{ "uniprot_canonical_ac": "O00194-1", "uniprot_ac": "O00194", "uniprot_id": "RB27B_HUMAN", "mass": { "chemical_mass": 24608.0, "monoisotopic_mass": 24608.0 }, "refseq": { "ac": "NP_004154", "name": "ras-related protein Rab-27B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, "gene_names": [ { "name": "RAB27B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00194", "id": "O00194" }, { "name": "C25KG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154", "id": "NP_004154" }, { "name": "RAB27B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154", "id": "NP_004154" } ], "protein_names": [ { "name": "Ras-related protein Rab-27B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00194" }, { "name": "3.6.5.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00194" }, { "name": "C25KG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00194" }, { "name": "ras-related protein Rab-27B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154", "id": "NP_004154" } ], "function": [ { "annotation": "Chromosomal mapping and gene structure of the RAB27B gene.", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, { "database": "PubMed", "id": "11178108", "url": "https://glygen.org/publication/PubMed/11178108" } ] }, { "annotation": "RAB27A and RAB27B Expression May Predict Lymph Node Metastasis and Survival in Patients With Gastric Cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, { "database": "PubMed", "id": "35985682", "url": "https://glygen.org/publication/PubMed/35985682" } ] }, { "annotation": "RAB27B Drives a Cancer Stem Cell Phenotype in NSCLC Cells Through Enhanced Extracellular Vesicle Secretion. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, { "database": "PubMed", "id": "37077938", "url": "https://glygen.org/publication/PubMed/37077938" } ] }, { "annotation": "RAB27B controls palmitoylation-dependent NRAS trafficking and signaling in myeloid leukemia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, { "database": "PubMed", "id": "37317963", "url": "https://glygen.org/publication/PubMed/37317963" } ] }, { "annotation": "Rab27b promotes endometriosis by enhancing invasiveness of ESCs and promoting angiogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, { "database": "PubMed", "id": "37641372", "url": "https://glygen.org/publication/PubMed/37641372" } ] }, { "annotation": "Rab27b, a Regulator of Exosome Secretion, Is Associated With Peritoneal Metastases in Gastric Cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" }, { "database": "PubMed", "id": "36581340", "url": "https://glygen.org/publication/PubMed/36581340" } ] }, { "annotation": "Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion (PubMed:30771381). Plays a role in NTRK2/TRKB axonal anterograde transport by facilitating the association of NTRK2/TRKB with KLC1 (PubMed:21775604). May be involved in targeting uroplakins to urothelial apical membranes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194#function" }, { "database": "PubMed", "id": "30771381", "url": "https://glygen.org/publication/PubMed/30771381" }, { "database": "UniProtKB", "id": "Q8HZJ5", "url": "https://www.uniprot.org/uniprot/Q8HZJ5#function" }, { "database": "PubMed", "id": "21775604", "url": "https://glygen.org/publication/PubMed/21775604" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O00194", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00194" } ], "glycoeffect": [], "start_pos": 16, "end_pos": 16, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "G", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "18", "chr_pos": "54877631", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "G16", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 23, "end_pos": 23, "sequence_org": "T", "sequence_mut": "N", "comment": "GDP-locked. Increases interaction with DENND10. Disrupts late endocytic pathway homeostasis.", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" }, { "database": "PubMed", "id": "30771381", "url": "https://glygen.org/publication/PubMed/30771381" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "Q", "sequence_mut": "L", "comment": "GTP-locked. decreases interaction with DENND10.", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" }, { "database": "PubMed", "id": "30771381", "url": "https://glygen.org/publication/PubMed/30771381" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "54.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "78.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "55.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "79.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "46.54", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "59.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "78.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "71.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00194" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "common_name": "Human" } ], "gene": [ { "name": "RAB27B", "url": "https://www.uniprot.org/uniprot/O00194", "locus": { "chromosome": "18", "start_pos": 54895516, "end_pos": 54717860, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000041353", "url": "https://www.ensembl.org/id/ENSG00000041353" } ] } } ], "crossref": [ { "id": "ENSG00000041353", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000041353", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O00194", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00194", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd04127", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04127", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "RAB27B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RAB27B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5874", "url": "https://www.ncbi.nlm.nih.gov/gene/5874", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9767", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9767", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00194", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00194*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041837", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041837", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5874", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5874", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603869", "url": "http://www.omim.org/entry/603869", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00194", "url": "https://www.nextprot.org/entry/NX_O00194", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00194", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00194", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FESLEGW", "url": "https://omabrowser.org/oma/group/FESLEGW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "8685at2759", "url": "http://www.orthodb.org/?query=8685at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47977", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47977", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47977:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47977:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2F7S", "url": "https://www.rcsb.org/structure/2F7S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00194", "url": "https://pharos.nih.gov/targets/O00194", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00194", "url": "http://purl.obolibrary.org/obo/PR_O00194", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19669", "url": "https://www.rhea-db.org/rhea/19669", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "K7EJ38", "url": "https://www.uniprot.org/uniprot/K7EJ38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJ38-1", "url": "https://www.uniprot.org/uniprot/K7EJ38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ES41", "url": "https://www.uniprot.org/uniprot/K7ES41", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ES41-1", "url": "https://www.uniprot.org/uniprot/K7ES41-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00194-1", "url": "https://www.uniprot.org/uniprot/O00194-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC", "length": 218, "header": "sp|O00194-1|RB27B_HUMAN Isoform 1 of Ras-related protein Rab-27B OS=Homo sapiens OX=9606 GN=RAB27B PE=1 SV=4 CANONICAL=O00194-1" }, "isoforms": [ { "isoform_ac": "K7EJ38-1", "url": "", "sequence": { "sequence": "XFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGCKLSTLGINKFDEACLSLHQWSCSLFCISLHLKRIHNSFLIAYYTKRLREKSSFVKDFGCII", "length": 131, "header": "tr|K7EJ38-1|RB27B_HUMAN Computationally mapped isoform of Ras-related protein Rab-27B OS=Homo sapiens OX=9606 GN=RAB27B PE=1 SV=1 CANONICAL=O00194-1" }, "locus": { "chromosome": "18", "start_pos": 54893271, "end_pos": 54884357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592334.1", "url": "https://www.ensembl.org/id/ENST00000592334.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465009.1", "url": "https://www.ensembl.org/id/ENSP00000465009.1" } ] } }, { "isoform_ac": "K7ES41-1", "url": "", "sequence": { "sequence": "MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTA", "length": 87, "header": "tr|K7ES41-1|RB27B_HUMAN Computationally mapped isoform of Ras-related protein Rab-27B OS=Homo sapiens OX=9606 GN=RAB27B PE=1 SV=1 CANONICAL=O00194-1" }, "locus": { "chromosome": "18", "start_pos": 54884354, "end_pos": 54877586, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000586570.5", "url": "https://www.ensembl.org/id/ENST00000586570.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000468542.1", "url": "https://www.ensembl.org/id/ENSP00000468542.1" } ] } }, { "isoform_ac": "O00194-1", "url": "", "sequence": { "sequence": "MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC", "length": 218, "header": "sp|O00194-1|RB27B_HUMAN Isoform 1 of Ras-related protein Rab-27B OS=Homo sapiens OX=9606 GN=RAB27B PE=1 SV=4 CANONICAL=O00194-1" }, "locus": { "chromosome": "18", "start_pos": 54889410, "end_pos": 54877586, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000262094.10", "url": "https://www.ensembl.org/id/ENST00000262094.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000262094.4", "url": "https://www.ensembl.org/id/ENSP00000262094.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O00194", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00194" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A novel membrane-anchored Rab5 interacting protein required for homotypic endosome fusion.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hoffenberg S, Liu X, Nikolova L, Hall HS, Dai W, Baughn RE, Dickey BF, Barbieri MA, Aballay A, Stahl PD, Knoll BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "10818110", "url": "https://glygen.org/publication/PubMed/10818110" } ] }, { "title": "Ric1p and Rgp1p form a complex that catalyses nucleotide exchange on Ypt6p.", "journal": "The EMBO journal", "date": "2000", "authors": "Siniossoglou S, Peak-Chew SY, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "10990452", "url": "https://glygen.org/publication/PubMed/10990452" } ] }, { "title": "TRAPP stimulates guanine nucleotide exchange on Ypt1p.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Wang W, Sacher M, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11038176", "url": "https://glygen.org/publication/PubMed/11038176" } ] }, { "title": "Allosteric regulation of substrate binding and product release in geranylgeranyltransferase type II.", "journal": "Biochemistry", "date": "2001", "authors": "Thoma NH, Iakovenko A, Kalinin A, Waldmann H, Goody RS, Alexandrov K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "11141079", "url": "https://glygen.org/publication/PubMed/11141079" } ] }, { "title": "Chromosomal mapping, gene structure and characterization of the human and murine RAB27B gene.", "journal": "BMC Genet.", "date": "2001", "authors": "Ramalho JS, Tolmachova T, Hume AN, McGuigan A, Gregory-Evans CY, Huxley C, Seabra MC", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" }, { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" } ], "reference": [ { "type": "PubMed", "id": "11178108", "url": "https://glygen.org/publication/PubMed/11178108" } ] }, { "title": "Rab-interacting lysosomal protein (RILP): the Rab7 effector required for transport to lysosomes.", "journal": "The EMBO journal", "date": "2001", "authors": "Cantalupo G, Alifano P, Roberti V, Bruni CB, Bucci C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11179213", "url": "https://glygen.org/publication/PubMed/11179213" } ] }, { "title": "Membrane targeting of a Rab GTPase that fails to associate with Rab escort protein (REP) or guanine nucleotide dissociation inhibitor (GDI).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overmeyer JH, Wilson AL, Maltese WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "11389151", "url": "https://glygen.org/publication/PubMed/11389151" } ] }, { "title": "Interaction of farnesylated PRL-2, a protein-tyrosine phosphatase, with the beta-subunit of geranylgeranyltransferase II.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Si X, Zeng Q, Ng CH, Hong W, Pallen CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "11447212", "url": "https://glygen.org/publication/PubMed/11447212" } ] }, { "title": "GRAB: a physiologic guanine nucleotide exchange factor for Rab3A, which interacts with inositol hexakisphosphate kinase.", "journal": "Neuron", "date": "2001", "authors": "Luo HR, Saiardi A, Nagata E, Ye K, Yu H, Jung TS, Luo X, Jain S, Sawa A, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11516400", "url": "https://glygen.org/publication/PubMed/11516400" } ] }, { "title": "Phosphoisoprenoids modulate association of Rab geranylgeranyltransferase with REP-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thoma NH, Iakovenko A, Goody RS, Alexandrov K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "11675392", "url": "https://glygen.org/publication/PubMed/11675392" } ] }, { "title": "An effector of Ypt6p binds the SNARE Tlg1p and mediates selective fusion of vesicles with late Golgi membranes.", "journal": "The EMBO journal", "date": "2001", "authors": "Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11689439", "url": "https://glygen.org/publication/PubMed/11689439" } ] }, { "title": "Ras-activated endocytosis is mediated by the Rab5 guanine nucleotide exchange activity of RIN1.", "journal": "Developmental cell", "date": "2001", "authors": "Tall GG, Barbieri MA, Stahl PD, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11703925", "url": "https://glygen.org/publication/PubMed/11703925" } ] }, { "title": "Role of rRAB22b, an oligodendrocyte protein, in regulation of transport of vesicles from trans Golgi to endocytic compartments.", "journal": "Journal of neuroscience research", "date": "2001", "authors": "Rodriguez-Gabin AG, Cammer M, Almazan G, Charron M, Larocca JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11746448", "url": "https://glygen.org/publication/PubMed/11746448" } ] }, { "title": "Molecular cloning, bacterial expression and properties of Rab31 and Rab32.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Bao X, Faris AE, Jang EK, Haslam RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11784320", "url": "https://glygen.org/publication/PubMed/11784320" } ] }, { "title": "Mutation of melanosome protein RAB38 in chocolate mice.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Loftus SK, Larson DM, Baxter LL, Antonellis A, Chen Y, Wu X, Jiang Y, Bittner M, Hammer JA 3rd, Pavan WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "11917121", "url": "https://glygen.org/publication/PubMed/11917121" } ] }, { "title": "The small GTPase Rab13 regulates assembly of functional tight junctions in epithelial cells.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Marzesco AM, Dunia I, Pandjaitan R, Recouvreur M, Dauzonne D, Benedetti EL, Louvard D, Zahraoui A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12058051", "url": "https://glygen.org/publication/PubMed/12058051" } ] }, { "title": "A Rab8-specific GDP/GTP exchange factor is involved in actin remodeling and polarized membrane transport.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Hattula K, Furuhjelm J, Arffman A, Peranen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12221131", "url": "https://glygen.org/publication/PubMed/12221131" } ] }, { "title": "Mutations in Rab3a alter circadian period and homeostatic response to sleep loss in the mouse.", "journal": "Nature genetics", "date": "2002", "authors": "Kapfhamer D, Valladares O, Sun Y, Nolan PM, Rux JJ, Arnold SE, Veasey SC, Bucan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12244319", "url": "https://glygen.org/publication/PubMed/12244319" } ] }, { "title": "The Ccz1-Mon1 protein complex is required for the late step of multiple vacuole delivery pathways.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang CW, Stromhaug PE, Shima J, Klionsky DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12364329", "url": "https://glygen.org/publication/PubMed/12364329" } ] }, { "title": "Molecular cloning and characterization of prokineticin receptors.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Soga T, Matsumoto Si, Oda T, Saito T, Hiyama H, Takasaki J, Kamohara M, Ohishi T, Matsushime H, Furuichi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12427552", "url": "https://glygen.org/publication/PubMed/12427552" } ] }, { "title": "ADAM10-mediated cleavage of L1 adhesion molecule at the cell surface and in released membrane vesicles.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2003", "authors": "Gutwein P, Mechtersheimer S, Riedle S, Stoeck A, Gast D, Joumaa S, Zentgraf H, Fogel M, Altevogt DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12475894", "url": "https://glygen.org/publication/PubMed/12475894" } ] }, { "title": "Rab39, a novel Golgi-associated Rab GTPase from human dendritic cells involved in cellular endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Chen T, Han Y, Yang M, Zhang W, Li N, Wan T, Guo J, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12684051", "url": "https://glygen.org/publication/PubMed/12684051" } ] }, { "title": "Phagosomes fuse with late endosomes and/or lysosomes by extension of membrane protrusions along microtubules: role of Rab7 and RILP.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Harrison RE, Bucci C, Vieira OV, Schroer TA, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12944476", "url": "https://glygen.org/publication/PubMed/12944476" } ] }, { "title": "RIN3: a novel Rab5 GEF interacting with amphiphysin II involved in the early endocytic pathway.", "journal": "Journal of cell science", "date": "2003", "authors": "Kajiho H, Saito K, Tsujita K, Kontani K, Araki Y, Kurosu H, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "12972505", "url": "https://glygen.org/publication/PubMed/12972505" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Rab13 regulates PKA signaling during tight junction assembly.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Kohler K, Louvard D, Zahraoui A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15096524", "url": "https://glygen.org/publication/PubMed/15096524" } ] }, { "title": "Rab7 is required for the normal progression of the autophagic pathway in mammalian cells.", "journal": "Journal of cell science", "date": "2004", "authors": "Gutierrez MG, Munafo DB, Beron W, Colombo MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15138286", "url": "https://glygen.org/publication/PubMed/15138286" } ] }, { "title": "The small GTPase rab5 functions as a regulatory factor in the early endocytic pathway.", "journal": "Cell", "date": "1992", "authors": "Bucci C, Parton RG, Mather IH, Stunnenberg H, Simons K, Hoflack B, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "1516130", "url": "https://glygen.org/publication/PubMed/1516130" } ] }, { "title": "Homo-oligomerization of ALS2 through its unique carboxyl-terminal regions is essential for the ALS2-associated Rab5 guanine nucleotide exchange activity and its regulatory function on endosome trafficking.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kunita R, Otomo A, Mizumura H, Suzuki K, Showguchi-Miyata J, Yanagisawa Y, Hadano S, Ikeda JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15247254", "url": "https://glygen.org/publication/PubMed/15247254" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "ALS2CL, the novel protein highly homologous to the carboxy-terminal half of ALS2, binds to Rab5 and modulates endosome dynamics.", "journal": "FEBS letters", "date": "2004", "authors": "Hadano S, Otomo A, Suzuki-Utsunomiya K, Kunita R, Yanagisawa Y, Showguchi-Miyata J, Mizumura H, Ikeda JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15388334", "url": "https://glygen.org/publication/PubMed/15388334" } ] }, { "title": "Rab13 mediates the continuous endocytic recycling of occludin to the cell surface.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Morimoto S, Nishimura N, Terai T, Manabe S, Yamamoto Y, Shinahara W, Miyake H, Tashiro S, Shimada M, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15528189", "url": "https://glygen.org/publication/PubMed/15528189" } ] }, { "title": "A role for the small GTPase Rab21 in the early endocytic pathway.", "journal": "Journal of cell science", "date": "2004", "authors": "Simpson JC, Griffiths G, Wessling-Resnick M, Fransen JA, Bennett H, Jones AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15561770", "url": "https://glygen.org/publication/PubMed/15561770" } ] }, { "title": "ADAM10 cleavage of N-cadherin and regulation of cell-cell adhesion and beta-catenin nuclear signalling.", "journal": "The EMBO journal", "date": "2005", "authors": "Reiss K, Maretzky T, Ludwig A, Tousseyn T, de Strooper B, Hartmann D, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15692570", "url": "https://glygen.org/publication/PubMed/15692570" } ] }, { "title": "Characterization of the human GARP (Golgi associated retrograde protein) complex.", "journal": "Experimental cell research", "date": "2005", "authors": "Liewen H, Meinhold-Heerlein I, Oliveira V, Schwarzenbacher R, Luo G, Wadle A, Jung M, Pfreundschuh M, Stenner-Liewen F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15878329", "url": "https://glygen.org/publication/PubMed/15878329" } ] }, { "title": "Rab18 localizes to lipid droplets and induces their close apposition to the endoplasmic reticulum-derived membrane.", "journal": "Journal of cell science", "date": "2005", "authors": "Ozeki S, Cheng J, Tauchi-Sato K, Hatano N, Taniguchi H, Fujimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15914536", "url": "https://glygen.org/publication/PubMed/15914536" } ] }, { "title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "15958533", "url": "https://glygen.org/publication/PubMed/15958533" } ] }, { "title": "Regulated localization of Rab18 to lipid droplets: effects of lipolytic stimulation and inhibition of lipid droplet catabolism.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Martin S, Driessen K, Nixon SJ, Zerial M, Parton RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16207721", "url": "https://glygen.org/publication/PubMed/16207721" } ] }, { "title": "Transcript profiling in peripheral T-cell lymphoma, not otherwise specified, and diffuse large B-cell lymphoma identifies distinct tumor profile signatures.", "journal": "Molecular cancer therapeutics", "date": "2005", "authors": "Mahadevan D, Spier C, Della Croce K, Miller S, George B, Riley C, Warner S, Grogan TM, Miller TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16373702", "url": "https://glygen.org/publication/PubMed/16373702" } ] }, { "title": "Thematic review series: lipid posttranslational modifications. geranylgeranylation of Rab GTPases.", "journal": "Journal of lipid research", "date": "2006", "authors": "Leung KF, Baron R, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "16401880", "url": "https://glygen.org/publication/PubMed/16401880" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "Isoprenoid modification of rab proteins terminating in CC or CXC motifs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Khosravi-Far R, Lutz RJ, Cox AD, Conroy L, Bourne JR, Sinensky M, Balch WE, Buss JE, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "1648736", "url": "https://glygen.org/publication/PubMed/1648736" } ] }, { "title": "JRAB/MICAL-L2 is a junctional Rab13-binding protein mediating the endocytic recycling of occludin.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Terai T, Nishimura N, Kanda I, Yasui N, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16525024", "url": "https://glygen.org/publication/PubMed/16525024" } ] }, { "title": "Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics.", "journal": "Journal of cell science", "date": "2006", "authors": "Zhang X, He X, Fu XY, Chang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16525121", "url": "https://glygen.org/publication/PubMed/16525121" } ] }, { "title": "Regulation of synaptic transmission by RAB-3 and RAB-27 in Caenorhabditis elegans.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Mahoney TR, Liu Q, Itoh T, Luo S, Hadwiger G, Vincent R, Wang ZW, Fukuda M, Nonet ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16571673", "url": "https://glygen.org/publication/PubMed/16571673" } ] }, { "title": "Rab10 regulates membrane transport through early endosomes of polarized Madin-Darby canine kidney cells.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Babbey CM, Ahktar N, Wang E, Chen CC, Grant BD, Dunn KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16641372", "url": "https://glygen.org/publication/PubMed/16641372" } ] }, { "title": "Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Pellinen T, Arjonen A, Vuoriluoto K, Kallio K, Fransen JA, Ivaska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16754960", "url": "https://glygen.org/publication/PubMed/16754960" } ] }, { "title": "Constitutive GDP/GTP exchange and secretion-dependent GTP hydrolysis activity for Rab27 in platelets.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kondo H, Shirakawa R, Higashi T, Kawato M, Fukuda M, Kita T, Horiuchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16880209", "url": "https://glygen.org/publication/PubMed/16880209" } ] }, { "title": "Rab35 regulates an endocytic recycling pathway essential for the terminal steps of cytokinesis.", "journal": "Current biology : CB", "date": "2006", "authors": "Kouranti I, Sachse M, Arouche N, Goud B, Echard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "16950109", "url": "https://glygen.org/publication/PubMed/16950109" } ] }, { "title": "Rab38 and Rab32 control post-Golgi trafficking of melanogenic enzymes.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Wasmeier C, Romao M, Plowright L, Bennett DC, Raposo G, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17043139", "url": "https://glygen.org/publication/PubMed/17043139" } ] }, { "title": "Rab GTPases containing a CAAX motif are processed post-geranylgeranylation by proteolysis and methylation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Leung KF, Baron R, Ali BR, Magee AI, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "17114793", "url": "https://glygen.org/publication/PubMed/17114793" } ] }, { "title": "Rab10 is involved in basolateral transport in polarized Madin-Darby canine kidney cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Schuck S, Gerl MJ, Ang A, Manninen A, Keller P, Mellman I, Simons K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17132146", "url": "https://glygen.org/publication/PubMed/17132146" } ] }, { "title": "Gapex-5, a Rab31 guanine nucleotide exchange factor that regulates Glut4 trafficking in adipocytes.", "journal": "Cell metabolism", "date": "2007", "authors": "Lodhi IJ, Chiang SH, Chang L, Vollenweider D, Watson RT, Inoue M, Pessin JE, Saltiel AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17189207", "url": "https://glygen.org/publication/PubMed/17189207" } ] }, { "title": "Rabs 8A and 14 are targets of the insulin-regulated Rab-GAP AS160 regulating GLUT4 traffic in muscle cells.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Ishikura S, Bilan PJ, Klip A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17208202", "url": "https://glygen.org/publication/PubMed/17208202" } ] }, { "title": "ALS2CL, a novel ALS2-interactor, modulates ALS2-mediated endosome dynamics.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Suzuki-Utsunomiya K, Hadano S, Otomo A, Kunita R, Mizumura H, Osuga H, Ikeda JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17239822", "url": "https://glygen.org/publication/PubMed/17239822" } ] }, { "title": "TRAPPI tethers COPII vesicles by binding the coat subunit Sec23.", "journal": "Nature", "date": "2007", "authors": "Cai H, Yu S, Menon S, Cai Y, Lazarova D, Fu C, Reinisch K, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17287728", "url": "https://glygen.org/publication/PubMed/17287728" } ] }, { "title": "Towards complete sets of farnesylated and geranylgeranylated proteins.", "journal": "PLoS computational biology", "date": "2007", "authors": "Maurer-Stroh S, Koranda M, Benetka W, Schneider G, Sirota FL, Eisenhaber F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "17411337", "url": "https://glygen.org/publication/PubMed/17411337" } ] }, { "title": "Rab18 inhibits secretory activity in neuroendocrine cells by interacting with secretory granules.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Vazquez-Martinez R, Cruz-Garcia D, Duran-Prado M, Peinado JR, Castano JP, Malagon MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17488286", "url": "https://glygen.org/publication/PubMed/17488286" } ] }, { "title": "Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Fuchs E, Haas AK, Spooner RA, Yoshimura S, Lord JM, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17562788", "url": "https://glygen.org/publication/PubMed/17562788" } ] }, { "title": "A core complex of BBS proteins cooperates with the GTPase Rab8 to promote ciliary membrane biogenesis.", "journal": "Cell", "date": "2007", "authors": "Nachury MV, Loktev AV, Zhang Q, Westlake CJ, Peranen J, Merdes A, Slusarski DC, Scheller RH, Bazan JF, Sheffield VC, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17574030", "url": "https://glygen.org/publication/PubMed/17574030" } ] }, { "title": "Functional dissection of Rab GTPases involved in primary cilium formation.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Yoshimura S, Egerer J, Fuchs E, Haas AK, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17646400", "url": "https://glygen.org/publication/PubMed/17646400" } ] }, { "title": "Melanosome maturation defect in Rab38-deficient retinal pigment epithelium results in instability of immature melanosomes during transient melanogenesis.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Lopes VS, Wasmeier C, Seabra MC, Futter CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17671165", "url": "https://glygen.org/publication/PubMed/17671165" } ] }, { "title": "Rab22B's role in trans-Golgi network membrane dynamics.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Ng EL, Wang Y, Tang BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "17678623", "url": "https://glygen.org/publication/PubMed/17678623" } ] }, { "title": "Rab10 in insulin-stimulated GLUT4 translocation.", "journal": "The Biochemical journal", "date": "2008", "authors": "Sano H, Roach WG, Peck GR, Fukuda M, Lienhard GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18076383", "url": "https://glygen.org/publication/PubMed/18076383" } ] }, { "title": "The interaction of JRAB/MICAL-L2 with Rab8 and Rab13 coordinates the assembly of tight junctions and adherens junctions.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Yamamura R, Nishimura N, Nakatsuji H, Arase S, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18094055", "url": "https://glygen.org/publication/PubMed/18094055" } ] }, { "title": "Regulation of endocytic recycling by C. elegans Rab35 and its regulator RME-4, a coated-pit protein.", "journal": "The EMBO journal", "date": "2008", "authors": "Sato M, Sato K, Liou W, Pant S, Harada A, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18354496", "url": "https://glygen.org/publication/PubMed/18354496" } ] }, { "title": "Requirement of the human GARP complex for mannose 6-phosphate-receptor-dependent sorting of cathepsin D to lysosomes.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Perez-Victoria FJ, Mardones GA, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18367545", "url": "https://glygen.org/publication/PubMed/18367545" } ] }, { "title": "A small GTP-binding protein dissociates from synaptic vesicles during exocytosis.", "journal": "Nature", "date": "1991", "authors": "Fischer von Mollard G, Sudhof TC, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "1845915", "url": "https://glygen.org/publication/PubMed/1845915" } ] }, { "title": "Varp interacts with Rab38 and functions as its potential effector.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Wang F, Zhang H, Zhang X, Wang Y, Ren F, Zhang X, Zhai Y, Chang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18477474", "url": "https://glygen.org/publication/PubMed/18477474" } ] }, { "title": "Rab geranylgeranylation occurs preferentially via the pre-formed REP-RGGT complex and is regulated by geranylgeranyl pyrophosphate.", "journal": "The Biochemical journal", "date": "2008", "authors": "Baron RA, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "18532927", "url": "https://glygen.org/publication/PubMed/18532927" } ] }, { "title": "Rab3GEP is the non-redundant guanine nucleotide exchange factor for Rab27a in melanocytes.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Figueiredo AC, Wasmeier C, Tarafder AK, Ramalho JS, Baron RA, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18559336", "url": "https://glygen.org/publication/PubMed/18559336" } ] }, { "title": "The structural basis for activation of the Rab Ypt1p by the TRAPP membrane-tethering complexes.", "journal": "Cell", "date": "2008", "authors": "Cai Y, Chin HF, Lazarova D, Menon S, Fu C, Cai H, Sclafani A, Rodgers DW, De La Cruz EM, Ferro-Novick S, Reinisch KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18585354", "url": "https://glygen.org/publication/PubMed/18585354" } ] }, { "title": "Rab18 and Rab43 have key roles in ER-Golgi trafficking.", "journal": "Journal of cell science", "date": "2008", "authors": "Dejgaard SY, Murshid A, Erman A, Kizilay O, Verbich D, Lodge R, Dejgaard K, Ly-Hartig TB, Pepperkok R, Simpson JC, Presley JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18664496", "url": "https://glygen.org/publication/PubMed/18664496" } ] }, { "title": "Muscle cells engage Rab8A and myosin Vb in insulin-dependent GLUT4 translocation.", "journal": "American journal of physiology. Cell physiology", "date": "2008", "authors": "Ishikura S, Klip A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18701652", "url": "https://glygen.org/publication/PubMed/18701652" } ] }, { "title": "Rab13 regulates membrane trafficking between TGN and recycling endosomes in polarized epithelial cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Nokes RL, Fields IC, Collins RN, Folsch H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18779367", "url": "https://glygen.org/publication/PubMed/18779367" } ] }, { "title": "Integrin trafficking regulated by Rab21 is necessary for cytokinesis.", "journal": "Developmental cell", "date": "2008", "authors": "Pellinen T, Tuomi S, Arjonen A, Wolf M, Edgren H, Meyer H, Grosse R, Kitzing T, Rantala JK, Kallioniemi O, Fassler R, Kallio M, Ivaska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "18804435", "url": "https://glygen.org/publication/PubMed/18804435" } ] }, { "title": "rab5 controls early endosome fusion in vitro.", "journal": "Cell", "date": "1991", "authors": "Gorvel JP, Chavrier P, Zerial M, Gruenberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "1900457", "url": "https://glygen.org/publication/PubMed/1900457" } ] }, { "title": "Tracing the retrograde route in protein trafficking.", "journal": "Cell", "date": "2008", "authors": "Johannes L, Popoff V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19109890", "url": "https://glygen.org/publication/PubMed/19109890" } ] }, { "title": "Transport of mannose-6-phosphate receptors from the trans-Golgi network to endosomes requires Rab31.", "journal": "Experimental cell research", "date": "2009", "authors": "Rodriguez-Gabin AG, Yin X, Si Q, Larocca JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19345684", "url": "https://glygen.org/publication/PubMed/19345684" } ] }, { "title": "Varp is a novel Rab32/38-binding protein that regulates Tyrp1 trafficking in melanocytes.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Tamura K, Ohbayashi N, Maruta Y, Kanno E, Itoh T, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19403694", "url": "https://glygen.org/publication/PubMed/19403694" } ] }, { "title": "RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.", "journal": "Cell", "date": "2009", "authors": "Espinosa EJ, Calero M, Sridevi K, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19490898", "url": "https://glygen.org/publication/PubMed/19490898" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "Dual roles of the mammalian GARP complex in tethering and SNARE complex assembly at the trans-golgi network.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Perez-Victoria FJ, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19620288", "url": "https://glygen.org/publication/PubMed/19620288" } ] }, { "title": "mTrs130 is a component of a mammalian TRAPPII complex, a Rab1 GEF that binds to COPI-coated vesicles.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Yamasaki A, Menon S, Yu S, Barrowman J, Meerloo T, Oorschot V, Klumperman J, Satoh A, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19656848", "url": "https://glygen.org/publication/PubMed/19656848" } ] }, { "title": "Rab22B is expressed in the CNS astroglia lineage and plays a role in epidermal growth factor receptor trafficking in A431 cells.", "journal": "Journal of cellular physiology", "date": "2009", "authors": "Ng EL, Ng JJ, Liang F, Tang BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19725050", "url": "https://glygen.org/publication/PubMed/19725050" } ] }, { "title": "Rab35 controls actin bundling by recruiting fascin as an effector protein.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Zhang J, Fonovic M, Suyama K, Bogyo M, Scott MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19729655", "url": "https://glygen.org/publication/PubMed/19729655" } ] }, { "title": "Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.", "journal": "EMBO reports", "date": "2009", "authors": "Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "19745841", "url": "https://glygen.org/publication/PubMed/19745841" } ] }, { "title": "Rab13 regulates neurite outgrowth in PC12 cells through its effector protein, JRAB/MICAL-L2.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Sakane A, Honda K, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20008558", "url": "https://glygen.org/publication/PubMed/20008558" } ] }, { "title": "The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Marat AL, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20154091", "url": "https://glygen.org/publication/PubMed/20154091" } ] }, { "title": "Mutations in the small GTPase gene RAB39B are responsible for X-linked mental retardation associated with autism, epilepsy, and macrocephaly.", "journal": "American journal of human genetics", "date": "2010", "authors": "Giannandrea M, Bianchi V, Mignogna ML, Sirri A, Carrabino S, D'Elia E, Vecellio M, Russo S, Cogliati F, Larizza L, Ropers HH, Tzschach A, Kalscheuer V, Oehl-Jaschkowitz B, Skinner C, Schwartz CE, Gecz J, Van Esch H, Raynaud M, Chelly J, de Brouwer AP, Toniolo D, D'Adamo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20159109", "url": "https://glygen.org/publication/PubMed/20159109" } ] }, { "title": "The Connecdenn DENN domain: a GEF for Rab35 mediating cargo-specific exit from early endosomes.", "journal": "Molecular cell", "date": "2010", "authors": "Allaire PD, Marat AL, Dall'Armi C, Di Paolo G, McPherson PS, Ritter B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20159556", "url": "https://glygen.org/publication/PubMed/20159556" } ] }, { "title": "Identification of two evolutionarily conserved genes regulating processing of engulfed apoptotic cells.", "journal": "Nature", "date": "2010", "authors": "Kinchen JM, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20305638", "url": "https://glygen.org/publication/PubMed/20305638" } ] }, { "title": "Coordination of Rab8 and Rab11 in primary ciliogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Knodler A, Feng S, Zhang J, Zhang X, Das A, Peranen J, Guo W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20308558", "url": "https://glygen.org/publication/PubMed/20308558" } ] }, { "title": "Regulation of exosome secretion by Rab35 and its GTPase-activating proteins TBC1D10A-C.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Hsu C, Morohashi Y, Yoshimura S, Manrique-Hoyos N, Jung S, Lauterbach MA, Bakhti M, Gronborg M, Mobius W, Rhee J, Barr FA, Simons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20404108", "url": "https://glygen.org/publication/PubMed/20404108" } ] }, { "title": "Identification of the switch in early-to-late endosome transition.", "journal": "Cell", "date": "2010", "authors": "Poteryaev D, Datta S, Ackema K, Zerial M, Spang A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20434987", "url": "https://glygen.org/publication/PubMed/20434987" } ] }, { "title": "Junctional adhesion molecule-C is a soluble mediator of angiogenesis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Rabquer BJ, Amin MA, Teegala N, Shaheen MK, Tsou PS, Ruth JH, Lesch CA, Imhof BA, Koch AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20592283", "url": "https://glygen.org/publication/PubMed/20592283" } ] }, { "title": "The Mon1-Ccz1 complex is the GEF of the late endosomal Rab7 homolog Ypt7.", "journal": "Current biology : CB", "date": "2010", "authors": "Nordmann M, Cabrera M, Perz A, Brocker C, Ostrowicz C, Engelbrecht-Vandre S, Ungermann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20797862", "url": "https://glygen.org/publication/PubMed/20797862" } ] }, { "title": "Rab7: role of its protein interaction cascades in endo-lysosomal traffic.", "journal": "Cellular signalling", "date": "2011", "authors": "Wang T, Ming Z, Xiaochun W, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20851765", "url": "https://glygen.org/publication/PubMed/20851765" } ] }, { "title": "Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Yoshimura S, Gerondopoulos A, Linford A, Rigden DJ, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "20937701", "url": "https://glygen.org/publication/PubMed/20937701" } ] }, { "title": "Rab8A and Rab13 are activated by insulin and regulate GLUT4 translocation in muscle cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Sun Y, Bilan PJ, Liu Z, Klip A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21041651", "url": "https://glygen.org/publication/PubMed/21041651" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Transport according to GARP: receiving retrograde cargo at the trans-Golgi network.", "journal": "Trends in cell biology", "date": "2011", "authors": "Bonifacino JS, Hierro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21183348", "url": "https://glygen.org/publication/PubMed/21183348" } ] }, { "title": "Structure-function analysis of VPS9-ankyrin-repeat protein (Varp) in the trafficking of tyrosinase-related protein 1 in melanocytes.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Tamura K, Ohbayashi N, Ishibashi K, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21187289", "url": "https://glygen.org/publication/PubMed/21187289" } ] }, { "title": "Signaling, cytoskeletal and membrane mechanisms regulating GLUT4 exocytosis.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "2011", "authors": "Hoffman NJ, Elmendorf JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21216617", "url": "https://glygen.org/publication/PubMed/21216617" } ] }, { "title": "Primary cilia membrane assembly is initiated by Rab11 and transport protein particle II (TRAPPII) complex-dependent trafficking of Rabin8 to the centrosome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Westlake CJ, Baye LM, Nachury MV, Wright KJ, Ervin KE, Phu L, Chalouni C, Beck JS, Kirkpatrick DS, Slusarski DC, Sheffield VC, Scheller RH, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21273506", "url": "https://glygen.org/publication/PubMed/21273506" } ] }, { "title": "DENN domain proteins: regulators of Rab GTPases.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Marat AL, Dokainish H, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21330364", "url": "https://glygen.org/publication/PubMed/21330364" } ] }, { "title": "Entry at the trans-face of the Golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21421921", "url": "https://glygen.org/publication/PubMed/21421921" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "Loss of skywalker reveals synaptic endosomes as sorting stations for synaptic vesicle proteins.", "journal": "Cell", "date": "2011", "authors": "Uytterhoeven V, Kuenen S, Kasprowicz J, Miskiewicz K, Verstreken P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21458671", "url": "https://glygen.org/publication/PubMed/21458671" } ] }, { "title": "Sequential interactions with Sec23 control the direction of vesicle traffic.", "journal": "Nature", "date": "2011", "authors": "Lord C, Bhandari D, Menon S, Ghassemian M, Nycz D, Hay J, Ghosh P, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21532587", "url": "https://glygen.org/publication/PubMed/21532587" } ] }, { "title": "Rab27a targeting to melanosomes requires nucleotide exchange but not effector binding.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Tarafder AK, Wasmeier C, Figueiredo AC, Booth AE, Orihara A, Ramalho JS, Hume AN, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21554507", "url": "https://glygen.org/publication/PubMed/21554507" } ] }, { "title": "Characterization of RIN3 as a guanine nucleotide exchange factor for the Rab5 subfamily GTPase Rab31.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kajiho H, Sakurai K, Minoda T, Yoshikawa M, Nakagawa S, Fukushima S, Kontani K, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21586568", "url": "https://glygen.org/publication/PubMed/21586568" } ] }, { "title": "Membrane dynamics and fusion at late endosomes and vacuoles--Rab regulation, multisubunit tethering complexes and SNAREs.", "journal": "European journal of cell biology", "date": "2011", "authors": "Epp N, Rethmeier R, Kramer L, Ungermann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21683469", "url": "https://glygen.org/publication/PubMed/21683469" } ] }, { "title": "Rab35 GTPase and OCRL phosphatase remodel lipids and F-actin for successful cytokinesis.", "journal": "Nature cell biology", "date": "2011", "authors": "Dambournet D, Machicoane M, Chesneau L, Sachse M, Rocancourt M, El Marjou A, Formstecher E, Salomon R, Goud B, Echard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21706022", "url": "https://glygen.org/publication/PubMed/21706022" } ] }, { "title": "Small GTPase Rab12 regulates constitutive degradation of transferrin receptor.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Matsui T, Itoh T, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21718402", "url": "https://glygen.org/publication/PubMed/21718402" } ] }, { "title": "JIP3 mediates TrkB axonal anterograde transport and enhances BDNF signaling by directly bridging TrkB with kinesin-1.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011-07-20", "authors": "Huang Shu-Hong, Duan Shan, Sun Tao, Wang Jue, Zhao Ling, Geng Zhao, Yan Jing, Sun Hai-Ji, Chen Zhe-Yu", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "reference": [ { "type": "PubMed", "id": "21775604", "url": "https://glygen.org/publication/PubMed/21775604" } ] }, { "title": "Distinct yet overlapping roles of Rab GTPases on synaptic vesicles.", "journal": "Small GTPases", "date": "2011", "authors": "Pavlos NJ, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21776405", "url": "https://glygen.org/publication/PubMed/21776405" } ] }, { "title": "MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Rahajeng J, Giridharan SS, Cai B, Naslavsky N, Caplan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "21951725", "url": "https://glygen.org/publication/PubMed/21951725" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "Insights regarding guanine nucleotide exchange from the structure of a DENN-domain protein complexed with its Rab GTPase substrate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Wu X, Bradley MJ, Cai Y, Kummel D, De La Cruz EM, Barr FA, Reinisch KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22065758", "url": "https://glygen.org/publication/PubMed/22065758" } ] }, { "title": "Connecdenn 3/DENND1C binds actin linking Rab35 activation to the actin cytoskeleton.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Marat AL, Ioannou MS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22072793", "url": "https://glygen.org/publication/PubMed/22072793" } ] }, { "title": "The Rab21-GEF activity of Varp, but not its Rab32/38 effector function, is required for dendrite formation in melanocytes.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Ohbayashi N, Yatsu A, Tamura K, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22171327", "url": "https://glygen.org/publication/PubMed/22171327" } ] }, { "title": "Plk1-dependent phosphorylation of optineurin provides a negative feedback mechanism for mitotic progression.", "journal": "Molecular cell", "date": "2012", "authors": "Kachaner D, Filipe J, Laplantine E, Bauch A, Bennett KL, Superti-Furga G, Israel A, Weil R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22365832", "url": "https://glygen.org/publication/PubMed/22365832" } ] }, { "title": "A Rab8 guanine nucleotide exchange factor-effector interaction network regulates primary ciliogenesis.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Feng S, Knodler A, Ren J, Zhang J, Zhang X, Hong Y, Huang S, Peranen J, Guo W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22433857", "url": "https://glygen.org/publication/PubMed/22433857" } ] }, { "title": "BLOC-2, AP-3, and AP-1 proteins function in concert with Rab38 and Rab32 proteins to mediate protein trafficking to lysosome-related organelles.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Bultema JJ, Ambrosio AL, Burek CL, Di Pietro SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22511774", "url": "https://glygen.org/publication/PubMed/22511774" } ] }, { "title": "Are Rab proteins the link between Golgi organization and membrane trafficking?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2012", "authors": "Liu S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22581368", "url": "https://glygen.org/publication/PubMed/22581368" } ] }, { "title": "Rab14 and its exchange factor FAM116 link endocytic recycling and adherens junction stability in migrating cells.", "journal": "Developmental cell", "date": "2012", "authors": "Linford A, Yoshimura S, Nunes Bastos R, Langemeyer L, Gerondopoulos A, Rigden DJ, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22595670", "url": "https://glygen.org/publication/PubMed/22595670" } ] }, { "title": "Rab5 is necessary for the biogenesis of the endolysosomal system in vivo.", "journal": "Nature", "date": "2012", "authors": "Zeigerer A, Gilleron J, Bogorad RL, Marsico G, Nonaka H, Seifert S, Epstein-Barash H, Kuchimanchi S, Peng CG, Ruda VM, Del Conte-Zerial P, Hengstler JG, Kalaidzidis Y, Koteliansky V, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22622570", "url": "https://glygen.org/publication/PubMed/22622570" } ] }, { "title": "Sbf/MTMR13 coordinates PI(3)P and Rab21 regulation in endocytic control of cellular remodeling.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Jean S, Cox S, Schmidt EJ, Robinson FL, Kiger A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22648168", "url": "https://glygen.org/publication/PubMed/22648168" } ] }, { "title": "The base of the cilium: roles for transition fibres and the transition zone in ciliary formation, maintenance and compartmentalization.", "journal": "EMBO reports", "date": "2012", "authors": "Reiter JF, Blacque OE, Leroux MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22653444", "url": "https://glygen.org/publication/PubMed/22653444" } ] }, { "title": "Structure, regulation and cellular functions of Rab geranylgeranyl transferase and its cellular partner Rab Escort Protein.", "journal": "Molecular membrane biology", "date": "2012", "authors": "Gutkowska M, Swiezewska E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "22694141", "url": "https://glygen.org/publication/PubMed/22694141" } ] }, { "title": "A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery.", "journal": "Developmental cell", "date": "2012", "authors": "Burgo A, Proux-Gillardeaux V, Sotirakis E, Bun P, Casano A, Verraes A, Liem RK, Formstecher E, Coppey-Moisan M, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22705394", "url": "https://glygen.org/publication/PubMed/22705394" } ] }, { "title": "TBC1D13 is a RAB35 specific GAP that plays an important role in GLUT4 trafficking in adipocytes.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Davey JR, Humphrey SJ, Junutula JR, Mishra AK, Lambright DG, James DE, Stockli J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22762500", "url": "https://glygen.org/publication/PubMed/22762500" } ] }, { "title": "Rab10 and myosin-Va mediate insulin-stimulated GLUT4 storage vesicle translocation in adipocytes.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Chen Y, Wang Y, Zhang J, Deng Y, Jiang L, Song E, Wu XS, Hammer JA, Xu T, Lippincott-Schwartz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22908308", "url": "https://glygen.org/publication/PubMed/22908308" } ] }, { "title": "The Arf GAP ASAP1 provides a platform to regulate Arf4- and Rab11-Rab8-mediated ciliary receptor targeting.", "journal": "The EMBO journal", "date": "2012", "authors": "Wang J, Morita Y, Mazelova J, Deretic D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "22983554", "url": "https://glygen.org/publication/PubMed/22983554" } ] }, { "title": "BLOC-3 mutated in Hermansky-Pudlak syndrome is a Rab32/38 guanine nucleotide exchange factor.", "journal": "Current biology : CB", "date": "2012", "authors": "Gerondopoulos A, Langemeyer L, Liang JR, Linford A, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23084991", "url": "https://glygen.org/publication/PubMed/23084991" } ] }, { "title": "Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Pusapati GV, Luchetti G, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23091056", "url": "https://glygen.org/publication/PubMed/23091056" } ] }, { "title": "Endocytosis and autophagy: Shared machinery for degradation.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2013", "authors": "Lamb CA, Dooley HC, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23147242", "url": "https://glygen.org/publication/PubMed/23147242" } ] }, { "title": "RAB3GAP1, RAB3GAP2 and RAB18: disease genes in Micro and Martsolf syndromes.", "journal": "Biochemical Society transactions", "date": "2012", "authors": "Handley MT, Aligianis IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23176487", "url": "https://glygen.org/publication/PubMed/23176487" } ] }, { "title": "Rab proteins of the endoplasmic reticulum: functions and interactors.", "journal": "Biochemical Society transactions", "date": "2012", "authors": "Ortiz Sandoval C, Simmen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23176493", "url": "https://glygen.org/publication/PubMed/23176493" } ] }, { "title": "Maturation of autophagosomes and endosomes: a key role for Rab7.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Hyttinen JM, Niittykoski M, Salminen A, Kaarniranta K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23220125", "url": "https://glygen.org/publication/PubMed/23220125" } ] }, { "title": "Molecular insights into vesicle tethering at the Golgi by the conserved oligomeric Golgi (COG) complex and the golgin TATA element modulatory factor (TMF).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Miller VJ, Sharma P, Kudlyk TA, Frost L, Rofe AP, Watson IJ, Duden R, Lowe M, Lupashin VV, Ungar D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23239882", "url": "https://glygen.org/publication/PubMed/23239882" } ] }, { "title": "Cell type-specific Rab32 and Rab38 cooperate with the ubiquitous lysosome biogenesis machinery to synthesize specialized lysosome-related organelles.", "journal": "Small GTPases", "date": "2013", "authors": "Bultema JJ, Di Pietro SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23247405", "url": "https://glygen.org/publication/PubMed/23247405" } ] }, { "title": "Rab10 GTPase regulates ER dynamics and morphology.", "journal": "Nature cell biology", "date": "2013", "authors": "English AR, Voeltz GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23263280", "url": "https://glygen.org/publication/PubMed/23263280" } ] }, { "title": "The ULK1 complex: sensing nutrient signals for autophagy activation.", "journal": "Autophagy", "date": "2013", "authors": "Wong PM, Puente C, Ganley IG, Jiang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23295650", "url": "https://glygen.org/publication/PubMed/23295650" } ] }, { "title": "Localization of Rab proteins to peroxisomes: a proteomics and immunofluorescence study.", "journal": "FEBS letters", "date": "2013", "authors": "Gronemeyer T, Wiese S, Grinhagens S, Schollenberger L, Satyagraha A, Huber LA, Meyer HE, Warscheid B, Just WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23333653", "url": "https://glygen.org/publication/PubMed/23333653" } ] }, { "title": "Tethering complexes in the endocytic pathway: CORVET and HOPS.", "journal": "The FEBS journal", "date": "2013", "authors": "Solinger JA, Spang A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23351085", "url": "https://glygen.org/publication/PubMed/23351085" } ] }, { "title": "M98K-OPTN induces transferrin receptor degradation and RAB12-mediated autophagic death in retinal ganglion cells.", "journal": "Autophagy", "date": "2013", "authors": "Sirohi K, Chalasani ML, Sudhakar C, Kumari A, Radha V, Swarup G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23357852", "url": "https://glygen.org/publication/PubMed/23357852" } ] }, { "title": "The highly conserved COPII coat complex sorts cargo from the endoplasmic reticulum and targets it to the golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Lord C, Ferro-Novick S, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23378591", "url": "https://glygen.org/publication/PubMed/23378591" } ] }, { "title": "Mutation spectrum in RAB3GAP1, RAB3GAP2, and RAB18 and genotype-phenotype correlations in warburg micro syndrome and Martsolf syndrome.", "journal": "Human mutation", "date": "2013", "authors": "Handley MT, Morris-Rosendahl DJ, Brown S, Macdonald F, Hardy C, Bem D, Carpanini SM, Borck G, Martorell L, Izzi C, Faravelli F, Accorsi P, Pinelli L, Basel-Vanagaite L, Peretz G, Abdel-Salam GM, Zaki MS, Jansen A, Mowat D, Glass I, Stewart H, Mancini G, Lederer D, Roscioli T, Giuliano F, Plomp AS, Rolfs A, Graham JM, Seemanova E, Poo P, Garcia-Cazorla A, Edery P, Jackson IJ, Maher ER, Aligianis IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23420520", "url": "https://glygen.org/publication/PubMed/23420520" } ] }, { "title": "A role for Rab14 in the endocytic trafficking of GLUT4 in 3T3-L1 adipocytes.", "journal": "Journal of cell science", "date": "2013", "authors": "Reed SE, Hodgson LR, Song S, May MT, Kelly EE, McCaffrey MW, Mastick CC, Verkade P, Tavare JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23444368", "url": "https://glygen.org/publication/PubMed/23444368" } ] }, { "title": "Rab12 regulates mTORC1 activity and autophagy through controlling the degradation of amino-acid transporter PAT4.", "journal": "EMBO reports", "date": "2013", "authors": "Matsui T, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23478338", "url": "https://glygen.org/publication/PubMed/23478338" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "CORVET and HOPS tethering complexes - coordinators of endosome and lysosome fusion.", "journal": "Journal of cell science", "date": "2013", "authors": "Balderhaar HJ, Ungermann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23645161", "url": "https://glygen.org/publication/PubMed/23645161" } ] }, { "title": "Rab27 effectors, pleiotropic regulators in secretory pathways.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2013", "authors": "Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23678941", "url": "https://glygen.org/publication/PubMed/23678941" } ] }, { "title": "Dynamic adipocyte phosphoproteome reveals that Akt directly regulates mTORC2.", "journal": "Cell metabolism", "date": "2013", "authors": "Humphrey SJ, Yang G, Yang P, Fazakerley DJ, Stockli J, Yang JY, James DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23684622", "url": "https://glygen.org/publication/PubMed/23684622" } ] }, { "title": "Rab10 delivers GLUT4 storage vesicles to the plasma membrane.", "journal": "Communicative & integrative biology", "date": "2013", "authors": "Chen Y, Lippincott-Schwartz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23713133", "url": "https://glygen.org/publication/PubMed/23713133" } ] }, { "title": "The Golgi puppet master: COG complex at center stage of membrane trafficking interactions.", "journal": "Histochemistry and cell biology", "date": "2013", "authors": "Willett R, Ungar D, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "23839779", "url": "https://glygen.org/publication/PubMed/23839779" } ] }, { "title": "Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Catherman AD, Durbin KR, Ahlf DR, Early BP, Fellers RT, Tran JC, Thomas PM, Kelleher NL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "24023390", "url": "https://glygen.org/publication/PubMed/24023390" } ] }, { "title": "The roles of evolutionarily conserved functional modules in cilia-related trafficking.", "journal": "Nature cell biology", "date": "2013", "authors": "Sung CH, Leroux MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24296415", "url": "https://glygen.org/publication/PubMed/24296415" } ] }, { "title": "Engagement of the small GTPase Rab31 protein and its effector, early endosome antigen 1, is important for trafficking of the ligand-bound epidermal growth factor receptor from the early to the late endosome.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Chua CE, Tang BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24644286", "url": "https://glygen.org/publication/PubMed/24644286" } ] }, { "title": "Rab14 regulation of claudin-2 trafficking modulates epithelial permeability and lumen morphogenesis.", "journal": "Molecular biology of the cell", "date": "2014", "authors": "Lu R, Johnson DL, Stewart L, Waite K, Elliott D, Wilson JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24694596", "url": "https://glygen.org/publication/PubMed/24694596" } ] }, { "title": "Dennd3 functions as a guanine nucleotide exchange factor for small GTPase Rab12 in mouse embryonic fibroblasts.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Matsui T, Noguchi K, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24719330", "url": "https://glygen.org/publication/PubMed/24719330" } ] }, { "title": "Rab18 and a Rab18 GEF complex are required for normal ER structure.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Gerondopoulos A, Bastos RN, Yoshimura S, Anderson R, Carpanini S, Aligianis I, Handley MT, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24891604", "url": "https://glygen.org/publication/PubMed/24891604" } ] }, { "title": "In sickness and in health: the role of TRAPP and associated proteins in disease.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2014", "authors": "Brunet S, Sacher M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24917561", "url": "https://glygen.org/publication/PubMed/24917561" } ] }, { "title": "Bioinformatics analysis reveals disturbance mechanism of MAPK signaling pathway and cell cycle in Glioblastoma multiforme.", "journal": "Gene", "date": "2014", "authors": "Li W, Li K, Zhao L, Zou H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "24967941", "url": "https://glygen.org/publication/PubMed/24967941" } ] }, { "title": "Rab13 acts downstream of the kinase Mst1 to deliver the integrin LFA-1 to the cell surface for lymphocyte trafficking.", "journal": "Science signaling", "date": "2014", "authors": "Nishikimi A, Ishihara S, Ozawa M, Etoh K, Fukuda M, Kinashi T, Katagiri K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "25074980", "url": "https://glygen.org/publication/PubMed/25074980" } ] }, { "title": "Purification, identification, and characterization of two GTP-binding proteins with molecular weights of 25,000 and 21,000 in human platelet cytosol. One is the rap1/smg21/Krev-1 protein and the other is a novel GTP-binding protein.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Nagata K, Itoh H, Katada T, Takenaka K, Ui M, Kaziro Y, Nozawa Y", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "reference": [ { "type": "PubMed", "id": "2507536", "url": "https://glygen.org/publication/PubMed/2507536" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "Membrane tethering.", "journal": "F1000prime reports", "date": "2014", "authors": "Chia PZ, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "25343031", "url": "https://glygen.org/publication/PubMed/25343031" } ] }, { "title": "The role of the small GTPase Rab31 in cancer.", "journal": "Journal of cellular and molecular medicine", "date": "2015", "authors": "Chua CE, Tang BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "25472813", "url": "https://glygen.org/publication/PubMed/25472813" } ] }, { "title": "Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.", "journal": "EMBO reports", "date": "2015", "authors": "Jean S, Cox S, Nassari S, Kiger AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "25648148", "url": "https://glygen.org/publication/PubMed/25648148" } ] }, { "title": "DENND2B activates Rab13 at the leading edge of migrating cells and promotes metastatic behavior.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Ioannou MS, Bell ES, Girard M, Chaineau M, Hamlin JN, Daubaras M, Monast A, Park M, Hodgson L, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "25713415", "url": "https://glygen.org/publication/PubMed/25713415" } ] }, { "title": "Phosphorylation of the exchange factor DENND3 by ULK in response to starvation activates Rab12 and induces autophagy.", "journal": "EMBO reports", "date": "2015", "authors": "Xu J, Fotouhi M, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "25925668", "url": "https://glygen.org/publication/PubMed/25925668" } ] }, { "title": "Phosphorylation-dependent Regulation of Connecdenn/DENND1 Guanine Nucleotide Exchange Factors.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Kulasekaran G, Nossova N, Marat AL, Lund I, Cremer C, Ioannou MS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26055712", "url": "https://glygen.org/publication/PubMed/26055712" } ] }, { "title": "DENND3: a signaling/trafficking interface in autophagy.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Xu J, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26177209", "url": "https://glygen.org/publication/PubMed/26177209" } ] }, { "title": "The Critical Role of Rab31 in Cell Proliferation and Apoptosis in Cancer Progression.", "journal": "Molecular neurobiology", "date": "2016", "authors": "Pan Y, Zhang Y, Chen L, Liu Y, Feng Y, Yan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26245486", "url": "https://glygen.org/publication/PubMed/26245486" } ] }, { "title": "PAT4 levels control amino-acid sensitivity of rapamycin-resistant mTORC1 from the Golgi and affect clinical outcome in colorectal cancer.", "journal": "Oncogene", "date": "2016", "authors": "Fan SJ, Snell C, Turley H, Li JL, McCormick R, Perera SM, Heublein S, Kazi S, Azad A, Wilson C, Harris AL, Goberdhan DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26434594", "url": "https://glygen.org/publication/PubMed/26434594" } ] }, { "title": "A complex of Rab13 with MICAL-L2 and alpha-actinin-4 is essential for insulin-dependent GLUT4 exocytosis.", "journal": "Molecular biology of the cell", "date": "2016", "authors": "Sun Y, Jaldin-Fincati J, Liu Z, Bilan PJ, Klip A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26538022", "url": "https://glygen.org/publication/PubMed/26538022" } ] }, { "title": "Small RAB GTPases Regulate Multiple Steps of Mitosis.", "journal": "Frontiers in cell and developmental biology", "date": "2016", "authors": "Miserey-Lenkei S, Colombo MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26925400", "url": "https://glygen.org/publication/PubMed/26925400" } ] }, { "title": "Rab14 limits the sorting of Glut4 from endosomes into insulin-sensitive regulated secretory compartments in adipocytes.", "journal": "The Biochemical journal", "date": "2016", "authors": "Brewer PD, Habtemichael EN, Romenskaia I, Coster AC, Mastick CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "26936971", "url": "https://glygen.org/publication/PubMed/26936971" } ] }, { "title": "Rab13 Traffics on Vesicles Independent of Prenylation.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Ioannou MS, Girard M, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "26969162", "url": "https://glygen.org/publication/PubMed/26969162" } ] }, { "title": "Rab1 in cell signaling, cancer and other diseases.", "journal": "Oncogene", "date": "2016", "authors": "Yang XZ, Li XX, Zhang YJ, Rodriguez-Rodriguez L, Xiang MQ, Wang HY, Zheng XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "27041585", "url": "https://glygen.org/publication/PubMed/27041585" } ] }, { "title": "Regulation of Cancer Cell Behavior by the Small GTPase Rab13.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Ioannou MS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "27044746", "url": "https://glygen.org/publication/PubMed/27044746" } ] }, { "title": "Multiple Roles of VARP in Endosomal Trafficking: Rabs, Retromer Components and R-SNARE VAMP7 Meet on VARP.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2016", "authors": "Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "27103185", "url": "https://glygen.org/publication/PubMed/27103185" } ] }, { "title": "Multiple Types of Guanine Nucleotide Exchange Factors (GEFs) for Rab Small GTPases.", "journal": "Cell structure and function", "date": "2016", "authors": "Ishida M, E Oguchi M, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "27246931", "url": "https://glygen.org/publication/PubMed/27246931" } ] }, { "title": "Rab35 GTPase: A Central Regulator of Phosphoinositides and F-actin in Endocytic Recycling and Beyond.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2016", "authors": "Klinkert K, Echard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "27329675", "url": "https://glygen.org/publication/PubMed/27329675" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00194", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00194" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "DENN domain-containing protein FAM45A regulates the homeostasis of late/multivesicular endosomes.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2019", "authors": "Zhang J, Zhang K, Qi L, Hu Q, Shen Z, Liu B, Deng J, Zhang C, Zhang Y", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "reference": [ { "type": "PubMed", "id": "30771381", "url": "https://glygen.org/publication/PubMed/30771381" } ] }, { "title": "RAB27A and RAB27B Expression May Predict Lymph Node Metastasis and Survival in Patients With Gastric Cancer.", "journal": "Cancer genomics & proteomics", "date": "2022", "authors": "An HJ, Lee JS, Yang JW, Kim MH, Na JM, Song DH", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" } ], "reference": [ { "type": "PubMed", "id": "35985682", "url": "https://glygen.org/publication/PubMed/35985682" } ] }, { "title": "Rab27b, a Regulator of Exosome Secretion, Is Associated With Peritoneal Metastases in Gastric Cancer.", "journal": "Cancer genomics & proteomics", "date": "2023", "authors": "Nambara Sho, Masuda Takaaki, Hirose Kosuke, Hu Qingjiang, Tobo Taro, Ozato Yuki, Kurashige Junji, Hiraki Yoshiki, Hisamatsu Yuichi, Iguchi Tomohiro, Sugimachi Keishi, Oki Eiji, Yoshizumi Tomoharu, Mimori Koshi", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" } ], "reference": [ { "type": "PubMed", "id": "36581340", "url": "https://glygen.org/publication/PubMed/36581340" } ] }, { "title": "RAB27B Drives a Cancer Stem Cell Phenotype in NSCLC Cells Through Enhanced Extracellular Vesicle Secretion.", "journal": "Cancer research communications", "date": "2023-04", "authors": "Meneses Kayleah M, Pandya Prita, Lindemann Jennifer A, Al-Qasrawi Dania S, Argo Ryan A, Weems Celeste M, Beetler Danielle J, Vijay Geraldine V, Yan Irene K, Wolfram Joy, Patel Tushar, Justilien Verline", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" } ], "reference": [ { "type": "PubMed", "id": "37077938", "url": "https://glygen.org/publication/PubMed/37077938" } ] }, { "title": "RAB27B controls palmitoylation-dependent NRAS trafficking and signaling in myeloid leukemia.", "journal": "The Journal of clinical investigation", "date": "2023-06-15", "authors": "Ren Jian-Gang, Xing Bowen, Lv Kaosheng, O'Keefe Rachel A, Wu Mengfang, Wang Ruoxing, Bauer Kaylyn M, Ghazaryan Arevik, Burslem George M, Zhang Jing, O'Connell Ryan M, Pillai Vinodh, Hexner Elizabeth O, Philips Mark R, Tong Wei", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" } ], "reference": [ { "type": "PubMed", "id": "37317963", "url": "https://glygen.org/publication/PubMed/37317963" } ] }, { "title": "Rab27b promotes endometriosis by enhancing invasiveness of ESCs and promoting angiogenesis.", "journal": "American journal of reproductive immunology (New York, N.Y. : 1989)", "date": "2023-09", "authors": "Shan Jing, Chang Ling-Yu, Li Da-Jin, Wang Xiao-Qiu", "evidence": [ { "database": "RefSeq", "id": "NP_004154", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004154" } ], "reference": [ { "type": "PubMed", "id": "37641372", "url": "https://glygen.org/publication/PubMed/37641372" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Expression and localization of two low molecular weight GTP-binding proteins, Rab8 and Rab10, by epitope tag.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Chen YT, Holcomb C, Moore HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "7688123", "url": "https://glygen.org/publication/PubMed/7688123" } ] }, { "title": "The role of Rab3A in neurotransmitter release.", "journal": "Nature", "date": "1994", "authors": "Geppert M, Bolshakov VY, Siegelbaum SA, Takei K, De Camilli P, Hammer RE, Sudhof TC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "7911226", "url": "https://glygen.org/publication/PubMed/7911226" } ] }, { "title": "Rab escort protein-1 is a multifunctional protein that accompanies newly prenylated rab proteins to their target membranes.", "journal": "The EMBO journal", "date": "1994", "authors": "Alexandrov K, Horiuchi H, Steele-Mortimer O, Seabra MC, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "7957092", "url": "https://glygen.org/publication/PubMed/7957092" } ] }, { "title": "Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A, Rab3A, and Rab5A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Farnsworth CC, Seabra MC, Ericsson LH, Gelb MH, Glomset JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "7991565", "url": "https://glygen.org/publication/PubMed/7991565" } ] }, { "title": "Evidence for the involvement of Rab3A in Ca(2+)-dependent exocytosis from adrenal chromaffin cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Holz RW, Brondyk WH, Senter RA, Kuizon L, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "8144603", "url": "https://glygen.org/publication/PubMed/8144603" } ] }, { "title": "Membrane targeting of the small GTPase Rab9 is accompanied by nucleotide exchange.", "journal": "Nature", "date": "1994", "authors": "Soldati T, Shapiro AD, Svejstrup AB, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8164745", "url": "https://glygen.org/publication/PubMed/8164745" } ] }, { "title": "Rab GDP dissociation inhibitor as a general regulator for the membrane association of rab proteins.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ullrich O, Stenmark H, Alexandrov K, Huber LA, Kaibuchi K, Sasaki T, Takai Y, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8349690", "url": "https://glygen.org/publication/PubMed/8349690" } ] }, { "title": "Isoprenylation of Rab proteins possessing a C-terminal CaaX motif.", "journal": "FEBS letters", "date": "1993", "authors": "Joberty G, Tavitian A, Zahraoui A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8375503", "url": "https://glygen.org/publication/PubMed/8375503" } ] }, { "title": "Rab8, a small GTPase involved in vesicular traffic between the TGN and the basolateral plasma membrane.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Huber LA, Pimplikar S, Parton RG, Virta H, Zerial M, Simons K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "8408203", "url": "https://glygen.org/publication/PubMed/8408203" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "cDNA cloning of component A of Rab geranylgeranyl transferase and demonstration of its role as a Rab escort protein.", "journal": "Cell", "date": "1993", "authors": "Andres DA, Seabra MC, Brown MS, Armstrong SA, Smeland TE, Cremers FP, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8513495", "url": "https://glygen.org/publication/PubMed/8513495" } ] }, { "title": "Rab 7: an important regulator of late endocytic membrane traffic.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Feng Y, Press B, Wandinger-Ness A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "8522602", "url": "https://glygen.org/publication/PubMed/8522602" } ] }, { "title": "Mechanism of digeranylgeranylation of Rab proteins. Formation of a complex between monogeranylgeranyl-Rab and Rab escort protein.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Shen F, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8631982", "url": "https://glygen.org/publication/PubMed/8631982" } ] }, { "title": "Nucleotide dependence of Rab geranylgeranylation. Rab escort protein interacts preferentially with GDP-bound Rab.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8662963", "url": "https://glygen.org/publication/PubMed/8662963" } ] }, { "title": "Prenylation of a Rab1B mutant with altered GTPase activity is impaired in cell-free systems but not in intact mammalian cells.", "journal": "The Biochemical journal", "date": "1996", "authors": "Wilson AL, Sheridan KM, Erdman RA, Maltese WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719" } ], "reference": [ { "type": "PubMed", "id": "8836150", "url": "https://glygen.org/publication/PubMed/8836150" } ] }, { "title": "Molecular cloning of two novel rab genes from human melanocytes.", "journal": "Gene", "date": "1996", "authors": "Chen D, Guo J, Miki T, Tachibana M, Gahl WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "8863739", "url": "https://glygen.org/publication/PubMed/8863739" } ] }, { "title": "Isolation and characterization of a GDP/GTP exchange protein specific for the Rab3 subfamily small G proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wada M, Nakanishi H, Satoh A, Hirano H, Obaishi H, Matsuura Y, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9020086", "url": "https://glygen.org/publication/PubMed/9020086" } ] }, { "title": "Role of the small GTPase Rab7 in the late endocytic pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Vitelli R, Santillo M, Lattero D, Chiariello M, Bifulco M, Bruni CB, Bucci C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9020161", "url": "https://glygen.org/publication/PubMed/9020161" } ] }, { "title": "Isolation and characterization of a GTPase activating protein specific for the Rab3 subfamily of small G proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Fukui K, Sasaki T, Imazumi K, Matsuura Y, Nakanishi H, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9030515", "url": "https://glygen.org/publication/PubMed/9030515" } ] }, { "title": "Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.", "journal": "Biochem. Mol. Med.", "date": "1997", "authors": "Chen D, Guo J, Miki T, Tachibana M, Gahl WA", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "reference": [ { "type": "PubMed", "id": "9066979", "url": "https://glygen.org/publication/PubMed/9066979" } ] }, { "title": "aex-3 encodes a novel regulator of presynaptic activity in C. elegans.", "journal": "Neuron", "date": "1997", "authors": "Iwasaki K, Staunton J, Saifee O, Nonet M, Thomas JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9136770", "url": "https://glygen.org/publication/PubMed/9136770" } ] }, { "title": "A novel Rab5 GDP/GTP exchange factor complexed to Rabaptin-5 links nucleotide exchange to effector recruitment and function.", "journal": "Cell", "date": "1997", "authors": "Horiuchi H, Lippe R, McBride HM, Rubino M, Woodman P, Stenmark H, Rybin V, Wilm M, Ashman K, Mann M, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9323142", "url": "https://glygen.org/publication/PubMed/9323142" } ] }, { "title": "TIP47: a cargo selection device for mannose 6-phosphate receptor trafficking.", "journal": "Cell", "date": "1998", "authors": "Diaz E, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9590177", "url": "https://glygen.org/publication/PubMed/9590177" } ] }, { "title": "Molecular cloning and characterization of the noncatalytic subunit of the Rab3 subfamily-specific GTPase-activating protein.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Nagano F, Sasaki T, Fukui K, Asakura T, Imazumi K, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198" } ], "reference": [ { "type": "PubMed", "id": "9733780", "url": "https://glygen.org/publication/PubMed/9733780" } ] } ], "pathway": [ { "id": "hsa:5874", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5874", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-8873719", "name": "RAB geranylgeranylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8873719", "resource": "Reactome", "description": "RAB geranylgeranylation" }, { "id": "R-HSA-8876198", "name": "RAB GEFs exchange GTP for GDP on RABs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876198", "resource": "Reactome", "description": "RAB GEFs exchange GTP for GDP on RABs" } ], "orthologs": [ { "uniprot_canonical_ac": "Q99P58-1", "protein_name": "Ras-related protein Rab-27B", "gene_name": "Rab27b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC", "length": 218 }, "evidence": [ { "id": "45920214", "url": "http://www.informatics.jax.org/homology/45920214", "database": "MGI" }, { "id": "O00194", "url": "https://omabrowser.org/oma/group/O00194/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q99P74-1", "protein_name": "Ras-related protein Rab-27B", "gene_name": "Rab27b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLLDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGVNSGKVDGEKPAEKKCAC", "length": 218 }, "evidence": [ { "id": "45920214", "url": "http://www.informatics.jax.org/homology/45920214", "database": "MGI" }, { "id": "O00194", "url": "https://omabrowser.org/oma/group/O00194/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "myosin V binding", "id": "GO:0031489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031489", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "G protein activity", "id": "GO:0003925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003925", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "multivesicular body sorting pathway", "id": "GO:0071985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071985", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "anterograde axonal protein transport", "id": "GO:0099641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099641", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "exocytosis", "id": "GO:0006887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006887", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "positive regulation of exocytosis", "id": "GO:0045921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045921", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "synaptic vesicle endocytosis", "id": "GO:0048488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048488", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 15, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "secretory granule", "id": "GO:0030141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030141", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "synaptic vesicle membrane", "id": "GO:0030672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030672", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "Golgi stack", "id": "GO:0005795", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005795", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "axon cytoplasm", "id": "GO:1904115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904115", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "exocytic vesicle", "id": "GO:0070382", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070382", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "trans-Golgi network transport vesicle", "id": "GO:0030140", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030140", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "multivesicular body membrane", "id": "GO:0032585", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032585", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "platelet dense granule membrane", "id": "GO:0031088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031088", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" }, { "name": "zymogen granule membrane", "id": "GO:0042589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042589", "evidence": [ { "database": "UniProtKB", "id": "O00194", "url": "https://www.uniprot.org/uniprot/O00194" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19669", "name": "", "equation": "GTP + H2O = GDP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q08877-1", "Q6AYC2-1", "Q2TA68-1", "P61589-1", "Q6RUV5-1", "P23640-1", "O35303-1", "P21575-1", "P39052-1", "Q6AYF9-1", "Q8CFN2-1", "Q63663-1", "M0RC99-1", "Q99P74-1", "B2GUV7-1", "Q8R4Z9-1", "Q8R500-1", "D3ZQL7-1", "P97538-1", "Q6IMA3-1", "Q5BJQ5-1", "Q62636-1", "Q63486-1", "Q63487-1", "P61227-1", "P62836-1", "P63322-1", "Q04970-1", "P08644-1", "D3Z8L7-1", "P35281-1", "P36860-1", "Q6IMA7-1", "C9WPN6-1", "P20171-1", "P81795-1", "Q6AYZ1-1", "Q6AY56-1", "Q99MB4-1", "Q5XIF6-1", "P84079-1", "P68370-1", "Q68FR8-1", "Q6P9V9-1", "P51146-1", "O35509-1", "P62494-1", "Q6NYB7-1", "Q66HA6-1", "P09527-1", "P10536-1", "P05714-1", "Q8K586-1", "P62828-1", "P62332-1", "P35280-1", "P05712-1", "Q6AYB5-1", "Q6AXM7-1", "P05197-1", "P62630-1", "D3ZM99-1", "D3ZLK2-1", "Q5BJP6-1", "F1M2G3-1", "A0A8I5ZU96-1", "A0A8I6AHV4-1", "Q62639-1", "P97687-1", "P60953-2", "Q9UQ16-1", "P55039-1", "Q9Y295-1", "O00429-1", "Q05193-1", "P50570-1", "Q6NXR0-1", "Q96PP8-1", "P32455-1", "Q9H0R5-1", "Q96PP9-1", "P32456-1", "Q8N442-1", "O60841-1", "Q8IWA4-1", "O95140-1", "O60313-1", "Q8IVH4-1", "Q5S007-1", "O00194-1", "P51159-1", "P63000-1", "P20339-1", "P61586-1", "O94811-1", "P61018-1", "Q9H0U4-1", "P51148-1", "P51149-1", "Q9Y227-1", "P62820-1", "Q9NQZ7-1", "P20338-1", "P62491-1", "Q15907-1", "Q92928-1", "P61020-1", "Q9NVJ2-1", "A6NIZ1-1", "P61224-1", "A1A4Y4-1", "P61011-1", "P62834-1", "P11234-1", "Q2VIR3-1", "P41091-1", "P01112-1", "P61225-1", "Q9Y3L5-1", "Q96S79-1", "Q9NQL2-1", "Q9HB90-1", "Q9H628-1", "O14807-1", "P01116-1", "P60763-1", "P11233-1", "P01111-1", "Q99578-1", "Q96A58-1", "Q92737-1", "Q9BPW5-1", "Q7Z444-1", "P10114-1", "Q5VZM2-1", "P10301-1", "P62070-1", "Q6T310-1", "P61026-1", "Q92963-1", "Q7L523-1", "Q9NYN1-1", "P62826-1", "P62330-1", "Q8N8V2-1", "Q9NRW1-1", "Q6ZN66-1", "Q8WUD1-1", "P61006-1", "P61019-1", "Q9BSD7-1", "Q9NY65-1", "Q9H853-1", "P68366-1", "Q4V339-1", "Q8IUF1-1", "Q71U36-1", "Q9BQE3-1", "P68363-1", "Q5RIA9-1", "Q9BRT8-1", "A6NHL2-1", "Q5JTY5-1", "P84077-1", "Q6PEY2-1", "P13639-1", "P15170-1", "P0DPH7-1", "P0DPH8-1", "Q969S9-1", "Q15382-1", "P49961-1", "Q8IYD1-1", "P68104-1", "P61221-1", "Q9Y450-1", "P61021-1", "Q62293-1", "Q61107-1", "P60766-2", "Q8BZ98-1", "Q8CFB4-1", "P32233-1", "Q9QXB9-1", "Q01514-1", "Q8K1M6-1", "P39053-1", "P39054-1", "Q8C262-1", "Q5S006-1", "Q8C3X4-1", "Q9Z0E6-1", "Q9QZ85-1", "Q05D44-1", "P58281-1", "Q8C7H1-1", "Q80U63-1", "Q811U4-1", "Q99P58-1", "Q9QUI0-1", "Q9ERI2-1", "P63001-1", "Q3T9E4-1", "Q7TQD2-1", "Q9CQD1-1", "Q9CQW2-1", "P56371-1", "P62821-1", "P62492-1", "Q91ZR1-1", "P35278-1", "P46638-1", "P51150-1", "Q3TCT4-1", "Q9D1G1-1", "P61226-1", "P61027-1", "P62071-1", "Q99JI6-1", "Q8R367-1", "Q922H7-1", "Q8BU31-1", "Q80ZJ1-1", "Q80X95-1", "O08989-1", "P70426-1", "Q8K5A4-1", "P10833-1", "P70425-1", "Q61411-1", "Q5SSG5-1", "Q7TT45-1", "Q6NTA4-1", "Q99K70-1", "Q9JIW9-1", "Q08AT1-1", "P60764-1", "P62835-1", "P63321-1", "Q6IMB1-1", "P32883-1", "Q9Z0N2-1", "Q9Z0N1-1", "P08556-1", "Q7TN89-1", "A4UUI3-1", "Q8VEH6-1", "A0A0G2JDV3-1", "P68368-1", "Q91Z40-1", "Q60766-1", "A0A140LIF8-1", "Q9DCE9-1", "Q3UX10-1", "Q9JJZ2-1", "Q0GUM3-1", "E9PXC0-1", "P62331-1", "Q9CQA9-1", "P53994-1", "P59279-1", "P62827-1", "P68369-1", "P55258-1", "P61294-1", "Q61820-1", "P05214-1", "P84078-1", "Q69ZS7-1", "P05213-1", "P68373-1", "Q149F3-1", "Q8R050-1", "P14576-1", "Q921J2-1", "P55772-1", "Q8R2Q4-1", "B2RVE2-1", "P10126-1", "P61222-1", "P58252-1", "P13856-1", "P20606-1", "P01119-1", "P01120-1", "P05453-1", "P06780-1", "P06781-1", "P09733-1", "P09734-1", "P11076-1", "P19073-1", "P32324-1", "P32481-1", "P32769-1", "P53893-1", "P54861-1", "Q00246-1", "P39730-1", "P46943-1", "P38297-1", "P53729-1", "P20424-1", "P53290-1", "Q00582-1", "Q54Y30-1", "Q54XP6-1", "Q54XD8-1", "Q55CA9-1", "Q55CB0-1", "Q55CB7-1", "Q55CB8-1", "Q55CB9-1", "Q55CC0-1", "Q75K18-1", "Q869Q0-1", "Q86L51-1", "B0G189-1", "O00909-1", "P03967-1", "P0CT31-1", "P15064-1", "P15112-1", "P18613-1", "P32252-1", "P32253-1", "P32254-1", "P32255-1", "P36409-1", "P36411-1", "Q54MH8-1", "Q55AX0-1", "Q55BW0-1", "Q55F94-1", "P08645-1", "P08646-1", "P40793-1", "Q24208-1", "P04388-1", "P27619-1", "Q7YU24-1", "P48555-1", "Q9VRH6-1", "A1Z9N0-1", "O18412-1", "P06604-1", "P06606-1", "P61209-1", "P06603-1", "P06605-1", "Q9W074-1", "O18333-1", "Q9V3I2-1", "Q9VRY2-1", "O76742-1", "P13060-1", "Q9VM20-1" ], "evidence": [ { "id": "19669", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19669" } ] }, { "id": "R-HSA-481010", "name": "Surface deployment of platelet dense granule membrane components", "equation": "", "summary": "Constituents of the platelet dense granule membrane are incorporated into the platelet membrane following exocytosis of granule content.", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00194-1" ], "evidence": [ { "id": "R-HSA-481010", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-481010" } ] }, { "id": "R-HSA-8870466", "name": "RGGT:CHM binds RABs", "equation": "", "summary": "CHM and CHML are the substrate-binding subunits of the RAB geranylgeranyltransferase (GGTase) complex. CHMs, also known as RAB escort proteins (REPs) bind to unprenylated RAB proteins in the GDP bound state (Seabra, 1996). In the classical model of RAB recruitment, CHM proteins first bind the unprenylated RAB alone and then present it to the catalytic dimer of the RAB GGTase, while in the alternative model, depicted here, RAB recruitment occurs after the GGPP-dependent formation of a highly stable trimeric GGTase complex (Andres et al, 1993; Thoma et al, 2001a; Thoma et al 2001b; Baron and Seabra, 2008). After geranylgeranylation, binding of additional GGPP to the GGTase promotes release of the CHM:RAB complex, possibly through an allosteric mechanism (Baron and Seabra, 2008). CHM proteins remain in complex with the RABs after geranylgeranylation, dissociating after the RAB has been transferred to the target membrane (Alexandrov et al, 1994; Shen and Seabra, 1996; Baron and Seabra, 2008).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00194-1", "P62491-1", "P51148-1", "P61019-1", "P51159-1", "Q92696-1", "P20339-1", "Q9NRW1-1", "P53611-1", "P20338-1", "P61018-1", "P62820-1", "Q15907-1", "P61020-1", "Q8WUD1-1", "P61006-1", "P61026-1", "Q9H0U4-1", "P51149-1" ], "evidence": [ { "id": "R-HSA-8870466", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8870466" } ] }, { "id": "R-HSA-8870469", "name": "RGGT geranylgeranylates RAB proteins", "equation": "", "summary": "RAB geranylgeranyltransferase (GGTase) recognizes and geranylgeranylates cysteine residues in -CXCX, -CCXX or -XXCC motifs in the C-termini of RAB proteins. Most RAB proteins are doubly geranylgeranylated, most likely in a sequential fashion, but some are only singly modified (Baron and Seabra, 2008; Farnsworth et al 1994; Wilson et al, 1996; Overmeyer et al, 2000; Khosravi-Far et al, 1991; Joberty et al, 1993; Catherman et al, 2013; Leung et al, 2007; Maurer-Stroh et al, 2007). In most cases, geranylgeranylation is required for proper localization and function of the RAB proteins. After geranylgeranylation, RABs remain associated with the RAB escort protein CHM or CHML, which dissociates when the GTPase reaches its target membrane (Alexandrov et al, 1994; Seabra et al, 1996; Shen and Seabra, 1996). Release of the geranylgeranyl RAB:CHM complex from the catalytic subunits is promoted by the binding of additional GGPP to the enzyme (Baron and Seabra, 2008). Once prenylated, RABs cycle between active GTP bound forms that are membrane associated, and inactive GDP bound forms that are cytosolic and associated with RAB GDP dissociation inhibitor (GDI) proteins. Conversion between these states is governed by the activities of guanine nucleotide exchange factors (GEFs), which promote the exchange of GDP for GTP, and GTPase activating proteins (GAPs), which stimulate the intrinsic GTPase activity of RABs (Ullrich et al, 1993; Soldati et al, 1994; reviewed in Wandinger-Ness and Zerial, 2014; Stenmark, 2009).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-1131164" ], "output_participant_list": [], "enzyme_list": [ "O00194-1", "P62491-1", "P51148-1", "P61019-1", "P51159-1", "Q92696-1", "P20339-1", "Q9NRW1-1", "P53611-1", "P20338-1", "P61018-1", "P62820-1", "Q15907-1", "P61020-1", "Q8WUD1-1", "P61006-1", "P61026-1", "Q9H0U4-1", "P51149-1" ], "evidence": [ { "id": "R-HSA-8870469", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8870469" } ] }, { "id": "R-HSA-8877308", "name": "MADD exchanges GTP for GDP on RAB27", "equation": "", "summary": "Vertebrate RAB27 exists in two isoforms, RAB27A and RAB27B, with overlapping but distinct functions in trafficking to melanosomes, secretory granules and platelets (Kondo et al, 2006; Figueiredo et al, 2008; Tarafder et al, 2011; reviewed in Fukuda et al, 2013). Studies in nematodes and vertebrates have identified MADD as a RAB27 GEF required for its activity (Mahoney et al, 2006; Tarafder et al, 2011; Yoshimura et al, 2010). Interaction of RAB27:GDP with its GEFs promotes release of GDP, allowing GTP to bind, and precludes the interaction of RAB27 with GDI and CHM proteins.", "cellular_location": "cytosol, melanosome membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00194-1", "P51159-1" ], "evidence": [ { "id": "R-HSA-8877308", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877308" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1131164", "participant_name": "geranylgeranyl diphosphate [cytosol]", "crossref": [ { "id": "48861", "database": "ChEBI", "url": "" }, { "id": "HMDB0004486", "database": "HMDB Metabolite", "url": "" }, { "id": "3052", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00353", "database": "COMPOUND", "url": "" }, { "id": "000012495043", "database": "ZINC", "url": "" }, { "id": "HMDB0004486", "database": "HMDB Metabolite", "url": "" }, { "id": "C00353", "database": "COMPOUND", "url": "" }, { "id": "48861", "database": "ChEBI", "url": "" }, { "id": "000012495043", "database": "ZINC", "url": "" }, { "id": "3052", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0004486", "database": "HMDB Metabolite", "url": "" }, { "id": "C00353", "database": "COMPOUND", "url": "" }, { "id": "000012495043", "database": "ZINC", "url": "" }, { "id": "3052", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "48861", "database": "ChEBI", "url": "" }, { "id": "48861", "database": "ChEBI", "url": "" }, { "id": "HMDB0004486", "database": "HMDB Metabolite", "url": "" }, { "id": "3052", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00353", "database": "COMPOUND", "url": "" }, { "id": "000012495043", "database": "ZINC", "url": "" }, { "id": "000012495043", "database": "ZINC", "url": "" }, { "id": "3052", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "48861", "database": "ChEBI", "url": "" }, { "id": "HMDB0004486", "database": "HMDB Metabolite", "url": "" }, { "id": "C00353", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004486", "database": "HMDB Metabolite", "url": "" }, { "id": "C00353", "database": "COMPOUND", "url": "" }, { "id": "48861", "database": "ChEBI", "url": "" }, { "id": "000012495043", "database": "ZINC", "url": "" }, { "id": "3052", "database": "Guide to Pharmacology - Ligands", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JDV3", "gene_name": "Gbp6", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A0A0G2JDV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV3" } ] } ] }, { "uniprot_ac": "A0A140LIF8", "gene_name": "Irgm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A0A140LIF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A140LIF8" } ] } ] }, { "uniprot_ac": "A0A8I5ZU96", "gene_name": "ENSRNOG00000063798", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A0A8I5ZU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZU96" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A0A8I5ZU96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZU96" } ] } ] }, { "uniprot_ac": "A0A8I6AHV4", "gene_name": "LOC367858", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A0A8I6AHV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AHV4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A0A8I6AHV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AHV4" } ] } ] }, { "uniprot_ac": "A1A4Y4", "gene_name": "IRGM", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A1A4Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1A4Y4" } ] } ] }, { "uniprot_ac": "A1Z9N0", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A1Z9N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9N0" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "A1Z9N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9N0" } ] } ] }, { "uniprot_ac": "A4UUI3", "gene_name": "Gbp4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A4UUI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ] } ] }, { "uniprot_ac": "A6NHL2", "gene_name": "TUBAL3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "A6NHL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NHL2" } ] } ] }, { "uniprot_ac": "A6NIZ1", "gene_name": "RAP1BL", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "A6NIZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NIZ1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "A6NIZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NIZ1" } ] } ] }, { "uniprot_ac": "B0G189", "gene_name": "guf1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "B0G189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G189" } ] } ] }, { "uniprot_ac": "B2GUV7", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "B2GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUV7" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "B2GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUV7" } ] } ] }, { "uniprot_ac": "B2RVE2", "gene_name": "Rergl", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "B2RVE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RVE2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "B2RVE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RVE2" } ] } ] }, { "uniprot_ac": "C9WPN6", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "C9WPN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9WPN6" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "C9WPN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9WPN6" } ] } ] }, { "uniprot_ac": "D3Z8L7", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "D3Z8L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8L7" } ] } ] }, { "uniprot_ac": "D3ZLK2", "gene_name": "Rasl12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "D3ZLK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLK2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "D3ZLK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLK2" } ] } ] }, { "uniprot_ac": "D3ZM99", "gene_name": "Rergl", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "D3ZM99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZM99" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "D3ZM99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZM99" } ] } ] }, { "uniprot_ac": "D3ZQL7", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "D3ZQL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQL7" } ] } ] }, { "uniprot_ac": "E9PXC0", "gene_name": "Srp54c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "E9PXC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PXC0" } ] } ] }, { "uniprot_ac": "F1M2G3", "gene_name": "Rerg", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "F1M2G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M2G3" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "F1M2G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M2G3" } ] } ] }, { "uniprot_ac": "M0RC99", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "M0RC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RC99" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "M0RC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RC99" } ] } ] }, { "uniprot_ac": "O00194", "gene_name": "RAB27B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O00194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00194" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O00194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00194" } ] } ] }, { "uniprot_ac": "O00429", "gene_name": "DNM1L", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O00429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00429" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O00429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00429" } ] } ] }, { "uniprot_ac": "O00909", "gene_name": "arfA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O00909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00909" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O00909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00909" } ] } ] }, { "uniprot_ac": "O08989", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] } ] }, { "uniprot_ac": "O14807", "gene_name": "MRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O14807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14807" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O14807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14807" } ] } ] }, { "uniprot_ac": "O18333", "gene_name": "Rab2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O18333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18333" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O18333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18333" } ] } ] }, { "uniprot_ac": "O18412", "gene_name": "fzo", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O18412", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18412" } ] } ] }, { "uniprot_ac": "O35303", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O35303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35303" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O35303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35303" } ] } ] }, { "uniprot_ac": "O35509", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O35509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35509" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O35509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35509" } ] } ] }, { "uniprot_ac": "O60313", "gene_name": "OPA1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O60313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60313" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O60313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60313" } ] } ] }, { "uniprot_ac": "O60841", "gene_name": "EIF5B", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O60841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60841" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "O60841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60841" } ] } ] }, { "uniprot_ac": "O76742", "gene_name": "Rab7", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "O76742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76742" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O76742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76742" } ] } ] }, { "uniprot_ac": "O94811", "gene_name": "TPPP", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O94811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94811" } ] } ] }, { "uniprot_ac": "O95140", "gene_name": "MFN2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O95140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95140" } ] } ] }, { "uniprot_ac": "P01111", "gene_name": "NRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] } ] }, { "uniprot_ac": "P01112", "gene_name": "HRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] } ] }, { "uniprot_ac": "P01116", "gene_name": "KRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01116" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01116" } ] } ] }, { "uniprot_ac": "P01119", "gene_name": "RAS1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01119", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01119" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01119", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01119" } ] } ] }, { "uniprot_ac": "P01120", "gene_name": "RAS2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01120" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01120" } ] } ] }, { "uniprot_ac": "P03967", "gene_name": "rasD", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P03967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03967" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P03967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03967" } ] } ] }, { "uniprot_ac": "P04388", "gene_name": "Ras64B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P04388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04388" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P04388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04388" } ] } ] }, { "uniprot_ac": "P05197", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05197" } ] } ] }, { "uniprot_ac": "P05213", "gene_name": "Tuba1b", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05213", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05213" } ] } ] }, { "uniprot_ac": "P05214", "gene_name": "Tuba3a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05214" } ] } ] }, { "uniprot_ac": "P05453", "gene_name": "SUP35", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05453" } ] } ] }, { "uniprot_ac": "P05712", "gene_name": "Rab2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P05712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05712" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P05712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05712" } ] } ] }, { "uniprot_ac": "P05714", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P05714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05714" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P05714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05714" } ] } ] }, { "uniprot_ac": "P06603", "gene_name": "alphaTub84B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06603" } ] } ] }, { "uniprot_ac": "P06604", "gene_name": "alphaTub85E", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06604" } ] } ] }, { "uniprot_ac": "P06605", "gene_name": "alphaTub84D", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06605" } ] } ] }, { "uniprot_ac": "P06606", "gene_name": "alphaTub67C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P06606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06606" } ] } ] }, { "uniprot_ac": "P06780", "gene_name": "RHO1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P06780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06780" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P06780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06780" } ] } ] }, { "uniprot_ac": "P06781", "gene_name": "RHO2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P06781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06781" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P06781", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06781" } ] } ] }, { "uniprot_ac": "P08556", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] } ] }, { "uniprot_ac": "P08644", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08644" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08644" } ] } ] }, { "uniprot_ac": "P08645", "gene_name": "Rap1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08645" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08645" } ] } ] }, { "uniprot_ac": "P08646", "gene_name": "Ras85D", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P08646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08646" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08646" } ] } ] }, { "uniprot_ac": "P09527", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P09527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09527" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P09527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09527" } ] } ] }, { "uniprot_ac": "P09733", "gene_name": "TUB1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P09733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09733" } ] } ] }, { "uniprot_ac": "P09734", "gene_name": "TUB3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P09734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09734" } ] } ] }, { "uniprot_ac": "P0CT31", "gene_name": "eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0CT31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CT31" } ] } ] }, { "uniprot_ac": "P0DPH7", "gene_name": "TUBA3C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0DPH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPH7" } ] } ] }, { "uniprot_ac": "P0DPH8", "gene_name": "TUBA3D", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P0DPH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPH8" } ] } ] }, { "uniprot_ac": "P10114", "gene_name": "RAP2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P10114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10114" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P10114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10114" } ] } ] }, { "uniprot_ac": "P10126", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10126" } ] } ] }, { "uniprot_ac": "P10301", "gene_name": "RRAS", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10301", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10301" } ] } ] }, { "uniprot_ac": "P10536", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P10536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10536" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P10536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10536" } ] } ] }, { "uniprot_ac": "P10833", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10833" } ] } ] }, { "uniprot_ac": "P11076", "gene_name": "ARF1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P11076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11076" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11076" } ] } ] }, { "uniprot_ac": "P11233", "gene_name": "RALA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P11233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11233" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11233" } ] } ] }, { "uniprot_ac": "P11234", "gene_name": "RALB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P11234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11234" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11234" } ] } ] }, { "uniprot_ac": "P13060", "gene_name": "eEF2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P13060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13060" } ] } ] }, { "uniprot_ac": "P13639", "gene_name": "EEF2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P13639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13639" } ] } ] }, { "uniprot_ac": "P13856", "gene_name": "RSR1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P13856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13856" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P13856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13856" } ] } ] }, { "uniprot_ac": "P14576", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] } ] }, { "uniprot_ac": "P15064", "gene_name": "rasG", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P15064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15064" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P15064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15064" } ] } ] }, { "uniprot_ac": "P15112", "gene_name": "efbA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P15112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15112" } ] } ] }, { "uniprot_ac": "P15170", "gene_name": "GSPT1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P15170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15170" } ] } ] }, { "uniprot_ac": "P18613", "gene_name": "rapA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P18613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18613" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P18613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18613" } ] } ] }, { "uniprot_ac": "P19073", "gene_name": "CDC42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P19073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19073" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P19073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19073" } ] } ] }, { "uniprot_ac": "P20171", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20171" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20171" } ] } ] }, { "uniprot_ac": "P20338", "gene_name": "RAB4A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20338" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20338" } ] } ] }, { "uniprot_ac": "P20339", "gene_name": "RAB5A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20339" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20339" } ] } ] }, { "uniprot_ac": "P20424", "gene_name": "SRP54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P20424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20424" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P20424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20424" } ] } ] }, { "uniprot_ac": "P20606", "gene_name": "SAR1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P20606", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20606" } ] } ] }, { "uniprot_ac": "P21575", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P21575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21575" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P21575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21575" } ] } ] }, { "uniprot_ac": "P23640", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P23640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23640" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P23640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23640" } ] } ] }, { "uniprot_ac": "P27619", "gene_name": "shi", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P27619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27619" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P27619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27619" } ] } ] }, { "uniprot_ac": "P32233", "gene_name": "Drg1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32233" } ] } ] }, { "uniprot_ac": "P32252", "gene_name": "rasB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32252" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32252" } ] } ] }, { "uniprot_ac": "P32253", "gene_name": "rasC", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32253" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32253" } ] } ] }, { "uniprot_ac": "P32254", "gene_name": "rasS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32254" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32254" } ] } ] }, { "uniprot_ac": "P32255", "gene_name": "tubA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32255" } ] } ] }, { "uniprot_ac": "P32324", "gene_name": "EFT1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32324" } ] } ] }, { "uniprot_ac": "P32455", "gene_name": "GBP1", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] } ] }, { "uniprot_ac": "P32456", "gene_name": "GBP2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32456" } ] } ] }, { "uniprot_ac": "P32481", "gene_name": "GCD11", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32481" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P32481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32481" } ] } ] }, { "uniprot_ac": "P32769", "gene_name": "HBS1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32769" } ] } ] }, { "uniprot_ac": "P32883", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] } ] }, { "uniprot_ac": "P35278", "gene_name": "Rab5c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] } ] }, { "uniprot_ac": "P35280", "gene_name": "Rab8a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35280" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35280" } ] } ] }, { "uniprot_ac": "P35281", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P35281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35281" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35281" } ] } ] }, { "uniprot_ac": "P36409", "gene_name": "rab2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36409" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36409" } ] } ] }, { "uniprot_ac": "P36411", "gene_name": "rab7A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36411" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36411" } ] } ] }, { "uniprot_ac": "P36860", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P36860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36860" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36860" } ] } ] }, { "uniprot_ac": "P38297", "gene_name": "FZO1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P38297", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38297" } ] } ] }, { "uniprot_ac": "P39052", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39052" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39052" } ] } ] }, { "uniprot_ac": "P39053", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] } ] }, { "uniprot_ac": "P39054", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] } ] }, { "uniprot_ac": "P39730", "gene_name": "FUN12", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P39730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39730" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P39730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39730" } ] } ] }, { "uniprot_ac": "P40793", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P40793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40793" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P40793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40793" } ] } ] }, { "uniprot_ac": "P41091", "gene_name": "EIF2S3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] } ] }, { "uniprot_ac": "P46638", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] } ] }, { "uniprot_ac": "P46943", "gene_name": "GUF1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P46943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46943" } ] } ] }, { "uniprot_ac": "P48555", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P48555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48555" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P48555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48555" } ] } ] }, { "uniprot_ac": "P49961", "gene_name": "ENTPD1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P49961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49961" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P49961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49961" } ] } ] }, { "uniprot_ac": "P50570", "gene_name": "DNM2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] } ] }, { "uniprot_ac": "P51146", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51146" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51146" } ] } ] }, { "uniprot_ac": "P51148", "gene_name": "RAB5C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] } ] }, { "uniprot_ac": "P51149", "gene_name": "RAB7A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51149" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51149" } ] } ] }, { "uniprot_ac": "P51150", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] } ] }, { "uniprot_ac": "P51159", "gene_name": "RAB27A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] } ] }, { "uniprot_ac": "P53290", "gene_name": "GTR2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P53290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53290" } ] } ] }, { "uniprot_ac": "P53611", "gene_name": "RABGGTB", "activity": [ { "ec_number": "2.5.1.60", "activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].", "evidence": [ { "id": "P53611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53611" } ] }, { "ec_number": "2.5.1.60", "activity": "", "evidence": [ { "id": "P53611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53611" } ] } ] }, { "uniprot_ac": "P53729", "gene_name": "ZNG1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P53729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53729" } ] } ] }, { "uniprot_ac": "P53893", "gene_name": "RIA1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P53893", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53893" } ] } ] }, { "uniprot_ac": "P53994", "gene_name": "Rab2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P53994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53994" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P53994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53994" } ] } ] }, { "uniprot_ac": "P54861", "gene_name": "DNM1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P54861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54861" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P54861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54861" } ] } ] }, { "uniprot_ac": "P55039", "gene_name": "DRG2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P55039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55039" } ] } ] }, { "uniprot_ac": "P55258", "gene_name": "Rab8a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P55258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55258" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P55258", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55258" } ] } ] }, { "uniprot_ac": "P55772", "gene_name": "Entpd1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P55772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55772" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P55772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55772" } ] } ] }, { "uniprot_ac": "P56371", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] } ] }, { "uniprot_ac": "P58252", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P58252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58252" } ] } ] }, { "uniprot_ac": "P58281", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] } ] }, { "uniprot_ac": "P59279", "gene_name": "Rab2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P59279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59279" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P59279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59279" } ] } ] }, { "uniprot_ac": "P60763", "gene_name": "RAC3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60763" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60763" } ] } ] }, { "uniprot_ac": "P60764", "gene_name": "Rac3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] } ] }, { "uniprot_ac": "P60766", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] } ] }, { "uniprot_ac": "P60953", "gene_name": "CDC42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P60953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60953" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60953" } ] } ] }, { "uniprot_ac": "P61006", "gene_name": "RAB8A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61006" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61006" } ] } ] }, { "uniprot_ac": "P61011", "gene_name": "SRP54", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] }, { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] } ] }, { "uniprot_ac": "P61018", "gene_name": "RAB4B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61018" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61018" } ] } ] }, { "uniprot_ac": "P61019", "gene_name": "RAB2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61019" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61019" } ] } ] }, { "uniprot_ac": "P61020", "gene_name": "RAB5B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61020" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61020" } ] } ] }, { "uniprot_ac": "P61021", "gene_name": "Rab5b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] } ] }, { "uniprot_ac": "P61026", "gene_name": "RAB10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61026" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61026" } ] } ] }, { "uniprot_ac": "P61027", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] } ] }, { "uniprot_ac": "P61209", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61209" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61209" } ] } ] }, { "uniprot_ac": "P61221", "gene_name": "ABCE1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61221", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61221" } ] } ] }, { "uniprot_ac": "P61222", "gene_name": "Abce1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61222" } ] } ] }, { "uniprot_ac": "P61224", "gene_name": "RAP1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] } ] }, { "uniprot_ac": "P61225", "gene_name": "RAP2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P61227", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] } ] }, { "uniprot_ac": "P61294", "gene_name": "Rab6b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61294", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61294" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61294", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61294" } ] } ] }, { "uniprot_ac": "P61586", "gene_name": "RHOA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61586" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61586" } ] } ] }, { "uniprot_ac": "P61589", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61589" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61589" } ] } ] }, { "uniprot_ac": "P62070", "gene_name": "RRAS2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62070" } ] } ] }, { "uniprot_ac": "P62071", "gene_name": "Rras2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62071" } ] } ] }, { "uniprot_ac": "P62330", "gene_name": "ARF6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62330" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62330" } ] } ] }, { "uniprot_ac": "P62331", "gene_name": "Arf6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62331" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62331" } ] } ] }, { "uniprot_ac": "P62332", "gene_name": "Arf6", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62332" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62332" } ] } ] }, { "uniprot_ac": "P62491", "gene_name": "RAB11A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62491" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62491" } ] } ] }, { "uniprot_ac": "P62492", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] } ] }, { "uniprot_ac": "P62494", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62494" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62494" } ] } ] }, { "uniprot_ac": "P62630", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62630" } ] } ] }, { "uniprot_ac": "P62820", "gene_name": "RAB1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62820" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62820" } ] } ] }, { "uniprot_ac": "P62821", "gene_name": "Rab1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] } ] }, { "uniprot_ac": "P62826", "gene_name": "RAN", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62826", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62826" } ] } ] }, { "uniprot_ac": "P62827", "gene_name": "Ran", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62827" } ] } ] }, { "uniprot_ac": "P62828", "gene_name": "Ran", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62828" } ] } ] }, { "uniprot_ac": "P62834", "gene_name": "RAP1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P62836", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] } ] }, { "uniprot_ac": "P63000", "gene_name": "RAC1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63000" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63000" } ] } ] }, { "uniprot_ac": "P63001", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] } ] }, { "uniprot_ac": "P63321", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] } ] }, { "uniprot_ac": "P63322", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P63322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63322" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63322" } ] } ] }, { "uniprot_ac": "P68104", "gene_name": "EEF1A1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68104" } ] } ] }, { "uniprot_ac": "P68363", "gene_name": "TUBA1B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68363", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68363" } ] } ] }, { "uniprot_ac": "P68366", "gene_name": "TUBA4A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68366", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68366" } ] } ] }, { "uniprot_ac": "P68368", "gene_name": "Tuba4a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68368" } ] } ] }, { "uniprot_ac": "P68369", "gene_name": "Tuba1a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68369" } ] } ] }, { "uniprot_ac": "P68370", "gene_name": "Tuba1a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68370" } ] } ] }, { "uniprot_ac": "P68373", "gene_name": "Tuba1c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68373" } ] } ] }, { "uniprot_ac": "P70425", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] } ] }, { "uniprot_ac": "P70426", "gene_name": "Rit1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] } ] }, { "uniprot_ac": "P81795", "gene_name": "Eif2s3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P81795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81795" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P81795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81795" } ] } ] }, { "uniprot_ac": "P84077", "gene_name": "ARF1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] } ] }, { "uniprot_ac": "P84078", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84078" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84078" } ] } ] }, { "uniprot_ac": "P84079", "gene_name": "Arf1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84079" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84079" } ] } ] }, { "uniprot_ac": "P97538", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P97538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97538" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P97538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97538" } ] } ] }, { "uniprot_ac": "P97687", "gene_name": "Entpd1", "activity": [ { "ec_number": "3.6.1.5", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + 2 H2O = a 2'-deoxyribonucleoside 5'-phosphate + 2 H(+) + 2 phosphate.", "evidence": [ { "id": "P97687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97687" } ] }, { "ec_number": "3.6.1.5", "activity": "", "evidence": [ { "id": "P97687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97687" } ] } ] }, { "uniprot_ac": "Q00246", "gene_name": "RHO4", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q00246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00246" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q00246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00246" } ] } ] }, { "uniprot_ac": "Q00582", "gene_name": "GTR1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q00582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00582" } ] } ] }, { "uniprot_ac": "Q01514", "gene_name": "Gbp1", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] } ] }, { "uniprot_ac": "Q04970", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] } ] }, { "uniprot_ac": "Q05193", "gene_name": "DNM1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q05193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05193" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q05193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05193" } ] } ] }, { "uniprot_ac": "Q05D44", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] } ] }, { "uniprot_ac": "Q08877", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q08877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08877" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q08877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08877" } ] } ] }, { "uniprot_ac": "Q08AT1", "gene_name": "Rasl12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] } ] }, { "uniprot_ac": "Q0GUM3", "gene_name": "Gm12250", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q0GUM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0GUM3" } ] } ] }, { "uniprot_ac": "Q149F3", "gene_name": "Gspt2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q149F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q149F3" } ] } ] }, { "uniprot_ac": "Q15382", "gene_name": "RHEB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q15382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15382" } ] } ] }, { "uniprot_ac": "Q15907", "gene_name": "RAB11B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q15907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15907" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q15907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15907" } ] } ] }, { "uniprot_ac": "Q24208", "gene_name": "eIF2gamma", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q24208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24208" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q24208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24208" } ] } ] }, { "uniprot_ac": "Q2TA68", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q2TA68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TA68" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q2TA68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TA68" } ] } ] }, { "uniprot_ac": "Q2VIR3", "gene_name": "EIF2S3B", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q2VIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2VIR3" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q2VIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2VIR3" } ] } ] }, { "uniprot_ac": "Q3T9E4", "gene_name": "Tgtp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3T9E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T9E4" } ] } ] }, { "uniprot_ac": "Q3TCT4", "gene_name": "Entpd7", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] } ] }, { "uniprot_ac": "Q3UX10", "gene_name": "Tubal3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3UX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UX10" } ] } ] }, { "uniprot_ac": "Q4V339", "gene_name": "ZNG1F", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q4V339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V339" } ] } ] }, { "uniprot_ac": "Q54MH8", "gene_name": "dlpB", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54MH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MH8" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q54MH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MH8" } ] } ] }, { "uniprot_ac": "Q54XD8", "gene_name": "eif2s3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54XD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XD8" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q54XD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XD8" } ] } ] }, { "uniprot_ac": "Q54XP6", "gene_name": "eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54XP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XP6" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q54XP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XP6" } ] } ] }, { "uniprot_ac": "Q54Y30", "gene_name": "rsmC", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q54Y30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y30" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q54Y30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y30" } ] } ] }, { "uniprot_ac": "Q55AX0", "gene_name": "dlpC", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55AX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AX0" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q55AX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AX0" } ] } ] }, { "uniprot_ac": "Q55BW0", "gene_name": "rapC", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55BW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BW0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55BW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BW0" } ] } ] }, { "uniprot_ac": "Q55CA9", "gene_name": "rasZ", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CA9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CA9" } ] } ] }, { "uniprot_ac": "Q55CB0", "gene_name": "rasU", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB0" } ] } ] }, { "uniprot_ac": "Q55CB7", "gene_name": "rasY", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB7" } ] } ] }, { "uniprot_ac": "Q55CB8", "gene_name": "rasX", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB8" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB8" } ] } ] }, { "uniprot_ac": "Q55CB9", "gene_name": "rasV", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CB9" } ] } ] }, { "uniprot_ac": "Q55CC0", "gene_name": "rasW", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55CC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CC0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q55CC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55CC0" } ] } ] }, { "uniprot_ac": "Q55F94", "gene_name": "dlpA", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q55F94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F94" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q55F94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F94" } ] } ] }, { "uniprot_ac": "Q5BJP6", "gene_name": "Gfm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5BJP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJP6" } ] } ] }, { "uniprot_ac": "Q5BJQ5", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q5BJQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJQ5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5BJQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJQ5" } ] } ] }, { "uniprot_ac": "Q5JTY5", "gene_name": "ZNG1C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5JTY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JTY5" } ] } ] }, { "uniprot_ac": "Q5RIA9", "gene_name": "ZNG1E", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5RIA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RIA9" } ] } ] }, { "uniprot_ac": "Q5S006", "gene_name": "Lrrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] } ] }, { "uniprot_ac": "Q5S007", "gene_name": "LRRK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] } ] }, { "uniprot_ac": "Q5SSG5", "gene_name": "Rasl10b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] } ] }, { "uniprot_ac": "Q5VZM2", "gene_name": "RRAGB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5VZM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZM2" } ] } ] }, { "uniprot_ac": "Q5XIF6", "gene_name": "Tuba4a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5XIF6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF6" } ] } ] }, { "uniprot_ac": "Q60766", "gene_name": "Irgm1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60766" } ] } ] }, { "uniprot_ac": "Q61107", "gene_name": "Gbp3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61107" } ] } ] }, { "uniprot_ac": "Q61411", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] } ] }, { "uniprot_ac": "Q61820", "gene_name": "Rasl2-9", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61820" } ] } ] }, { "uniprot_ac": "Q62293", "gene_name": "Tgtp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q62293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62293" } ] } ] }, { "uniprot_ac": "Q62636", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q62636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62636" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q62636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62636" } ] } ] }, { "uniprot_ac": "Q62639", "gene_name": "Rheb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q62639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62639" } ] } ] }, { "uniprot_ac": "Q63486", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63486" } ] } ] }, { "uniprot_ac": "Q63487", "gene_name": "RragB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63487" } ] } ] }, { "uniprot_ac": "Q63663", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63663", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63663" } ] } ] }, { "uniprot_ac": "Q66HA6", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q66HA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q66HA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA6" } ] } ] }, { "uniprot_ac": "Q68FR8", "gene_name": "Tuba3a", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q68FR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FR8" } ] } ] }, { "uniprot_ac": "Q69ZS7", "gene_name": "Hbs1l", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q69ZS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZS7" } ] } ] }, { "uniprot_ac": "Q6AXM7", "gene_name": "Hbs1l", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AXM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXM7" } ] } ] }, { "uniprot_ac": "Q6AY56", "gene_name": "Tuba8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AY56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AY56" } ] } ] }, { "uniprot_ac": "Q6AYB5", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] } ] }, { "uniprot_ac": "Q6AYC2", "gene_name": "Irgm", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYC2" } ] } ] }, { "uniprot_ac": "Q6AYF9", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYF9" } ] } ] }, { "uniprot_ac": "Q6AYZ1", "gene_name": "Tuba1c", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYZ1" } ] } ] }, { "uniprot_ac": "Q6IMA3", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA3" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA3" } ] } ] }, { "uniprot_ac": "Q6IMA7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA7" } ] } ] }, { "uniprot_ac": "Q6IMB1", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] } ] }, { "uniprot_ac": "Q6NTA4", "gene_name": "Rragb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NTA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NTA4" } ] } ] }, { "uniprot_ac": "Q6NXR0", "gene_name": "IRGC", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NXR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NXR0" } ] } ] }, { "uniprot_ac": "Q6NYB7", "gene_name": "Rab1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6NYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NYB7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6NYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NYB7" } ] } ] }, { "uniprot_ac": "Q6P9V9", "gene_name": "Tuba1b", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6P9V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P9V9" } ] } ] }, { "uniprot_ac": "Q6PEY2", "gene_name": "TUBA3E", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6PEY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PEY2" } ] } ] }, { "uniprot_ac": "Q6RUV5", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6RUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6RUV5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6RUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6RUV5" } ] } ] }, { "uniprot_ac": "Q6T310", "gene_name": "RASL11A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q6T310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6T310" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6T310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6T310" } ] } ] }, { "uniprot_ac": "Q6ZN66", "gene_name": "GBP6", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6ZN66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZN66" } ] } ] }, { "uniprot_ac": "Q71U36", "gene_name": "TUBA1A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q71U36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71U36" } ] } ] }, { "uniprot_ac": "Q75K18", "gene_name": "srp54", "activity": [ { "ec_number": "3.6.5.4", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q75K18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75K18" } ] }, { "ec_number": "3.6.5.4", "activity": "", "evidence": [ { "id": "Q75K18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q75K18" } ] } ] }, { "uniprot_ac": "Q7L523", "gene_name": "RRAGA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7L523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L523" } ] } ] }, { "uniprot_ac": "Q7TN89", "gene_name": "Eras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] } ] }, { "uniprot_ac": "Q7TQD2", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TQD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQD2" } ] } ] }, { "uniprot_ac": "Q7TT45", "gene_name": "Rragd", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TT45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT45" } ] } ] }, { "uniprot_ac": "Q7YU24", "gene_name": "Marf", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7YU24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7YU24" } ] } ] }, { "uniprot_ac": "Q7Z444", "gene_name": "ERAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q7Z444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z444" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7Z444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z444" } ] } ] }, { "uniprot_ac": "Q80U63", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80U63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U63" } ] } ] }, { "uniprot_ac": "Q80X95", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80X95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X95" } ] } ] }, { "uniprot_ac": "Q80ZJ1", "gene_name": "Rap2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] } ] }, { "uniprot_ac": "Q811U4", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q811U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811U4" } ] } ] }, { "uniprot_ac": "Q869Q0", "gene_name": "", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q869Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q869Q0" } ] } ] }, { "uniprot_ac": "Q86L51", "gene_name": "rapB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q86L51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86L51" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q86L51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86L51" } ] } ] }, { "uniprot_ac": "Q8BU31", "gene_name": "Rap2c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] } ] }, { "uniprot_ac": "Q8BZ98", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] } ] }, { "uniprot_ac": "Q8C262", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C262" } ] } ] }, { "uniprot_ac": "Q8C3X4", "gene_name": "Guf1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C3X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C3X4" } ] } ] }, { "uniprot_ac": "Q8C7H1", "gene_name": "Mmaa", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8C7H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7H1" } ] } ] }, { "uniprot_ac": "Q8CFB4", "gene_name": "Gbp5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8CFB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFB4" } ] } ] }, { "uniprot_ac": "Q8CFN2", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8CFN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFN2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8CFN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFN2" } ] } ] }, { "uniprot_ac": "Q8IUF1", "gene_name": "ZNG1B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IUF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IUF1" } ] } ] }, { "uniprot_ac": "Q8IVH4", "gene_name": "MMAA", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8IVH4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVH4" } ] } ] }, { "uniprot_ac": "Q8IWA4", "gene_name": "MFN1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IWA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWA4" } ] } ] }, { "uniprot_ac": "Q8IYD1", "gene_name": "GSPT2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IYD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IYD1" } ] } ] }, { "uniprot_ac": "Q8K1M6", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] } ] }, { "uniprot_ac": "Q8K586", "gene_name": "Rasl2-9", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8K586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K586" } ] } ] }, { "uniprot_ac": "Q8K5A4", "gene_name": "Rasl10a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] } ] }, { "uniprot_ac": "Q8N442", "gene_name": "GUF1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8N442", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N442" } ] } ] }, { "uniprot_ac": "Q8N8V2", "gene_name": "GBP7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q8N8V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N8V2" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8N8V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N8V2" } ] } ] }, { "uniprot_ac": "Q8R050", "gene_name": "Gspt1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R050", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R050" } ] } ] }, { "uniprot_ac": "Q8R2Q4", "gene_name": "Gfm2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R2Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Q4" } ] } ] }, { "uniprot_ac": "Q8R367", "gene_name": "Rerg", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] } ] }, { "uniprot_ac": "Q8R4Z9", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R4Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4Z9" } ] } ] }, { "uniprot_ac": "Q8R500", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R500", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R500" } ] } ] }, { "uniprot_ac": "Q8VEH6", "gene_name": "Zng1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8VEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEH6" } ] } ] }, { "uniprot_ac": "Q8WUD1", "gene_name": "RAB2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q8WUD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUD1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8WUD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUD1" } ] } ] }, { "uniprot_ac": "Q91Z40", "gene_name": "Gbp7", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q91Z40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z40" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q91Z40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z40" } ] } ] }, { "uniprot_ac": "Q91ZR1", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] } ] }, { "uniprot_ac": "Q921J2", "gene_name": "Rheb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q921J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921J2" } ] } ] }, { "uniprot_ac": "Q922H7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] } ] }, { "uniprot_ac": "Q92696", "gene_name": "RABGGTA", "activity": [ { "ec_number": "2.5.1.60", "activity": "geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein].", "evidence": [ { "id": "Q92696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92696" } ] }, { "ec_number": "2.5.1.60", "activity": "", "evidence": [ { "id": "Q92696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92696" } ] } ] }, { "uniprot_ac": "Q92737", "gene_name": "RASL10A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q92737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92737" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92737" } ] } ] }, { "uniprot_ac": "Q92928", "gene_name": "RAB1C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q92928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92928" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92928" } ] } ] }, { "uniprot_ac": "Q92963", "gene_name": "RIT1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q92963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92963" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92963" } ] } ] }, { "uniprot_ac": "Q969S9", "gene_name": "GFM2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q969S9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969S9" } ] } ] }, { "uniprot_ac": "Q96A58", "gene_name": "RERG", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q96A58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q96A58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A58" } ] } ] }, { "uniprot_ac": "Q96PP8", "gene_name": "GBP5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP8" } ] } ] }, { "uniprot_ac": "Q96PP9", "gene_name": "GBP4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP9" } ] } ] }, { "uniprot_ac": "Q96S79", "gene_name": "RASL10B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q96S79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S79" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q96S79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S79" } ] } ] }, { "uniprot_ac": "Q99578", "gene_name": "RIT2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99578" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99578" } ] } ] }, { "uniprot_ac": "Q99JI6", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] } ] }, { "uniprot_ac": "Q99K70", "gene_name": "Rragc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99K70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99K70" } ] } ] }, { "uniprot_ac": "Q99MB4", "gene_name": "Zng1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99MB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MB4" } ] } ] }, { "uniprot_ac": "Q99P58", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] } ] }, { "uniprot_ac": "Q99P74", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q99P74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P74" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P74" } ] } ] }, { "uniprot_ac": "Q9BPW5", "gene_name": "RASL11B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9BPW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BPW5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9BPW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BPW5" } ] } ] }, { "uniprot_ac": "Q9BQE3", "gene_name": "TUBA1C", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9BQE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQE3" } ] } ] }, { "uniprot_ac": "Q9BRT8", "gene_name": "ZNG1A", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9BRT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRT8" } ] } ] }, { "uniprot_ac": "Q9BSD7", "gene_name": "NTPCR", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9BSD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BSD7" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9BSD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BSD7" } ] } ] }, { "uniprot_ac": "Q9CQA9", "gene_name": "Ntpcr", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9CQA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQA9" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9CQA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQA9" } ] } ] }, { "uniprot_ac": "Q9CQD1", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] } ] }, { "uniprot_ac": "Q9CQW2", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] } ] }, { "uniprot_ac": "Q9D1G1", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] } ] }, { "uniprot_ac": "Q9DCE9", "gene_name": "Igtp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9DCE9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCE9" } ] } ] }, { "uniprot_ac": "Q9ERI2", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] } ] }, { "uniprot_ac": "Q9H0R5", "gene_name": "GBP3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9H0R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0R5" } ] } ] }, { "uniprot_ac": "Q9H0U4", "gene_name": "RAB1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9H0U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0U4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9H0U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0U4" } ] } ] }, { "uniprot_ac": "Q9H628", "gene_name": "RERGL", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9H628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H628" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9H628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H628" } ] } ] }, { "uniprot_ac": "Q9H853", "gene_name": "TUBA4B", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9H853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H853" } ] } ] }, { "uniprot_ac": "Q9HB90", "gene_name": "RRAGC", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9HB90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB90" } ] } ] }, { "uniprot_ac": "Q9JIW9", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] } ] }, { "uniprot_ac": "Q9JJZ2", "gene_name": "Tuba8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9JJZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJZ2" } ] } ] }, { "uniprot_ac": "Q9NQL2", "gene_name": "RRAGD", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9NQL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQL2" } ] } ] }, { "uniprot_ac": "Q9NQZ7", "gene_name": "ENTPD7", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9NQZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQZ7" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9NQZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQZ7" } ] } ] }, { "uniprot_ac": "Q9NRW1", "gene_name": "RAB6B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9NRW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NRW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW1" } ] } ] }, { "uniprot_ac": "Q9NVJ2", "gene_name": "ARL8B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9NVJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVJ2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NVJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVJ2" } ] } ] }, { "uniprot_ac": "Q9NY65", "gene_name": "TUBA8", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9NY65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NY65" } ] } ] }, { "uniprot_ac": "Q9NYN1", "gene_name": "RASL12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9NYN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYN1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NYN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYN1" } ] } ] }, { "uniprot_ac": "Q9QUI0", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] } ] }, { "uniprot_ac": "Q9QXB9", "gene_name": "Drg2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXB9" } ] } ] }, { "uniprot_ac": "Q9QZ85", "gene_name": "Iigp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QZ85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZ85" } ] } ] }, { "uniprot_ac": "Q9UQ16", "gene_name": "DNM3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9UQ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ16" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q9UQ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ16" } ] } ] }, { "uniprot_ac": "Q9V3I2", "gene_name": "Rab5", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9V3I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3I2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9V3I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3I2" } ] } ] }, { "uniprot_ac": "Q9VM20", "gene_name": "Dmel\\CG5160", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9VM20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VM20" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9VM20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VM20" } ] } ] }, { "uniprot_ac": "Q9VRH6", "gene_name": "waw", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9VRH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRH6" } ] } ] }, { "uniprot_ac": "Q9VRY2", "gene_name": "Dmel\\CG8519", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9VRY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRY2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9VRY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRY2" } ] } ] }, { "uniprot_ac": "Q9W074", "gene_name": "HBS1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9W074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W074" } ] } ] }, { "uniprot_ac": "Q9Y227", "gene_name": "ENTPD4", "activity": [ { "ec_number": "3.6.1.15", "activity": "a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.42", "activity": "GDP + H2O = GMP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] } ] }, { "uniprot_ac": "Q9Y295", "gene_name": "DRG1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Y295", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y295" } ] } ] }, { "uniprot_ac": "Q9Y3L5", "gene_name": "RAP2C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] } ] }, { "uniprot_ac": "Q9Y450", "gene_name": "HBS1L", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Y450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y450" } ] } ] }, { "uniprot_ac": "Q9Z0E6", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Z0E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0E6" } ] } ] }, { "uniprot_ac": "Q9Z0N1", "gene_name": "Eif2s3x", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] } ] }, { "uniprot_ac": "Q9Z0N2", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 16 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 59, "end_pos": 61 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 220 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }