{ "uniprot_canonical_ac": "O00746-1", "uniprot_ac": "O00746", "uniprot_id": "NDKM_HUMAN", "mass": { "chemical_mass": 20659.0, "monoisotopic_mass": 20659.0 }, "refseq": { "ac": "NP_001273362", "name": "nucleoside diphosphate kinase, mitochondrial isoform b", "summary": "The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" }, "gene_names": [ { "name": "NME4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00746", "id": "O00746" }, { "name": "NDPK-D; nm23-H4; NM23H4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362", "id": "NP_001273362" }, { "name": "NM23D", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00746", "id": "O00746" }, { "name": "NME4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362", "id": "NP_001273362" } ], "protein_names": [ { "name": "Nucleoside diphosphate kinase, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00746" }, { "name": "2.7.4.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00746" }, { "name": "NDK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00746" }, { "name": "NDP kinase D; nucleoside diphosphate kinase, mitochondrial; NDK; NDPKD; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; non-metastatic cells 4, protein expressed in", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362", "id": "NP_001273362" }, { "name": "NDP kinase, mitochondrial", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00746" }, { "name": "NDPKD", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00746" }, { "name": "Nucleoside diphosphate kinase D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00746" }, { "name": "nm23-H4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00746" }, { "name": "nucleoside diphosphate kinase, mitochondrial isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362", "id": "NP_001273362" } ], "function": [ { "annotation": "Differential Expression of NME4 in Trophoblast Stem-Like Cells and Peripheral Blood Mononuclear Cells of Normal Pregnancy and Preeclampsia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" }, { "database": "PubMed", "id": "37096311", "url": "https://glygen.org/publication/PubMed/37096311" } ] }, { "annotation": "Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis (PubMed:10799505). Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity (PubMed:18635542, PubMed:23150663). Acts as a mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration (PubMed:18635542). Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria (PubMed:24970086). In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling (PubMed:18635542, PubMed:17028143, PubMed:23150663).", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746#function" }, { "database": "PubMed", "id": "10799505", "url": "https://glygen.org/publication/PubMed/10799505" }, { "database": "PubMed", "id": "17028143", "url": "https://glygen.org/publication/PubMed/17028143" }, { "database": "PubMed", "id": "24970086", "url": "https://glygen.org/publication/PubMed/24970086" }, { "database": "PubMed", "id": "23150663", "url": "https://glygen.org/publication/PubMed/23150663" }, { "database": "PubMed", "id": "18635542", "url": "https://glygen.org/publication/PubMed/18635542" } ] }, { "annotation": "NME4 modulates PD-L1 expression via the STAT3 signaling pathway in squamous cell carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" }, { "database": "PubMed", "id": "32192776", "url": "https://glygen.org/publication/PubMed/32192776" } ] }, { "annotation": "The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" } ] }, { "annotation": "Widely targeted metabolomic analyses unveil the metabolic variations after stable knock-down of NME4 in esophageal squamous cell carcinoma cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" }, { "database": "PubMed", "id": "32504364", "url": "https://glygen.org/publication/PubMed/32504364" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 90, "end_pos": 90, "sequence_org": "R", "sequence_mut": "D", "comment": "Abolishes cardiolipin-containing membrane binding; decreases lipid transfer and pro-apoptotic activity; does not change phosphotransfer activity.", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" }, { "database": "PubMed", "id": "23150663", "url": "https://glygen.org/publication/PubMed/23150663" }, { "database": "PubMed", "id": "18635542", "url": "https://glygen.org/publication/PubMed/18635542" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "91.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "81", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "92.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "92.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "92.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "94.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "83.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00746", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00746" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "common_name": "Human" } ], "gene": [ { "name": "NME4", "url": "https://www.uniprot.org/uniprot/O00746", "locus": { "chromosome": "16", "start_pos": 410367, "end_pos": 396725, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000103202", "url": "https://www.ensembl.org/id/ENSG00000103202" } ] } } ], "crossref": [ { "id": "ENSG00000103202", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000103202", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.7.4.6", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.4.6&UniProtAcc=O00746", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd04413", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04413", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4488", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4488", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NME4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NME4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4833", "url": "https://www.ncbi.nlm.nih.gov/gene/4833", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7852", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7852", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "F2Z2X0", "url": "https://www.ebi.ac.uk/intact/interactors/id:F2Z2X0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O00746", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00746*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q4TT34", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q4TT34*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001564", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001564", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4833", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4833", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "601818", "url": "http://www.omim.org/entry/601818", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00746", "url": "https://www.nextprot.org/entry/NX_O00746", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00746", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00746", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LLNWECC", "url": "https://omabrowser.org/oma/group/LLNWECC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3075753at2759", "url": "http://www.orthodb.org/?query=3075753at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11349", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11349", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11349:SF49", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11349:SF49", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1EHW", "url": "https://www.rcsb.org/structure/1EHW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00334", "url": "http://pfam.xfam.org/family/PF00334", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00746", "url": "https://pharos.nih.gov/targets/O00746", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00746", "url": "http://purl.obolibrary.org/obo/PR_O00746", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "18113", "url": "https://www.rhea-db.org/rhea/18113", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38695", "url": "https://www.rhea-db.org/rhea/38695", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44640", "url": "https://www.rhea-db.org/rhea/44640", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087WVT9", "url": "https://www.uniprot.org/uniprot/A0A087WVT9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WVT9-1", "url": "https://www.uniprot.org/uniprot/A0A087WVT9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2IDC9", "url": "https://www.uniprot.org/uniprot/A2IDC9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2IDC9-1", "url": "https://www.uniprot.org/uniprot/A2IDC9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z297", "url": "https://www.uniprot.org/uniprot/F2Z297", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z297-1", "url": "https://www.uniprot.org/uniprot/F2Z297-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2X0", "url": "https://www.uniprot.org/uniprot/F2Z2X0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2X0-1", "url": "https://www.uniprot.org/uniprot/F2Z2X0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y6J0", "url": "https://www.uniprot.org/uniprot/H0Y6J0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y6J0-1", "url": "https://www.uniprot.org/uniprot/H0Y6J0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00746-1", "url": "https://www.uniprot.org/uniprot/O00746-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00746-2", "url": "https://www.uniprot.org/uniprot/O00746-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4TT34", "url": "https://www.uniprot.org/uniprot/Q4TT34", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4TT34-1", "url": "https://www.uniprot.org/uniprot/Q4TT34-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA", "length": 187, "header": "sp|O00746-1|NDKM_HUMAN Isoform 1 of Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "isoforms": [ { "isoform_ac": "A0A087WVT9-1", "url": "", "sequence": { "sequence": "MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA", "length": 153, "header": "tr|A0A087WVT9-1|A0A087WVT9_HUMAN Computationally mapped isoform of Nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 400339, "end_pos": 397223, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000621774.4", "url": "https://www.ensembl.org/id/ENST00000621774.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000479681.1", "url": "https://www.ensembl.org/id/ENSP00000479681.1" } ] } }, { "isoform_ac": "A2IDC9-1", "url": "", "sequence": { "sequence": "MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVV", "length": 37, "header": "tr|A2IDC9-1|A2IDC9_HUMAN Computationally mapped isoform of nucleoside-diphosphate kinase OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 399474, "end_pos": 399109, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000454619.5", "url": "https://www.ensembl.org/id/ENST00000454619.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000406317.1", "url": "https://www.ensembl.org/id/ENSP00000406317.1" } ] } }, { "isoform_ac": "F2Z297-1", "url": "", "sequence": { "sequence": "MGGLFWRSALRGLRCGPRAPGPSLLVRHGSASPPEEDGWGGAQR", "length": 44, "header": "tr|F2Z297-1|F2Z297_HUMAN Computationally mapped isoform of NME/NM23 nucleoside diphosphate kinase 4 OS=Homo sapiens OX=9606 GN=NME4 PE=4 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 398248, "end_pos": 397223, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000448828.5", "url": "https://www.ensembl.org/id/ENST00000448828.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000412039.1", "url": "https://www.ensembl.org/id/ENSP00000412039.1" } ] } }, { "isoform_ac": "F2Z2X0-1", "url": "", "sequence": { "sequence": "MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELSPTGAPWPSRRPTWRGTTVSPRTATSSARTCCGTKWPSSQEAALGLGSGLLRFSCGTAAIR", "length": 233, "header": "tr|F2Z2X0-1|F2Z2X0_HUMAN Computationally mapped isoform of Nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 406362, "end_pos": 397223, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000444498.5", "url": "https://www.ensembl.org/id/ENST00000444498.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000395605.1", "url": "https://www.ensembl.org/id/ENSP00000395605.1" } ] } }, { "isoform_ac": "H0Y6J0-1", "url": "", "sequence": { "sequence": "XWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISSHRLAPLDRGQREQQMVPGIPQGAHEA", "length": 169, "header": "tr|H0Y6J0-1|H0Y6J0_HUMAN Computationally mapped isoform of nucleoside-diphosphate kinase OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 400189, "end_pos": 397237, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000433358.5", "url": "https://www.ensembl.org/id/ENST00000433358.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000405925.1", "url": "https://www.ensembl.org/id/ENSP00000405925.1" } ] } }, { "isoform_ac": "O00746-1", "url": "", "sequence": { "sequence": "MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA", "length": 187, "header": "sp|O00746-1|NDKM_HUMAN Isoform 1 of Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 400339, "end_pos": 397223, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000219479.7", "url": "https://www.ensembl.org/id/ENST00000219479.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000219479.2", "url": "https://www.ensembl.org/id/ENSP00000219479.2" } ] } }, { "isoform_ac": "O00746-2", "url": "", "sequence": { "sequence": "MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA", "length": 117, "header": "sp|O00746-2|NDKM_HUMAN Isoform 2 of Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 400339, "end_pos": 399109, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000450036.1", "url": "https://www.ensembl.org/id/ENST00000450036.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000389048.1", "url": "https://www.ensembl.org/id/ENSP00000389048.1" } ] } }, { "isoform_ac": "Q4TT34-1", "url": "", "sequence": { "sequence": "MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGLPPSALKRGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA", "length": 195, "header": "tr|Q4TT34-1|Q4TT34_HUMAN Computationally mapped isoform of Nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 CANONICAL=O00746-1" }, "locus": { "chromosome": "16", "start_pos": 400339, "end_pos": 397223, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000382940.8", "url": "https://www.ensembl.org/id/ENST00000382940.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000372398.4", "url": "https://www.ensembl.org/id/ENSP00000372398.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O00746", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00746" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [ { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00746", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00746" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr127" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Identification of a novel human adenylate kinase. cDNA cloning, expression analysis, chromosome localization and characterization of the recombinant protein.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Van Rompay AR, Johansson M, Karlsson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "10215863", "url": "https://glygen.org/publication/PubMed/10215863" } ] }, { "title": "A ribonucleotide reductase gene involved in a p53-dependent cell-cycle checkpoint for DNA damage.", "journal": "Nature", "date": "2000", "authors": "Tanaka H, Arakawa H, Yamaguchi T, Shiraishi K, Fukuda S, Matsui K, Takei Y, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "10716435", "url": "https://glygen.org/publication/PubMed/10716435" } ] }, { "title": "The human nm23-H4 gene product is a mitochondrial nucleoside diphosphate kinase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Milon L, Meyer P, Chiadmi M, Munier A, Johansson M, Karlsson A, Lascu I, Capeau J, Janin J, Lacombe ML", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" }, { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "10799505", "url": "https://glygen.org/publication/PubMed/10799505" } ] }, { "title": "Cross-talk between the allosteric effector-binding sites in mouse ribonucleotide reductase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Reichard P, Eliasson R, Ingemarson R, Thelander L", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "10884394", "url": "https://glygen.org/publication/PubMed/10884394" } ] }, { "title": "Identification of a cDNA encoding an isoform of human CTP synthetase.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "van Kuilenburg AB, Meinsma R, Vreken P, Waterham HR, van Gennip AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "10899599", "url": "https://glygen.org/publication/PubMed/10899599" } ] }, { "title": "Structural and catalytic properties and homology modelling of the human nucleoside diphosphate kinase C, product of the DRnm23 gene.", "journal": "European journal of biochemistry", "date": "2001", "authors": "Erent M, Gonin P, Cherfils J, Tissier P, Raschella G, Giartosio A, Agou F, Sarger C, Lacombe ML, Konrad M, Lascu I", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "11277919", "url": "https://glygen.org/publication/PubMed/11277919" } ] }, { "title": "Structure of human thymidylate synthase suggests advantages of chemotherapy with noncompetitive inhibitors.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Phan J, Steadman DJ, Koli S, Ding WC, Minor W, Dunlap RB, Berger SH, Lebioda L", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "11278511", "url": "https://glygen.org/publication/PubMed/11278511" } ] }, { "title": "Mammalian p53R2 protein forms an active ribonucleotide reductase in vitro with the R1 protein, which is expressed both in resting cells in response to DNA damage and in proliferating cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Guittet O, Hakansson P, Voevodskaya N, Fridd S, Graslund A, Arakawa H, Nakamura Y, Thelander L", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "11517226", "url": "https://glygen.org/publication/PubMed/11517226" } ] }, { "title": "Structure and function of the radical enzyme ribonucleotide reductase.", "journal": "Progress in biophysics and molecular biology", "date": "2001", "authors": "Eklund H, Uhlin U, Farnegardh M, Logan DT, Nordlund P", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "11796141", "url": "https://glygen.org/publication/PubMed/11796141" } ] }, { "title": "Characterization of human UMP/CMP kinase and its phosphorylation of D- and L-form deoxycytidine analogue monophosphates.", "journal": "Cancer research", "date": "2002", "authors": "Liou JY, Dutschman GE, Lam W, Jiang Z, Cheng YC", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "11912132", "url": "https://glygen.org/publication/PubMed/11912132" } ] }, { "title": "Nucleotide binding to nucleoside diphosphate kinases: X-ray structure of human NDPK-A in complex with ADP and comparison to protein kinases.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Chen Y, Gallois-Montbrun S, Schneider B, Veron M, Morera S, Deville-Bonne D, Janin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "12972261", "url": "https://glygen.org/publication/PubMed/12972261" } ] }, { "title": "Enzymatic phosphorylation of nucleoside diphosphates.", "journal": "The Journal of biological chemistry", "date": "1954", "authors": "BERG P, JOKLIK WK", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "13211603", "url": "https://glygen.org/publication/PubMed/13211603" } ] }, { "title": "In vitro characterization of enzymatic properties and inhibition of the p53R2 subunit of human ribonucleotide reductase.", "journal": "Cancer research", "date": "2004", "authors": "Shao J, Zhou B, Zhu L, Qiu W, Yuan YC, Xi B, Yen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "14729598", "url": "https://glygen.org/publication/PubMed/14729598" } ] }, { "title": "The crystal structure of human adenylate kinase 6: An adenylate kinase localized to the cell nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Ren H, Wang L, Bennett M, Liang Y, Zheng X, Lu F, Li L, Nan J, Luo M, Eriksson S, Zhang C, Su XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "15630091", "url": "https://glygen.org/publication/PubMed/15630091" } ] }, { "title": "Expression of Human CTP synthetase in Saccharomyces cerevisiae reveals phosphorylation by protein kinase A.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Han GS, Sreenivas A, Choi MG, Chang YF, Martin SS, Baldwin EP, Carman GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "16179339", "url": "https://glygen.org/publication/PubMed/16179339" } ] }, { "title": "A dityrosyl-diiron radical cofactor center is essential for human ribonucleotide reductases.", "journal": "Molecular cancer therapeutics", "date": "2005", "authors": "Zhou B, Shao J, Su L, Yuan YC, Qi C, Shih J, Xi B, Chu B, Yen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "16373698", "url": "https://glygen.org/publication/PubMed/16373698" } ] }, { "title": "Ribonucleotide reductases.", "journal": "Annual review of biochemistry", "date": "2006", "authors": "Nordlund P, Reichard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "16756507", "url": "https://glygen.org/publication/PubMed/16756507" } ] }, { "title": "Structure of the synthetase domain of human CTP synthetase, a target for anticancer therapy.", "journal": "Acta crystallographica. Section F, Structural biology and crystallization communications", "date": "2006", "authors": "Kursula P, Flodin S, Ehn M, Hammarstrom M, Schuler H, Nordlund P, Stenmark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "16820675", "url": "https://glygen.org/publication/PubMed/16820675" } ] }, { "title": "Novel lipid transfer property of two mitochondrial proteins that bridge the inner and outer membranes.", "journal": "Biophysical journal", "date": "2007-01-01", "authors": "Epand Raquel F, Schlattner Uwe, Wallimann Theo, Lacombe Marie-Lise, Epand Richard M", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "reference": [ { "type": "PubMed", "id": "17028143", "url": "https://glygen.org/publication/PubMed/17028143" } ] }, { "title": "Crystal structure of RS21-C6, involved in nucleoside triphosphate pyrophosphohydrolysis.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Wu B, Liu Y, Zhao Q, Liao S, Zhang J, Bartlam M, Chen W, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "17320107", "url": "https://glygen.org/publication/PubMed/17320107" } ] }, { "title": "Studies on the properties and tissue distribution of the isozymes of guanylate kinase in man.", "journal": "Human heredity", "date": "1975", "authors": "Jamil T, Fisher RA, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "177353", "url": "https://glygen.org/publication/PubMed/177353" } ] }, { "title": "Cloning and characterization of AtNUDT13, a novel mitochondrial Arabidopsis thaliana Nudix hydrolase specific for long-chain diadenosine polyphosphates.", "journal": "The FEBS journal", "date": "2007", "authors": "Olejnik K, Murcha MW, Whelan J, Kraszewska E", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "17824959", "url": "https://glygen.org/publication/PubMed/17824959" } ] }, { "title": "Human thymidylate kinase. Purification, characterization, and kinetic behavior of the thymidylate kinase derived from chronic myelocytic leukemia.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Lee LS, Cheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "18469", "url": "https://glygen.org/publication/PubMed/18469" } ] }, { "title": "Nucleoside diphosphate kinase from human erythrocytes. Structural characterization of the two polypeptide chains responsible for heterogeneity of the hexameric enzyme.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Gilles AM, Presecan E, Vonica A, Lascu I", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "1851158", "url": "https://glygen.org/publication/PubMed/1851158" } ] }, { "title": "The nucleoside diphosphate kinase D (NM23-H4) binds the inner mitochondrial membrane with high affinity to cardiolipin and couples nucleotide transfer with respiration.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tokarska-Schlattner M, Boissan M, Munier A, Borot C, Mailleau C, Speer O, Schlattner U, Lacombe ML", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" }, { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "18635542", "url": "https://glygen.org/publication/PubMed/18635542" } ] }, { "title": "Ribonucleotide reduction is a cytosolic process in mammalian cells independently of DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Pontarin G, Fijolek A, Pizzo P, Ferraro P, Rampazzo C, Pozzan T, Thelander L, Reichard PA, Bianchi V", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "18997010", "url": "https://glygen.org/publication/PubMed/18997010" } ] }, { "title": "Molecular mechanisms of thioredoxin and glutaredoxin as hydrogen donors for Mammalian s phase ribonucleotide reductase.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zahedi Avval F, Holmgren A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "19176520", "url": "https://glygen.org/publication/PubMed/19176520" } ] }, { "title": "Mouse RS21-C6 is a mammalian 2'-deoxycytidine 5'-triphosphate pyrophosphohydrolase that prefers 5-iodocytosine.", "journal": "The FEBS journal", "date": "2009", "authors": "Nonaka M, Tsuchimoto D, Sakumi K, Nakabeppu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "19220460", "url": "https://glygen.org/publication/PubMed/19220460" } ] }, { "title": "Evidence of an intact N-terminal translocation sequence of human mitochondrial adenylate kinase 4.", "journal": "The international journal of biochemistry & cell biology", "date": "2010", "authors": "Panayiotou C, Solaroli N, Johansson M, Karlsson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "19766732", "url": "https://glygen.org/publication/PubMed/19766732" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00746-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00746-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "The characterization of human adenylate kinases 7 and 8 demonstrates differences in kinetic parameters and structural organization among the family of adenylate kinase isoenzymes.", "journal": "The Biochemical journal", "date": "2011", "authors": "Panayiotou C, Solaroli N, Xu Y, Johansson M, Karlsson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "21080915", "url": "https://glygen.org/publication/PubMed/21080915" } ] }, { "title": "AMP (dAMP) kinase from human erythrocytes.", "journal": "Methods in enzymology", "date": "1978", "authors": "Tsuboi KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "211388", "url": "https://glygen.org/publication/PubMed/211388" } ] }, { "title": "Guanylate kinases from human erythrocytes, hog brain, and rat liver.", "journal": "Methods in enzymology", "date": "1978", "authors": "Agarwal KC, Miech RP, Parks RE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "211390", "url": "https://glygen.org/publication/PubMed/211390" } ] }, { "title": "Mammalian ribonucleotide reductase subunit p53R2 is required for mitochondrial DNA replication and DNA repair in quiescent cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Pontarin G, Ferraro P, Bee L, Reichard P, Bianchi V", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "22847445", "url": "https://glygen.org/publication/PubMed/22847445" } ] }, { "title": "Dual function of mitochondrial Nm23-H4 protein in phosphotransfer and intermembrane lipid transfer: a cardiolipin-dependent switch.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Schlattner U, Tokarska-Schlattner M, Ramirez S, Tyurina YY, Amoscato AA, Mohammadyani D, Huang Z, Jiang J, Yanamala N, Seffouh A, Boissan M, Epand RF, Epand RM, Klein-Seetharaman J, Lacombe ML, Kagan VE", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "reference": [ { "type": "PubMed", "id": "23150663", "url": "https://glygen.org/publication/PubMed/23150663" } ] }, { "title": "The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Amiri M, Conserva F, Panayiotou C, Karlsson A, Solaroli N", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "23416111", "url": "https://glygen.org/publication/PubMed/23416111" } ] }, { "title": "Membrane trafficking. Nucleoside diphosphate kinases fuel dynamin superfamily proteins with GTP for membrane remodeling.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Boissan M, Montagnac G, Shen Q, Griparic L, Guitton J, Romao M, Sauvonnet N, Lagache T, Lascu I, Raposo G, Desbourdes C, Schlattner U, Lacombe ML, Polo S, van der Bliek AM, Roux A, Chavrier P", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "reference": [ { "type": "PubMed", "id": "24970086", "url": "https://glygen.org/publication/PubMed/24970086" } ] }, { "title": "Human adenylate kinase deficiency associated with hemolytic anemia. A single base substitution affecting solubility and catalytic activity of the cytosolic adenylate kinase.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Matsuura S, Igarashi M, Tanizawa Y, Yamada M, Kishi F, Kajii T, Fujii H, Miwa S, Sakurai M, Nakazawa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "2542324", "url": "https://glygen.org/publication/PubMed/2542324" } ] }, { "title": "Expression of human thymidylate synthase in Escherichia coli.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Davisson VJ, Sirawaraporn W, Santi DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "2656695", "url": "https://glygen.org/publication/PubMed/2656695" } ] }, { "title": "Thioredoxin and glutaredoxin systems.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Holmgren A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "2668278", "url": "https://glygen.org/publication/PubMed/2668278" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00746", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00746" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "NME4 modulates PD-L1 expression via the STAT3 signaling pathway in squamous cell carcinoma.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Zheng S, Liu Q, Liu T, Yang L, Zhang Q, Shen T, Zhang X, Han X, Lu X", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" } ], "reference": [ { "type": "PubMed", "id": "32192776", "url": "https://glygen.org/publication/PubMed/32192776" } ] }, { "title": "Widely targeted metabolomic analyses unveil the metabolic variations after stable knock-down of NME4 in esophageal squamous cell carcinoma cells.", "journal": "Molecular and cellular biochemistry", "date": "2020", "authors": "Zheng S, Liu T, Liu Q, Yang L, Zhang Q, Han X, Shen T, Zhang X, Lu X", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" } ], "reference": [ { "type": "PubMed", "id": "32504364", "url": "https://glygen.org/publication/PubMed/32504364" } ] }, { "title": "Differential Expression of NME4 in Trophoblast Stem-Like Cells and Peripheral Blood Mononuclear Cells of Normal Pregnancy and Preeclampsia.", "journal": "Journal of Korean medical science", "date": "2023-04-24", "authors": "Yu Ji Hea, Jung Yun Ji, Kim Myung-Sun, Cho Sung-Rae, Kim Young-Han", "evidence": [ { "database": "RefSeq", "id": "NP_001273362", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273362" } ], "reference": [ { "type": "PubMed", "id": "37096311", "url": "https://glygen.org/publication/PubMed/37096311" } ] }, { "title": "Kinetics and equilibria of pyrimidine nucleoside monophosphate kinase from human erythrocytes.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Scott EM, Wright RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "40615", "url": "https://glygen.org/publication/PubMed/40615" } ] }, { "title": "Rat liver adenosine triphosphate: adenosine monophosphate phosphotransferase activity. II. Subcellular localization of adenylate kinase isozymes.", "journal": "The Journal of biological chemistry", "date": "1970", "authors": "Criss WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "5484814", "url": "https://glygen.org/publication/PubMed/5484814" } ] }, { "title": "Adenosine triphosphate-adenosine-5'-monophosphate phosphotransferase from normal human liver mitochondria. Isolation, chemical properties, and immunochemical comparison with Duchenne dystrophic serum aberrant adenylate kinase.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Hamada M, Sumida M, Okuda H, Watanabe T, Nojima M, Kuby SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "6182143", "url": "https://glygen.org/publication/PubMed/6182143" } ] }, { "title": "Phosphorylation of acyclovir (acycloguanosine) monophosphate by GMP kinase.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Miller WH, Miller RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "6248551", "url": "https://glygen.org/publication/PubMed/6248551" } ] }, { "title": "Primary structure of human deoxycytidylate deaminase and overexpression of its functional protein in Escherichia coli.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Weiner KX, Weiner RS, Maley F, Maley GF", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "7685356", "url": "https://glygen.org/publication/PubMed/7685356" } ] }, { "title": "Purification from placenta, amino acid sequence, structure comparisons and cDNA cloning of human glutaredoxin.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Padilla CA, Martinez-Galisteo E, Barcena JA, Spyrou G, Holmgren A", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "7851394", "url": "https://glygen.org/publication/PubMed/7851394" } ] }, { "title": "Properties of an affinity-column-purified human deoxycytidylate deaminase.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Maley GF, Lobo AP, Maley F", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "8448179", "url": "https://glygen.org/publication/PubMed/8448179" } ] }, { "title": "Cloning, characterization, and modeling of mouse and human guanylate kinases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Brady WA, Kokoris MS, Fitzgibbon M, Black ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "8663313", "url": "https://glygen.org/publication/PubMed/8663313" } ] }, { "title": "nm23-H4, a new member of the family of human nm23/nucleoside diphosphate kinase genes localised on chromosome 16p13.", "journal": "Hum. Genet.", "date": "1997", "authors": "Milon L, Rousseau-Merck M F, Munier A, Erent M, Lascu I, Capeau J, Lacombe M L", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "reference": [ { "type": "PubMed", "id": "9099850", "url": "https://glygen.org/publication/PubMed/9099850" } ] }, { "title": "Substrate specificity of human nucleoside-diphosphate kinase revealed by transient kinetic analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Schaertl S, Konrad M, Geeves MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "9488696", "url": "https://glygen.org/publication/PubMed/9488696" } ] }, { "title": "The NMR solution structure of human glutaredoxin in the fully reduced form.", "journal": "Journal of molecular biology", "date": "1998", "authors": "Sun C, Berardi MJ, Bushweller JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943" } ], "reference": [ { "type": "PubMed", "id": "9677297", "url": "https://glygen.org/publication/PubMed/9677297" } ] } ], "pathway": [ { "id": "hsa:4833", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4833", "resource": "KEGG Pathway" }, { "id": "R-HSA-499943", "name": "Interconversion of nucleotide di- and triphosphates", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-499943", "resource": "Reactome", "description": "Interconversion of nucleotide di- and triphosphates" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9WV84-1", "protein_name": "Nucleoside diphosphate kinase, mitochondrial", "gene_name": "Nme4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGSLFGRVAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKPDGVQRRLVGTVIQRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMSSGPVVAMVWEGPNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREIELWFQSSELLNWADGGHHSSCYPA", "length": 186 }, "evidence": [ { "id": "45924570", "url": "http://www.informatics.jax.org/homology/45924570", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "nucleoside diphosphate kinase activity", "id": "GO:0004550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004550", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "cardiolipin binding", "id": "GO:1901612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901612", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "GTP biosynthetic process", "id": "GO:0006183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006183", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "UTP biosynthetic process", "id": "GO:0006228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006228", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "CTP biosynthetic process", "id": "GO:0006241", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006241", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "nucleoside metabolic process", "id": "GO:0009116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009116", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "mitochondrial intermembrane space", "id": "GO:0005758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005758", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "O00746", "url": "https://www.uniprot.org/uniprot/O00746" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "18113", "name": "", "equation": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q05982-1", "Q9QXL7-1", "O88426-1", "Q68FP8-1", "Q4KM73-1", "P19804-1", "Q9WUS0-1", "P39069-1", "Q9Z2M4-1", "G3V816-1", "A0A8I6A4T4-1", "A0A8I6AII3-1", "Q5EBM0-1", "Q5TCS8-4", "P27144-1", "P30085-1", "Q9Y6K8-1", "P00568-1", "Q96MA6-1", "Q96M32-1", "Q13232-1", "Q9Y5B8-1", "P15531-1", "O60361-1", "O00746-1", "P22392-1", "O75414-1", "A0A8I5KW96-1", "Q3U5Q7-1", "Q9WUR9-1", "Q9R0Y5-1", "Q920P5-1", "Q32M07-1", "Q9D2H2-2", "Q9DBP5-1", "P15532-1", "Q9QXL8-1", "Q9WV84-1", "Q9WV85-1", "O88425-1", "Q01768-1", "P36010-1", "Q54CG9-1", "P22887-1", "P34093-1", "P08879-1", "Q9VA43-1" ], "evidence": [ { "id": "18113", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18113" } ] }, { "id": "38695", "name": "", "equation": "a cardiolipin(in) = a cardiolipin(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00746-1" ], "evidence": [ { "id": "38695", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38695" } ] }, { "id": "44640", "name": "", "equation": "a 2'-deoxyribonucleoside 5'-diphosphate + ATP = a 2'-deoxyribonucleoside 5'-triphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q05982-1", "Q9QXL7-1", "O88426-1", "Q68FP8-1", "Q4KM73-1", "P19804-1", "Q9WUS0-1", "Q9Z2M4-1", "G3V816-1", "P39069-1", "A0A8I6A4T4-1", "A0A8I6AII3-1", "Q13232-1", "O00746-1", "P22392-1", "O75414-1", "Q5EBM0-1", "Q5TCS8-4", "P27144-1", "P30085-1", "Q9Y6K8-1", "P00568-1", "Q96MA6-1", "Q96M32-1", "Q9Y5B8-1", "P15531-1", "O60361-1", "A0A8I5KW96-1", "Q9WV84-1", "Q3U5Q7-1", "Q9WUR9-1", "Q9R0Y5-1", "Q920P5-1", "Q32M07-1", "Q9D2H2-2", "Q9DBP5-1", "P15532-1", "Q9QXL8-1", "Q9WV85-1", "O88425-1", "Q01768-1", "P36010-1", "Q54CG9-1", "P22887-1", "P34093-1", "P08879-1", "Q9VY27-1", "Q9VA43-1" ], "evidence": [ { "id": "44640", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44640" } ] }, { "id": "R-HSA-482804", "name": "(d)NDP + ATP <=> (d)NTP + ADP (NME4)", "equation": "", "summary": "Nucleoside diphosphate kinase NME4 associated with the inner mitochondrial membrane (Tokarska-Schlattner et al. 2008) catalyzes the reversible reaction of ribonucleoside and deoxyribonucleoside 5'-diphosphates with ATP to form the corresponding nucleoside 5'-triphosphates and ADP. The active form of the enzyme is a hexamer of NME4 polypeptides whose amino-terminal 33 residues, a mitochondrial translocation signal, have been removed (Milon et al. 2000). The substrate specificity of NME4 has not been examined in detail but is inferred to be broad like that of the homologous NME1, 2, and 3 kinases (Schaertl et al. 1998).", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00746-1" ], "evidence": [ { "id": "R-HSA-482804", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-482804" } ] }, { "id": "R-HSA-482812", "name": "(d)NTP + ADP <=> (d)NDP + ATP (NME4)", "equation": "", "summary": "Nucleoside diphosphate kinase NME4 associated with the inner mitochondrial membrane (Tokarska-Schlattner et al. 2008) catalyzes the reversible reaction of ribonucleoside and deoxyribonucleoside 5'-diphosphates with ADP to form the corresponding nucleoside 5'-diphosphates and ATP. The active form of the enzyme is a hexamer of NME4 polypeptides whose amino-terminal 33 residues, a mitochondrial translocation signal, have been removed (Milon et al. 2000). The substrate specificity of NME4 has not been examined in detail, but is inferred to be broad like that of the homologous NME1, 2, and 3 kinases (Schaertl et al. 1998).", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00746-1" ], "evidence": [ { "id": "R-HSA-482812", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-482812" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I5KW96", "gene_name": "AK4P3", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "A0A8I5KW96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5KW96" } ] } ] }, { "uniprot_ac": "A0A8I6A4T4", "gene_name": "Nme2-ps1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I6A4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A4T4" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I6A4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A4T4" } ] } ] }, { "uniprot_ac": "A0A8I6AII3", "gene_name": "ENSRNOG00000062879", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "A0A8I6AII3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AII3" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "A0A8I6AII3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AII3" } ] } ] }, { "uniprot_ac": "G3V816", "gene_name": "Nme3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "G3V816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V816" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "G3V816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V816" } ] } ] }, { "uniprot_ac": "O00746", "gene_name": "NME4", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00746" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00746" } ] } ] }, { "uniprot_ac": "O60361", "gene_name": "NME2P1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O60361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60361" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O60361", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60361" } ] } ] }, { "uniprot_ac": "O75414", "gene_name": "NME6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O75414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75414" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O75414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75414" } ] } ] }, { "uniprot_ac": "O88425", "gene_name": "Nme6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O88425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88425" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O88425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88425" } ] } ] }, { "uniprot_ac": "O88426", "gene_name": "Nme6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "O88426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88426" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "O88426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88426" } ] } ] }, { "uniprot_ac": "P00568", "gene_name": "AK1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] } ] }, { "uniprot_ac": "P08879", "gene_name": "awd", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P08879", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08879" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P08879", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08879" } ] } ] }, { "uniprot_ac": "P15531", "gene_name": "NME1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P15531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15531" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P15531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15531" } ] } ] }, { "uniprot_ac": "P15532", "gene_name": "Nme1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P15532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15532" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P15532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15532" } ] } ] }, { "uniprot_ac": "P19804", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] } ] }, { "uniprot_ac": "P22392", "gene_name": "NME2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] } ] }, { "uniprot_ac": "P22887", "gene_name": "ndkC-1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22887" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22887" } ] } ] }, { "uniprot_ac": "P27144", "gene_name": "AK4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P27144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27144" } ] } ] }, { "uniprot_ac": "P30085", "gene_name": "CMPK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P30085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30085" } ] } ] }, { "uniprot_ac": "P34093", "gene_name": "ndkM", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P34093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34093" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P34093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34093" } ] } ] }, { "uniprot_ac": "P36010", "gene_name": "YNK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P36010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36010" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P36010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36010" } ] } ] }, { "uniprot_ac": "P39069", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] } ] }, { "uniprot_ac": "Q01768", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] } ] }, { "uniprot_ac": "Q05982", "gene_name": "Nme1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q05982", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05982" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q05982", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05982" } ] } ] }, { "uniprot_ac": "Q13232", "gene_name": "NME3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13232" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13232" } ] } ] }, { "uniprot_ac": "Q32M07", "gene_name": "Ak8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] } ] }, { "uniprot_ac": "Q3U5Q7", "gene_name": "Cmpk2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q3U5Q7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5Q7" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q3U5Q7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5Q7" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q3U5Q7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5Q7" } ] } ] }, { "uniprot_ac": "Q4KM73", "gene_name": "Cmpk1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q4KM73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM73" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q4KM73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM73" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q4KM73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM73" } ] } ] }, { "uniprot_ac": "Q54CG9", "gene_name": "", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q54CG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CG9" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q54CG9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CG9" } ] } ] }, { "uniprot_ac": "Q5EBM0", "gene_name": "CMPK2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q5EBM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EBM0" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q5EBM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EBM0" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q5EBM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EBM0" } ] } ] }, { "uniprot_ac": "Q5TCS8", "gene_name": "AK9", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] }, { "ec_number": "2.7.4.4", "activity": "a ribonucleoside 5'-phosphate + ATP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] }, { "ec_number": "2.7.4.4", "activity": "", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q5TCS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5TCS8" } ] } ] }, { "uniprot_ac": "Q68FP8", "gene_name": "Ak8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] } ] }, { "uniprot_ac": "Q920P5", "gene_name": "Ak5", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] } ] }, { "uniprot_ac": "Q96M32", "gene_name": "AK7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] } ] }, { "uniprot_ac": "Q96MA6", "gene_name": "AK8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] } ] }, { "uniprot_ac": "Q9D2H2", "gene_name": "Ak7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] } ] }, { "uniprot_ac": "Q9DBP5", "gene_name": "Cmpk1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9DBP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBP5" } ] }, { "ec_number": "2.7.4.14", "activity": "ATP + CMP = ADP + CDP.", "evidence": [ { "id": "Q9DBP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBP5" } ] }, { "ec_number": "2.7.4.14", "activity": "", "evidence": [ { "id": "Q9DBP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBP5" } ] } ] }, { "uniprot_ac": "Q9QXL7", "gene_name": "Nme7", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9QXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL7" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9QXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL7" } ] } ] }, { "uniprot_ac": "Q9QXL8", "gene_name": "Nme7", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9QXL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9QXL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXL8" } ] } ] }, { "uniprot_ac": "Q9R0Y5", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] } ] }, { "uniprot_ac": "Q9VA43", "gene_name": "Dmel\\CG15543", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9VA43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA43" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9VA43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA43" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9VA43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA43" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9VA43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA43" } ] } ] }, { "uniprot_ac": "Q9VY27", "gene_name": "nmdyn-D6", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9VY27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VY27" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9VY27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VY27" } ] } ] }, { "uniprot_ac": "Q9WUR9", "gene_name": "Ak4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WUR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUR9" } ] } ] }, { "uniprot_ac": "Q9WUS0", "gene_name": "Ak4", "activity": [ { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WUS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUS0" } ] } ] }, { "uniprot_ac": "Q9WV84", "gene_name": "Nme4", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WV84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV84" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WV84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV84" } ] } ] }, { "uniprot_ac": "Q9WV85", "gene_name": "Nme3", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9WV85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV85" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9WV85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV85" } ] } ] }, { "uniprot_ac": "Q9Y5B8", "gene_name": "NME7", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Y5B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y5B8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Y5B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y5B8" } ] } ] }, { "uniprot_ac": "Q9Y6K8", "gene_name": "AK5", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] } ] }, { "uniprot_ac": "Q9Z2M4", "gene_name": "Decr2", "activity": [ { "ec_number": "1.3.1.124", "activity": "a (2E,4E)-dienoyl-CoA + H(+) + NADPH = a 4,5-saturated-(3E)-enoyl-CoA + NADP(+).", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] }, { "ec_number": "1.3.1.124", "activity": "", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Z2M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2M4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 127 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }