization.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "White DW, Kuropatwinski KK, Devos R, Baumann H, Tartaglia LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "9020115", "url": "https://glygen.org/publication/PubMed/9020115" } ] }, { "title": "A single STAT recruitment module in a chimeric cytokine receptor complex is sufficient for STAT activation.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Behrmann I, Janzen C, Gerhartz C, Schmitz-Van de Leur H, Hermanns H, Heesel B, Graeve L, Horn F, Tavernier J, Heinrich PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "9030599", "url": "https://glygen.org/publication/PubMed/9030599" } ] }, { "title": "A short isoform of the human growth hormone receptor functions as a dominant negative inhibitor of the full-length receptor and generates large amounts of binding protein.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Ross RJ, Esposito N, Shen XY, Von Laue S, Chew SL, Dobson PR, Postel-Vinay MC, Finidori J", "evidence": [ { "database": "Reactome", "id": "R-HSA-982772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772" } ], "reference": [ { "type": "PubMed", "id": "9058373", "url": "https://glygen.org/publication/PubMed/9058373" } ] }, { "title": "Cloning and characterization of a human leptin receptor using a biologically active leptin immunoadhesin.", "journal": "Journal of molecular endocrinology", "date": "1997", "authors": "Luoh SM, Di Marco F, Levin N, Armanini M, Xie MH, Nelson C, Bennett GL, Williams M, Spencer SA, Gurney A, de Sauvage FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "9061609", "url": "https://glygen.org/publication/PubMed/9061609" } ] }, { "title": "The leptin receptor activates janus kinase 2 and signals for proliferation in a factor-dependent cell line.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Ghilardi N, Skoda RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "9092791", "url": "https://glygen.org/publication/PubMed/9092791" } ] }, { "title": "A double-stranded RNA-activated protein kinase-dependent pathway mediating stress-induced apoptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Der SD, Yang YL, Weissmann C, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9096384", "url": "https://glygen.org/publication/PubMed/9096384" } ] }, { "title": "Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Feng J, Witthuhn BA, Matsuda T, Kohlhuber F, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9111318", "url": "https://glygen.org/publication/PubMed/9111318" } ] }, { "title": "Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li X, Leung S, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9121453", "url": "https://glygen.org/publication/PubMed/9121453" } ] }, { "title": "Cellular responses to interferon-gamma.", "journal": "Annual review of immunology", "date": "1997", "authors": "Boehm U, Klamp T, Groot M, Howard JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9143706", "url": "https://glygen.org/publication/PubMed/9143706" } ] }, { "title": "Jak1 plays an essential role for receptor phosphorylation and Stat activation in response to granulocyte colony-stimulating factor.", "journal": "Blood", "date": "1997", "authors": "Shimoda K, Feng J, Murakami H, Nagata S, Watling D, Rogers NC, Stark GR, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "9226159", "url": "https://glygen.org/publication/PubMed/9226159" } ] }, { "title": "Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Martinez-Moczygemba M, Gutch MJ, French DL, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9242679", "url": "https://glygen.org/publication/PubMed/9242679" } ] }, { "title": "Cloning and functional analysis of new members of STAT induced STAT inhibitor (SSI) family: SSI-2 and SSI-3.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Minamoto S, Ikegame K, Ueno K, Narazaki M, Naka T, Yamamoto H, Matsumoto T, Saito H, Hosoe S, Kishimoto T", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "9266833", "url": "https://glygen.org/publication/PubMed/9266833" } ] }, { "title": "The protein tyrosine phosphatase SHP-2 negatively regulates ciliary neurotrophic factor induction of gene expression.", "journal": "Current biology : CB", "date": "1997", "authors": "Symes A, Stahl N, Reeves SA, Farruggella T, Servidei T, Gearan T, Yancopoulos G, Fink JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "9285712", "url": "https://glygen.org/publication/PubMed/9285712" } ] }, { "title": "A region of the beta subunit of the interferon alpha receptor different from box 1 interacts with Jak1 and is sufficient to activate the Jak-Stat pathway and induce an antiviral state.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Domanski P, Fish E, Nadeau OW, Witte M, Platanias LC, Yan H, Krolewski J, Pitha P, Colamonici OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9334213", "url": "https://glygen.org/publication/PubMed/9334213" } ] }, { "title": "Cloning and characterization of novel CIS family genes.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Masuhara M, Sakamoto H, Matsumoto A, Suzuki R, Yasukawa H, Mitsui K, Wakioka T, Tanimura S, Sasaki A, Misawa H, Yokouchi M, Ohtsubo M, Yoshimura A", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "reference": [ { "type": "PubMed", "id": "9344848", "url": "https://glygen.org/publication/PubMed/9344848" } ] }, { "title": "Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Craiu A, Akopian T, Goldberg A, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9380723", "url": "https://glygen.org/publication/PubMed/9380723" } ] }, { "title": "Janus kinases in interleukin-2-mediated signaling: JAK1 and JAK3 are differentially regulated by tyrosine phosphorylation.", "journal": "Current biology : CB", "date": "1997", "authors": "Liu KD, Gaffen SL, Goldsmith MA, Greene WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "9382798", "url": "https://glygen.org/publication/PubMed/9382798" } ] }, { "title": "Divergent signaling capacities of the long and short isoforms of the leptin receptor.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Bjorbaek C, Uotani S, da Silva B, Flier JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "9405487", "url": "https://glygen.org/publication/PubMed/9405487" } ] }, { "title": "Enhancing leptin response by preventing SH2-containing phosphatase 2 interaction with Ob receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Carpenter LR, Farruggella TJ, Symes A, Karow ML, Yancopoulos GD, Stahl N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2586552", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552" } ], "reference": [ { "type": "PubMed", "id": "9600917", "url": "https://glygen.org/publication/PubMed/9600917" } ] }, { "title": "Crystal structure of a tyrosine phosphorylated STAT-1 dimer bound to DNA.", "journal": "Cell", "date": "1998", "authors": "Chen X, Vinkemeier U, Zhao Y, Jeruzalmi D, Darnell JE Jr, Kuriyan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "9630226", "url": "https://glygen.org/publication/PubMed/9630226" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "RNase L inhibitor (RLI) antisense constructions block partially the down regulation of the 2-5A/RNase L pathway in encephalomyocarditis-virus-(EMCV)-infected cells.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Martinand C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9660177", "url": "https://glygen.org/publication/PubMed/9660177" } ] }, { "title": "Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Beninga J, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9668046", "url": "https://glygen.org/publication/PubMed/9668046" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Cleavage of the C-terminus of NEDD8 by UCH-L3.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Wada H, Kito K, Caskey LS, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "9790970", "url": "https://glygen.org/publication/PubMed/9790970" } ] }, { "title": "Activation of the protein tyrosine phosphatase SHP2 via the interleukin-6 signal transducing receptor protein gp130 requires tyrosine kinase Jak1 and limits acute-phase protein expression.", "journal": "The Biochemical journal", "date": "1998", "authors": "Schaper F, Gendo C, Eck M, Schmitz J, Grimm C, Anhuf D, Kerr IM, Heinrich PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1059683", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683" } ], "reference": [ { "type": "PubMed", "id": "9794795", "url": "https://glygen.org/publication/PubMed/9794795" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "RNase L inhibitor is induced during human immunodeficiency virus type 1 infection and down regulates the 2-5A/RNase L pathway in human T cells.", "journal": "Journal of virology", "date": "1999", "authors": "Martinand C, Montavon C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9847332", "url": "https://glygen.org/publication/PubMed/9847332" } ] }, { "title": "Identification of genes differentially regulated by interferon alpha, beta, or gamma using oligonucleotide arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Der SD, Zhou A, Williams BR, Silverman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9861020", "url": "https://glygen.org/publication/PubMed/9861020" } ] }, { "title": "Tyrosine-dependent and -independent mechanisms of STAT3 activation by the human granulocyte colony-stimulating factor (G-CSF) receptor are differentially utilized depending on G-CSF concentration.", "journal": "Blood", "date": "1999", "authors": "Ward AC, Hermans MH, Smith L, van Aesch YM, Schelen AM, Antonissen C, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "9864153", "url": "https://glygen.org/publication/PubMed/9864153" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Defective internalization and sustained activation of truncated granulocyte colony-stimulating factor receptor found in severe congenital neutropenia/acute myeloid leukemia.", "journal": "Blood", "date": "1999", "authors": "Ward AC, van Aesch YM, Schelen AM, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "9885206", "url": "https://glygen.org/publication/PubMed/9885206" } ] }, { "title": "Keap1 represses nuclear activation of antioxidant responsive elements by Nrf2 through binding to the amino-terminal Neh2 domain.", "journal": "Genes & development", "date": "1999", "authors": "Itoh K, Wakabayashi N, Katoh Y, Ishii T, Igarashi K, Engel JD, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "9887101", "url": "https://glygen.org/publication/PubMed/9887101" } ] }, { "title": "Transcription-dependent nuclear-cytoplasmic trafficking is required for the function of the von Hippel-Lindau tumor suppressor protein.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Lee S, Neumann M, Stearman R, Stauber R, Pause A, Pavlakis GN, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "9891082", "url": "https://glygen.org/publication/PubMed/9891082" } ] } ], "pathway": [ { "id": "hsa:9021", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9021", "resource": "KEGG Pathway" }, { "id": "R-HSA-1059683", "name": "Interleukin-6 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1059683", "resource": "Reactome", "description": "Interleukin-6 signaling" }, { "id": "R-HSA-2586552", "name": "Signaling by Leptin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2586552", "resource": "Reactome", "description": "Signaling by Leptin" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-877300", "name": "Interferon gamma signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "resource": "Reactome", "description": "Interferon gamma signaling" }, { "id": "R-HSA-877312", "name": "Regulation of IFNG signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877312", "resource": "Reactome", "description": "Regulation of IFNG signaling" }, { "id": "R-HSA-8849474", "name": "PTK6 Activates STAT3", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8849474", "resource": "Reactome", "description": "PTK6 Activates STAT3" }, { "id": "R-HSA-8939242", "name": "RUNX1 regulates transcription of genes involved in differentiation of keratinocytes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939242", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of keratinocytes" }, { "id": "R-HSA-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "resource": "Reactome", "description": "Neddylation" }, { "id": "R-HSA-909733", "name": "Interferon alpha/beta signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "resource": "Reactome", "description": "Interferon alpha/beta signaling" }, { "id": "R-HSA-912694", "name": "Regulation of IFNA/IFNB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912694", "resource": "Reactome", "description": "Regulation of IFNA/IFNB signaling" }, { "id": "R-HSA-9674555", "name": "Signaling by CSF3 (G-CSF)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555", "resource": "Reactome", "description": "Signaling by CSF3 (G-CSF)" }, { "id": "R-HSA-9705462", "name": "Inactivation of CSF3 (G-CSF) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462", "resource": "Reactome", "description": "Inactivation of CSF3 (G-CSF) signaling" }, { "id": "R-HSA-982772", "name": "Growth hormone receptor signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-982772", "resource": "Reactome", "description": "Growth hormone receptor signaling" }, { "id": "R-HSA-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "O35718-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "Socs3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL", "length": 225 }, "evidence": [ { "id": "45921512", "url": "http://www.informatics.jax.org/homology/45921512", "database": "MGI" }, { "id": "O14543", "url": "https://omabrowser.org/oma/group/O14543/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "O88583-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "Socs3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL", "length": 225 }, "evidence": [ { "id": "45921512", "url": "http://www.informatics.jax.org/homology/45921512", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "negative regulation of insulin receptor signaling pathway", "id": "GO:0046627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046627", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "positive regulation of cell differentiation", "id": "GO:0045597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045597", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "negative regulation of tyrosine phosphorylation of STAT protein", "id": "GO:0042532", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042532", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "branching involved in labyrinthine layer morphogenesis", "id": "GO:0060670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060670", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "placenta blood vessel development", "id": "GO:0060674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060674", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "negative regulation of receptor signaling pathway via JAK-STAT", "id": "GO:0046426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046426", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "T-helper 17 cell lineage commitment", "id": "GO:0072540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072540", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "phosphatidylinositol phosphate biosynthetic process", "id": "GO:0046854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046854", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "cellular response to interleukin-17", "id": "GO:0097398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097398", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "phosphotyrosine residue binding", "id": "GO:0001784", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001784", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "protein kinase inhibitor activity", "id": "GO:0004860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004860", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "miRNA binding", "id": "GO:0035198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035198", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "1-phosphatidylinositol-3-kinase regulator activity", "id": "GO:0046935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046935", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "protein tyrosine kinase inhibitor activity", "id": "GO:0030292", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030292", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "cytoplasmic side of plasma membrane", "id": "GO:0009898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase complex", "id": "GO:0005942", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005942", "evidence": [ { "database": "UniProtKB", "id": "O14543", "url": "https://www.uniprot.org/uniprot/O14543" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 13 ], "snv_sites": [ 13 ], "glycation_sites": [], "phosphorylation_sites": [ 204, 221 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 435 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }