{ "uniprot_canonical_ac": "O00472-1", "uniprot_ac": "O00472", "uniprot_id": "ELL2_HUMAN", "mass": { "chemical_mass": 72324.0, "monoisotopic_mass": 72324.0 }, "refseq": { "ac": "NP_036213", "name": "RNA polymerase II elongation factor ELL2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" }, "gene_names": [ { "name": "ELL2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00472", "id": "O00472" }, { "name": "ELL2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213", "id": "NP_036213" }, { "name": "MRCCAT1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213", "id": "NP_036213" } ], "protein_names": [ { "name": "RNA polymerase II elongation factor ELL2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00472" }, { "name": "ELL-related RNA polymerase II, elongation factor; elongation factor, RNA polymerase II, 2; elongation factor RNA for polymerase II 2; metastatic renal cell carcinoma-associated transcript 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213", "id": "NP_036213" }, { "name": "RNA polymerase II elongation factor ELL2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213", "id": "NP_036213" } ], "function": [ { "annotation": "Allosteric transcription stimulation by RNA polymerase II super elongation complex.", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" }, { "database": "PubMed", "id": "34265249", "url": "https://glygen.org/publication/PubMed/34265249" } ] }, { "annotation": "Characterizing the Interaction between the HTLV-1 Transactivator Tax-1 with Transcription Elongation Factor ELL2 and Its Impact on Viral Transactivation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" }, { "database": "PubMed", "id": "34948391", "url": "https://glygen.org/publication/PubMed/34948391" } ] }, { "annotation": "ELL2 addition regulates mRNA processing by enhancing poly(A) site choice and exon splice-site skipping", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" }, { "database": "PubMed", "id": "19749764", "url": "https://glygen.org/publication/PubMed/19749764" } ] }, { "annotation": "Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III (PubMed:22195968). Plays a role in immunoglobulin secretion in plasma cells: directs efficient alternative mRNA processing, influencing both proximal poly(A) site choice and exon skipping, as well as immunoglobulin heavy chain (IgH) alternative processing. Probably acts by regulating histone modifications accompanying transition from membrane-specific to secretory IgH mRNA expression.", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472#function" }, { "database": "PubMed", "id": "23251033", "url": "https://glygen.org/publication/PubMed/23251033" }, { "database": "PubMed", "id": "22195968", "url": "https://glygen.org/publication/PubMed/22195968" }, { "database": "PubMed", "id": "20159561", "url": "https://glygen.org/publication/PubMed/20159561" }, { "database": "PubMed", "id": "20471948", "url": "https://glygen.org/publication/PubMed/20471948" } ] }, { "annotation": "MRCCAT1 is upregulated in glioma, predicting poor outcome for patients. MRCCAT1 promotes glioma cell proliferation and migration by activating p38-MAPK signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" }, { "database": "PubMed", "id": "30556882", "url": "https://glygen.org/publication/PubMed/30556882" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs370001465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370001465" }, { "id": "rs370001465", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370001465" }, { "id": "rs370001465", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370001465#frequency_tab" }, { "id": "rs370001465", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370001465" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 197, "end_pos": 197, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "5", "chr_pos": "95906674", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S197", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138311898", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138311898" }, { "id": "rs138311898", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138311898" }, { "id": "rs138311898", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138311898" }, { "id": "rs138311898", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138311898#frequency_tab" }, { "id": "rs138311898", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138311898" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 293, "end_pos": 293, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).", "chr_id": "5", "chr_pos": "95900769", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "P293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs113894818", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113894818" }, { "id": "rs113894818", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs113894818" }, { "id": "rs113894818", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113894818" }, { "id": "rs113894818", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs113894818#frequency_tab" }, { "id": "rs113894818", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs113894818" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 293, "end_pos": 293, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NTS).", "chr_id": "5", "chr_pos": "95900770", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.005791", "site_lbl": "P293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3815768", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3815768" }, { "id": "rs3815768", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs3815768" }, { "id": "rs3815768", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3815768" }, { "id": "rs3815768", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs3815768#frequency_tab" }, { "id": "rs3815768", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs3815768" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 298, "end_pos": 298, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).", "chr_id": "5", "chr_pos": "95900755", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.3417", "site_lbl": "A298", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O00472", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00472" } ], "glycoeffect": [], "start_pos": 336, "end_pos": 336, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "5", "chr_pos": "95898758", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R336", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1371839853", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1371839853" }, { "id": "rs1371839853", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1371839853" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 82, "end_pos": 82, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFN->NFS).", "chr_id": "5", "chr_pos": "95919496", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N82", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "97.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "89.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "87.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "87.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00472" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "common_name": "Human" } ], "gene": [ { "name": "ELL2", "url": "https://www.uniprot.org/uniprot/O00472", "locus": { "chromosome": "5", "start_pos": 95885098, "end_pos": 95961851, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000118985", "url": "https://www.ensembl.org/id/ENSG00000118985" } ] } } ], "crossref": [ { "id": "ENSG00000118985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118985", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O00472", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00472", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "ELL2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ELL2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "22936", "url": "https://www.ncbi.nlm.nih.gov/gene/22936", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1720", "url": "https://glyconnect.expasy.org/browser/proteins/1720", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "17064", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=17064", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00472", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00472*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR010844", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010844", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019464", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019464", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031176", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031176", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042065", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042065", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:22936", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:22936", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "601874", "url": "http://www.omim.org/entry/601874", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00472", "url": "https://www.nextprot.org/entry/NX_O00472", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PNYYEEK", "url": "https://omabrowser.org/oma/group/PNYYEEK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2910197at2759", "url": "http://www.orthodb.org/?query=2910197at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23288", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23288", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23288:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23288:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2E5N", "url": "https://www.rcsb.org/structure/2E5N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JW9", "url": "https://www.rcsb.org/structure/5JW9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OKX", "url": "https://www.rcsb.org/structure/7OKX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OKY", "url": "https://www.rcsb.org/structure/7OKY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07303", "url": "http://pfam.xfam.org/family/PF07303", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10390", "url": "http://pfam.xfam.org/family/PF10390", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00472", "url": "https://pharos.nih.gov/targets/O00472", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00472", "url": "http://purl.obolibrary.org/obo/PR_O00472", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0U1RR08", "url": "https://www.uniprot.org/uniprot/A0A0U1RR08", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RR08-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RR08-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RC27", "url": "https://www.uniprot.org/uniprot/D6RC27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RC27-1", "url": "https://www.uniprot.org/uniprot/D6RC27-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y8G1", "url": "https://www.uniprot.org/uniprot/H0Y8G1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y8G1-1", "url": "https://www.uniprot.org/uniprot/H0Y8G1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00472-1", "url": "https://www.uniprot.org/uniprot/O00472-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00472-2", "url": "https://www.uniprot.org/uniprot/O00472-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIPKNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS", "length": 640, "header": "sp|O00472-1|ELL2_HUMAN Isoform 1 of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2 CANONICAL=O00472-1" }, "isoforms": [ { "isoform_ac": "A0A0U1RR08-1", "url": "", "sequence": { "sequence": "XLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGMPVFFKRTLQTSHKA", "length": 65, "header": "tr|A0A0U1RR08-1|ELL2_HUMAN Computationally mapped isoform of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=1 CANONICAL=O00472-1" }, "locus": { "chromosome": "5", "start_pos": 95961674, "end_pos": 95932667, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000635633.1", "url": "https://www.ensembl.org/id/ENST00000635633.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000489270.1", "url": "https://www.ensembl.org/id/ENSP00000489270.1" } ] } }, { "isoform_ac": "D6RC27-1", "url": "", "sequence": { "sequence": "MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNK", "length": 151, "header": "tr|D6RC27-1|ELL2_HUMAN Computationally mapped isoform of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=1 CANONICAL=O00472-1" }, "locus": { "chromosome": "5", "start_pos": 95961721, "end_pos": 95898766, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513343.1", "url": "https://www.ensembl.org/id/ENST00000513343.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000423915.1", "url": "https://www.ensembl.org/id/ENSP00000423915.1" } ] } }, { "isoform_ac": "H0Y8G1-1", "url": "", "sequence": { "sequence": "XEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQVNGFVTRWADFHILPSFFPCPAQPQPSQWPLE", "length": 137, "header": "tr|H0Y8G1-1|ELL2_HUMAN Computationally mapped isoform of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=1 CANONICAL=O00472-1" }, "locus": { "chromosome": "5", "start_pos": 95898317, "end_pos": 95891006, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000508757.1", "url": "https://www.ensembl.org/id/ENST00000508757.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000420894.1", "url": "https://www.ensembl.org/id/ENSP00000420894.1" } ] } }, { "isoform_ac": "O00472-1", "url": "", "sequence": { "sequence": "MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIPKNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS", "length": 640, "header": "sp|O00472-1|ELL2_HUMAN Isoform 1 of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2 CANONICAL=O00472-1" }, "locus": { "chromosome": "5", "start_pos": 95961721, "end_pos": 95888874, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000237853.9", "url": "https://www.ensembl.org/id/ENST00000237853.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000237853.4", "url": "https://www.ensembl.org/id/ENSP00000237853.4" } ] } }, { "isoform_ac": "O00472-2", "url": "", "sequence": { "sequence": "MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIPKNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS", "length": 390, "header": "sp|O00472-2|ELL2_HUMAN Isoform 2 of RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2 CANONICAL=O00472-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 500, "start_aa": "Asn", "end_pos": 500, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn500", "evidence": [ { "id": "1720", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1720" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 500, "start_aa": "Asn", "end_pos": 500, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn500", "evidence": [ { "id": "1720", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1720" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 500, "start_aa": "Asn", "end_pos": 500, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn500", "evidence": [ { "id": "1720", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1720" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] } ], "phosphorylation": [ { "start_pos": 305, "end_pos": 305, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser305" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser310" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser315" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser316" }, { "start_pos": 502, "end_pos": 502, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O00472", "url": "http://phospho.elm.eu.org/byAccession/O00472.html" } ], "site_lbl": "Ser502" }, { "start_pos": 503, "end_pos": 503, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O00472", "url": "http://phospho.elm.eu.org/byAccession/O00472.html" } ], "site_lbl": "Ser503" }, { "start_pos": 506, "end_pos": 506, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O00472", "url": "http://phospho.elm.eu.org/byAccession/O00472.html" } ], "site_lbl": "Ser506" }, { "start_pos": 580, "end_pos": 580, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser580" }, { "start_pos": 604, "end_pos": 604, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser604" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The general transcription factors IIA, IIB, IIF, and IIE are required for RNA polymerase II transcription from the human U1 small nuclear RNA promoter.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Kuhlman TC, Cho H, Reinberg D, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "10022900", "url": "https://glygen.org/publication/PubMed/10022900" } ] }, { "title": "EAF1, a novel ELL-associated factor that is delocalized by expression of the MLL-ELL fusion protein.", "journal": "Blood", "date": "2001", "authors": "Simone F, Polak PE, Kaberlein JJ, Luo RT, Levitan DA, Thirman MJ", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "11418481", "url": "https://glygen.org/publication/PubMed/11418481" } ] }, { "title": "Crystallization of the Oct-1/SNAP190 peptide/DNA complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Hovde S, Brooks A, Strong K, Geiger JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "11856838", "url": "https://glygen.org/publication/PubMed/11856838" } ] }, { "title": "Activator recruitment by the general transcription machinery: X-ray structural analysis of the Oct-1 POU domain/human U1 octamer/SNAP190 peptide ternary complex.", "journal": "Genes & development", "date": "2002", "authors": "Hovde S, Hinkley CS, Strong K, Brooks A, Gu L, Henry RW, Geiger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "12414730", "url": "https://glygen.org/publication/PubMed/12414730" } ] }, { "title": "ELL-associated factor 2 (EAF2), a functional homolog of EAF1 with alternative ELL binding properties.", "journal": "Blood", "date": "2003", "authors": "Simone Federico, Luo Roger T, Polak Paul E, Kaberlein Joseph J, Thirman Michael J", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "12446457", "url": "https://glygen.org/publication/PubMed/12446457" } ] }, { "title": "The C-terminal domain of pol II and a DRB-sensitive kinase are required for 3' processing of U2 snRNA.", "journal": "The EMBO journal", "date": "2003", "authors": "Medlin JE, Uguen P, Taylor A, Bentley DL, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "12574128", "url": "https://glygen.org/publication/PubMed/12574128" } ] }, { "title": "Role of the C-terminal domain of RNA polymerase II in U2 snRNA transcription and 3' processing.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Jacobs EY, Ogiwara I, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "14701755", "url": "https://glygen.org/publication/PubMed/14701755" } ] }, { "title": "Oct-1 and Oct-2 potentiate functional interactions of a transcription factor with the proximal sequence element of small nuclear RNA genes.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Murphy S, Yoon JB, Gerster T, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1535687", "url": "https://glygen.org/publication/PubMed/1535687" } ] }, { "title": "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.", "journal": "Cell", "date": "2005", "authors": "Baillat D, Hakimi MA, Naar AM, Shilatifard A, Cooch N, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16239144", "url": "https://glygen.org/publication/PubMed/16239144" } ] }, { "title": "P-TEFb is not an essential elongation factor for the intronless human U2 snRNA and histone H2b genes.", "journal": "The EMBO journal", "date": "2005", "authors": "Medlin J, Scurry A, Taylor A, Zhang F, Peterlin BM, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16308568", "url": "https://glygen.org/publication/PubMed/16308568" } ] }, { "title": "The unorthodox SNAP50 zinc finger domain contributes to cooperative promoter recognition by human SNAPC.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Jawdekar GW, Hanzlowsky A, Hovde SL, Jelencic B, Feig M, Geiger JH, Henry RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16901896", "url": "https://glygen.org/publication/PubMed/16901896" } ] }, { "title": "Promoter-selective activation domains in Oct-1 and Oct-2 direct differential activation of an snRNA and mRNA promoter.", "journal": "Cell", "date": "1992", "authors": "Tanaka M, Lai JS, Herr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1739980", "url": "https://glygen.org/publication/PubMed/1739980" } ] }, { "title": "Serine-7 of the RNA polymerase II CTD is specifically required for snRNA gene expression.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Egloff S, O'Reilly D, Chapman RD, Taylor A, Tanzhaus K, Pitts L, Eick D, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "18079403", "url": "https://glygen.org/publication/PubMed/18079403" } ] }, { "title": "Both Oct-1 and Oct-2A contain domains which can activate the ubiquitously expressed U2 snRNA genes.", "journal": "The EMBO journal", "date": "1991", "authors": "Yang J, Muller-Immergluck MM, Seipel K, Janson L, Westin G, Schaffner W, Pettersson U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1829677", "url": "https://glygen.org/publication/PubMed/1829677" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O00472-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O00472-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" }, { "database": "iPTMnet", "id": "O00472-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00472-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "TFIIH-associated Cdk7 kinase functions in phosphorylation of C-terminal domain Ser7 residues, promoter-proximal pausing, and termination by RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Glover-Cutter K, Larochelle S, Erickson B, Zhang C, Shokat K, Fisher RP, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "19667075", "url": "https://glygen.org/publication/PubMed/19667075" } ] }, { "title": "Transcription elongation factor ELL2 directs immunoglobulin secretion in plasma cells by stimulating altered RNA processing.", "journal": "Nature immunology", "date": "2009", "authors": "Martincic K, Alkan SA, Cheatle A, Borghesi L, Milcarek C", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" } ], "reference": [ { "type": "PubMed", "id": "19749764", "url": "https://glygen.org/publication/PubMed/19749764" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" }, { "database": "iPTMnet", "id": "O00472-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "AFF4, a component of the ELL/P-TEFb elongation complex and a shared subunit of MLL chimeras, can link transcription elongation to leukemia.", "journal": "Molecular cell", "date": "2010", "authors": "Lin C, Smith ER, Takahashi H, Lai KC, Martin-Brown S, Florens L, Washburn MP, Conaway JW, Conaway RC, Shilatifard A", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "20159561", "url": "https://glygen.org/publication/PubMed/20159561" } ] }, { "title": "The integrator complex recognizes a new double mark on the RNA polymerase II carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Egloff S, Szczepaniak SA, Dienstbier M, Taylor A, Knight S, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "20457598", "url": "https://glygen.org/publication/PubMed/20457598" } ] }, { "title": "HIV-1 Tat and host AFF4 recruit two transcription elongation factors into a bifunctional complex for coordinated activation of HIV-1 transcription.", "journal": "Molecular cell", "date": "2010-05-14", "authors": "He Nanhai, Liu Min, Hsu Joanne, Xue Yuhua, Chou Seemay, Burlingame Alma, Krogan Nevan J, Alber Tom, Zhou Qiang", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "20471948", "url": "https://glygen.org/publication/PubMed/20471948" } ] }, { "title": "The human U1 snRNA promoter correctly initiates transcription in vitro and is activated by PSE1.", "journal": "Genes & development", "date": "1990", "authors": "Gunderson SI, Knuth MW, Burgess RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "2125285", "url": "https://glygen.org/publication/PubMed/2125285" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" }, { "database": "iPTMnet", "id": "O00472", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00472" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Ser7 phosphorylation of the CTD recruits the RPAP2 Ser5 phosphatase to snRNA genes.", "journal": "Molecular cell", "date": "2012", "authors": "Egloff S, Zaborowska J, Laitem C, Kiss T, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22137580", "url": "https://glygen.org/publication/PubMed/22137580" } ] }, { "title": "The little elongation complex regulates small nuclear RNA transcription.", "journal": "Molecular cell", "date": "2011", "authors": "Smith ER, Lin C, Garrett AS, Thornton J, Mohaghegh N, Hu D, Jackson J, Saraf A, Swanson SK, Seidel C, Florens L, Washburn MP, Eissenberg JC, Shilatifard A", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "22195968", "url": "https://glygen.org/publication/PubMed/22195968" } ] }, { "title": "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.", "journal": "Transcription", "date": "2011", "authors": "Ni Z, Olsen JB, Guo X, Zhong G, Ruan ED, Marcon E, Young P, Guo H, Li J, Moffat J, Emili A, Greenblatt JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22231121", "url": "https://glygen.org/publication/PubMed/22231121" } ] }, { "title": "snRNA 3' end formation requires heterodimeric association of integrator subunits.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Albrecht TR, Wagner EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22252320", "url": "https://glygen.org/publication/PubMed/22252320" } ] }, { "title": "A novel TBP-TAF complex on RNA polymerase II-transcribed snRNA genes.", "journal": "Transcription", "date": "2012", "authors": "Zaborowska J, Taylor A, Roeder RG, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22441827", "url": "https://glygen.org/publication/PubMed/22441827" } ] }, { "title": "The ubiquitin ligase Siah1 controls ELL2 stability and formation of super elongation complexes to modulate gene transcription.", "journal": "Molecular cell", "date": "2012", "authors": "Liu M, Hsu J, Chan C, Li Z, Zhou Q", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "22483617", "url": "https://glygen.org/publication/PubMed/22483617" } ] }, { "title": "The super elongation complex (SEC) family in transcriptional control.", "journal": "Nat. Rev. Mol. Cell Biol.", "date": "2012", "authors": "Luo Zhuojuan, Lin Chengqi, Shilatifard Ali", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "22895430", "url": "https://glygen.org/publication/PubMed/22895430" } ] }, { "title": "Genomic study of RNA polymerase II and III SNAPc-bound promoters reveals a gene transcribed by both enzymes and a broad use of common activators.", "journal": "PLoS genetics", "date": "2012", "authors": "James Faresse N, Canella D, Praz V, Michaud J, Romascano D, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "23166507", "url": "https://glygen.org/publication/PubMed/23166507" } ] }, { "title": "HIV-1 Tat recruits transcription elongation factors dispersed along a flexible AFF4 scaffold.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013-01-08", "authors": "Chou Seemay, Upton Heather, Bao Katherine, Schulze-Gahmen Ursula, Samelson Avi J, He Nanhai, Nowak Anna, Lu Huasong, Krogan Nevan J, Zhou Qiang, Alber Tom", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "23251033", "url": "https://glygen.org/publication/PubMed/23251033" } ] }, { "title": "The little elongation complex functions at initiation and elongation phases of snRNA gene transcription.", "journal": "Molecular cell", "date": "2013", "authors": "Hu D, Smith ER, Garruss AS, Mohaghegh N, Varberg JM, Lin C, Jackson J, Gao X, Saraf A, Florens L, Washburn MP, Eissenberg JC, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "23932780", "url": "https://glygen.org/publication/PubMed/23932780" } ] }, { "title": "Human snRNA genes use polyadenylation factors to promote efficient transcription termination.", "journal": "Nucleic acids research", "date": "2014", "authors": "O'Reilly D, Kuznetsova OV, Laitem C, Zaborowska J, Dienstbier M, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24097444", "url": "https://glygen.org/publication/PubMed/24097444" } ] }, { "title": "CBC-ARS2 stimulates 3'-end maturation of multiple RNA families and favors cap-proximal processing.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Hallais M, Pontvianne F, Andersen PR, Clerici M, Lener D, Benbahouche Nel H, Gostan T, Vandermoere F, Robert MC, Cusack S, Verheggen C, Jensen TH, Bertrand E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24270878", "url": "https://glygen.org/publication/PubMed/24270878" } ] }, { "title": "RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Ni Z, Xu C, Guo X, Hunter GO, Kuznetsova OV, Tempel W, Marcon E, Zhong G, Guo H, Kuo WW, Li J, Young P, Olsen JB, Wan C, Loppnau P, El Bakkouri M, Senisterra GA, He H, Huang H, Sidhu SS, Emili A, Murphy S, Mosley AL, Arrowsmith CH, Min J, Greenblatt JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24997600", "url": "https://glygen.org/publication/PubMed/24997600" } ] }, { "title": "The Integrator complex controls the termination of transcription at diverse classes of gene targets.", "journal": "Cell research", "date": "2015", "authors": "Skaar JR, Ferris AL, Wu X, Saraf A, Khanna KK, Florens L, Washburn MP, Hughes SH, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "25675981", "url": "https://glygen.org/publication/PubMed/25675981" } ] }, { "title": "Cap trimethylation of U snRNA is cytoplasmic and dependent on U snRNP protein binding.", "journal": "Cell", "date": "1986", "authors": "Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "2944599", "url": "https://glygen.org/publication/PubMed/2944599" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1720", "url": "https://glyconnect.expasy.org/browser/proteins/1720" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Upregulation of long noncoding RNA MRCCAT1 predicts poor prognosis and functions as an oncogene in glioma.", "journal": "European review for medical and pharmacological sciences", "date": "2018", "authors": "Ma J, Su LJ, Zheng ZJ", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" } ], "reference": [ { "type": "PubMed", "id": "30556882", "url": "https://glygen.org/publication/PubMed/30556882" } ] }, { "title": "Allosteric transcription stimulation by RNA polymerase II super elongation complex.", "journal": "Molecular cell", "date": "2021", "authors": "Chen Y, Vos SM, Dienemann C, Ninov M, Urlaub H, Cramer P", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" } ], "reference": [ { "type": "PubMed", "id": "34265249", "url": "https://glygen.org/publication/PubMed/34265249" } ] }, { "title": "Characterizing the Interaction between the HTLV-1 Transactivator Tax-1 with Transcription Elongation Factor ELL2 and Its Impact on Viral Transactivation.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Kohrt S, Strobel S, Mann MC, Sticht H, Fleckenstein B, Thoma-Kress AK", "evidence": [ { "database": "RefSeq", "id": "NP_036213", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036213" } ], "reference": [ { "type": "PubMed", "id": "34948391", "url": "https://glygen.org/publication/PubMed/34948391" } ] }, { "title": "A TBP-TAF complex required for transcription of human snRNA genes by RNA polymerase II and III.", "journal": "Nature", "date": "1995", "authors": "Henry RW, Sadowski CL, Kobayashi R, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "7715707", "url": "https://glygen.org/publication/PubMed/7715707" } ] }, { "title": "Common and unique transcription factor requirements of human U1 and U6 snRNA genes.", "journal": "The EMBO journal", "date": "1993", "authors": "Bernues J, Simmen KA, Lewis JD, Gunderson SI, Polycarpou-Schwarz M, Moncollin V, Egly JM, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8253082", "url": "https://glygen.org/publication/PubMed/8253082" } ] }, { "title": "Targeting TBP to a non-TATA box cis-regulatory element: a TBP-containing complex activates transcription from snRNA promoters through the PSE.", "journal": "Genes & development", "date": "1993", "authors": "Sadowski CL, Henry RW, Lobo SM, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8339931", "url": "https://glygen.org/publication/PubMed/8339931" } ] }, { "title": "The Oct-1 POU-specific domain can stimulate small nuclear RNA gene transcription by stabilizing the basal transcription complex SNAPc.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mittal V, Cleary MA, Herr W, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8628262", "url": "https://glygen.org/publication/PubMed/8628262" } ] }, { "title": "The transcription factors Sp1 and Oct-1 interact physically to regulate human U2 snRNA gene expression.", "journal": "Nucleic acids research", "date": "1996", "authors": "Strom AC, Forsberg M, Lillhager P, Westin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8668525", "url": "https://glygen.org/publication/PubMed/8668525" } ] }, { "title": "Staf, a promiscuous activator for enhanced transcription by RNA polymerases II and III.", "journal": "The EMBO journal", "date": "1997", "authors": "Schaub M, Myslinski E, Schuster C, Krol A, Carbon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9009278", "url": "https://glygen.org/publication/PubMed/9009278" } ] }, { "title": "ELL2, a new member of an ELL family of RNA polymerase II elongation factors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Shilatifard A, Duan DR, Haque D, Florence C, Schubach WH, Conaway JW, Conaway RC", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "reference": [ { "type": "PubMed", "id": "9108030", "url": "https://glygen.org/publication/PubMed/9108030" } ] }, { "title": "Differential in vivo activation of the class II and class III snRNA genes by the POU-specific domain of Oct-1.", "journal": "Nucleic acids research", "date": "1997", "authors": "Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9153304", "url": "https://glygen.org/publication/PubMed/9153304" } ] }, { "title": "Characterization of a trimeric complex containing Oct-1, SNAPc, and DNA.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ford E, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9188510", "url": "https://glygen.org/publication/PubMed/9188510" } ] }, { "title": "5'-Capping enzymes are targeted to pre-mRNA by binding to the phosphorylated carboxy-terminal domain of RNA polymerase II.", "journal": "Genes & development", "date": "1997", "authors": "McCracken S, Fong N, Rosonina E, Yankulov K, Brothers G, Siderovski D, Hessel A, Foster S, Shuman S, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9407024", "url": "https://glygen.org/publication/PubMed/9407024" } ] }, { "title": "ZNF76 and ZNF143 are two human homologs of the transcriptional activator Staf.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Myslinski E, Krol A, Carbon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9705341", "url": "https://glygen.org/publication/PubMed/9705341" } ] }, { "title": "The Oct-1 POU domain activates snRNA gene transcription by contacting a region in the SNAPc largest subunit that bears sequence similarities to the Oct-1 coactivator OBF-1.", "journal": "Genes & development", "date": "1998", "authors": "Ford E, Strubin M, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9832505", "url": "https://glygen.org/publication/PubMed/9832505" } ] } ], "pathway": [ { "id": "hsa:22936", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:22936", "resource": "KEGG Pathway" }, { "id": "R-HSA-6807505", "name": "RNA polymerase II transcribes snRNA genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505", "resource": "Reactome", "description": "RNA polymerase II transcribes snRNA genes" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A480JTG5-1", "protein_name": "RNA polymerase II elongation factor ELL2", "gene_name": "ELL2", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAAGGAAGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLQGLVKIPKNDPPNEVHTFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDAVPERKRSTPMNPANTIRKTHGSSSVSQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNPKDLSYTLKDYVFKELQRDWPGYNEIDRRSLESVLSRKLNSSQNAASTSRSESPVCSSRDSASSPQKRLLDSDFIDPLMNKKARISHLTNRVPPTLNGHLNPSSEKSAAGPPTPPAAAAIPTPPPLPSTHLPVSNPPQTVNSNSNSPSTPEGRGTQDLPVDSFSQNGRIYEDQQDKYTSRTSLETLPPGSVLLKCPKPLEENHSSHKKSKKKSKKHKEKDQIKKHDIEMIEEKEEDLKREEEIAKLNNSSPDSNEGVKEGCTASTEPSSTIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWH", "length": 640 }, "evidence": [ { "id": "O00472", "url": "https://omabrowser.org/oma/group/O00472/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8I6A5G5-1", "protein_name": "Elongation factor for RNA polymerase II 2", "gene_name": "Ell2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAGGAAGLREEQRYGLACGRLGQDNITVLHVKLTETAIRALETYQSQKSLIPFQPSIQFQGLQGLMKIPKNDPFNEVHNFNFYLSNVGKDNPQGSFDCIQQTLSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAISDAVPERKRSTPMNPANTIRKMHGGSSVSQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNPKDLSYTLKDYVFKELQRDWPGYSETDKQTLDLVLSRKLNPSQNAGTSRPESPMCSSKDAASSPQKRPLDSDFIDPLTNKKARISHLTNRVPPTLNGHLNPTNEKSCASLLPPPAAAAIPTPSPLPSTHLPVSNPTQTVNSNSNSPSTPEGRGTQDLPVDSFSQNSSIFEDQQDKYTSRTCLEETLPSSSALLKCPKPMEEEHPVSHKKSKKKSKKHKEKDQIKKHDIESREEKEKDLQREETAKLSNDSPNPNEGVKEECTASMEPSSTIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWH", "length": 640 }, "evidence": [ { "id": "45928131", "url": "http://www.informatics.jax.org/homology/45928131", "database": "MGI" }, { "id": "O00472", "url": "https://omabrowser.org/oma/group/O00472/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q3UKU1-1", "protein_name": "RNA polymerase II elongation factor ELL2", "gene_name": "Ell2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAGGAAGLREEQRYGLACGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLQGLMKIPKNDPFNEVQNFNFYLSNVGRDNPQGSFDCIQQTLSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAISDTVPERKRSTPMNPANTIRKMHSGNSVSQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNPKDLSYTLKDYVFKELQRDWPGYSETDRQTLDLVLSRKLNPSQNASTSRSESPLCSSKDAASSPQKRPLDSDFIDPLMNKKARISHLTNRVPPTLNGYLNPTSEKSCAGLLPPPAAAAIPTLSPLPSTHLPVSNPPQTVNSNSNSPSTPEGLGTQDLPVDSFSQNGSIFEDQQEKYTSRTCLETLPPSSALLKCPKPMEEEHPVSHKKSKKKSKKHKEKDQIKKLDIETMEEKEEDLQREETAKLSNASPNPNEGVKEGCTASMEPSSALELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWH", "length": 639 }, "evidence": [ { "id": "45928131", "url": "http://www.informatics.jax.org/homology/45928131", "database": "MGI" }, { "id": "O00472", "url": "https://omabrowser.org/oma/group/O00472/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "transcription elongation factor complex", "id": "GO:0008023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008023", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "transcription elongation by RNA polymerase II", "id": "GO:0006368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006368", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "pmid": "" }, { "name": "positive regulation of transcription elongation by RNA polymerase II", "id": "GO:0032968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032968", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "pmid": "" }, { "name": "snRNA transcription by RNA polymerase II", "id": "GO:0042795", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042795", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cis-regulatory region sequence-specific DNA binding", "id": "GO:0000987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000987", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 128, "end_pos": 130, "annotation": "n_glycosylation_sequon" }, { "start_pos": 147, "end_pos": 149, "annotation": "n_glycosylation_sequon" }, { "start_pos": 26, "end_pos": 28, "annotation": "n_glycosylation_sequon" }, { "start_pos": 418, "end_pos": 420, "annotation": "n_glycosylation_sequon" }, { "start_pos": 454, "end_pos": 456, "annotation": "n_glycosylation_sequon" }, { "start_pos": 500, "end_pos": 502, "annotation": "n_glycosylation_sequon" }, { "start_pos": 501, "end_pos": 503, "annotation": "n_glycosylation_sequon" }, { "start_pos": 505, "end_pos": 507, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated by SIAH1, leading to its degradation by the proteasome. Interaction with AFF4 stabilizes ELL2 and prevents ELL2 ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "O00472", "url": "https://www.uniprot.org/uniprot/O00472" }, { "database": "PubMed", "id": "22483617", "url": "https://glygen.org/publication/PubMed/22483617" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 500 ], "o_linked_sites": [], "snv_sites": [ 82, 197, 293, 298, 336 ], "glycation_sites": [], "phosphorylation_sites": [ 305, 310, 315, 316, 502, 503, 506, 580, 604 ], "sequon_annotation_sites": [ { "start_pos": 128, "end_pos": 130 }, { "start_pos": 147, "end_pos": 149 }, { "start_pos": 26, "end_pos": 28 }, { "start_pos": 418, "end_pos": 420 }, { "start_pos": 454, "end_pos": 456 }, { "start_pos": 500, "end_pos": 502 }, { "start_pos": 501, "end_pos": 503 }, { "start_pos": 505, "end_pos": 507 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 3 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 3 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }