{ "uniprot_canonical_ac": "E9PQ53-1", "uniprot_ac": "E9PQ53", "uniprot_id": "NDUCR_HUMAN", "mass": { "chemical_mass": 13408.0, "monoisotopic_mass": 13408.0 }, "refseq": { "ac": "NP_001190190", "name": "NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 isoform 2", "summary": "This locus represents naturally occurring read-through transcription between the neighboring NDUFC2 (NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa) and KCTD14 (potassium channel tetramerisation domain containing 14) genes on chromosome 11. The read-through transcripts share sequence identity with the upstream gene product and one variant has a frameshifted C-terminal region derived from the downstream gene exons. [provided by RefSeq, Feb 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001190190" }, "gene_names": [ { "name": "NDUFC2-KCTD14", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/E9PQ53", "id": "E9PQ53" }, { "name": "NDUFC2-KCTD14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001190190", "id": "NP_001190190" } ], "protein_names": [ { "name": "NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "E9PQ53" }, { "name": "NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001190190", "id": "NP_001190190" }, { "name": "NDUFC2-KCTD14 readthrough transcript protein; NADH dehydrogenase [ubiquinone] 1 subunit C2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001190190", "id": "NP_001190190" }, { "name": "NDUFC2-KCTD14 readthrough transcript protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "E9PQ53" } ], "function": [ { "annotation": "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53#function" } ] }, { "annotation": "This locus represents naturally occurring read-through transcription between the neighboring NDUFC2 (NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa) and KCTD14 (potassium channel tetramerisation domain containing 14) genes on chromosome 11. The read-through transcripts share sequence identity with the upstream gene product and one variant has a frameshifted C-terminal region derived from the downstream gene exons. [provided by RefSeq, Feb 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001190190", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001190190" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "E9PQ53", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/E9PQ53" } ], "glycoeffect": [], "start_pos": 59, "end_pos": 59, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "11", "chr_pos": "78073133", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R59", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "36.38", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "56.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "67.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "51.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "39.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "51.47", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "60.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "32.52", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "48.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53" } ], "common_name": "Human" } ], "gene": [ { "name": "NDUFC2-KCTD14", "url": "https://www.uniprot.org/uniprot/E9PQ53", "locus": { "chromosome": "11", "start_pos": 78016971, "end_pos": 78079865, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000259112", "url": "https://www.ensembl.org/id/ENSG00000259112" } ] } } ], "crossref": [ { "id": "ENSG00000259112", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259112", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "E9PQ53", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/E9PQ53", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "NDUFC2-KCTD14", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NDUFC2-KCTD14", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "100532726", "url": "https://www.ncbi.nlm.nih.gov/gene/100532726", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "42956", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=42956", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "E9PQ53", "url": "https://www.ebi.ac.uk/intact/interactors/id:E9PQ53*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009423", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009423", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:100532726", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100532726", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_E9PQ53", "url": "https://www.nextprot.org/entry/NX_E9PQ53", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "QGERSEC", "url": "https://omabrowser.org/oma/group/QGERSEC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2912088at2759", "url": "http://www.orthodb.org/?query=2912088at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13099", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13099", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13099:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13099:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06374", "url": "http://pfam.xfam.org/family/PF06374", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "E9PQ53", "url": "https://pharos.nih.gov/targets/E9PQ53", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_E9PQ53", "url": "http://purl.obolibrary.org/obo/PR_E9PQ53", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001190190", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001190190", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WUM3", "url": "https://www.uniprot.org/uniprot/A0A087WUM3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WUM3-1", "url": "https://www.uniprot.org/uniprot/A0A087WUM3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WY27", "url": "https://www.uniprot.org/uniprot/A0A087WY27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WY27-1", "url": "https://www.uniprot.org/uniprot/A0A087WY27-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQ53-1", "url": "https://www.uniprot.org/uniprot/E9PQ53-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PRQ4", "url": "https://www.uniprot.org/uniprot/E9PRQ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PRQ4-1", "url": "https://www.uniprot.org/uniprot/E9PRQ4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG", "length": 114, "header": "sp|E9PQ53-1|NDUCR_HUMAN Isoform 1 of NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 OS=Homo sapiens OX=9606 GN=NDUFC2-KCTD14 PE=1 SV=1 CANONICAL=E9PQ53-1" }, "isoforms": [ { "isoform_ac": "A0A087WUM3-1", "url": "", "sequence": { "sequence": "MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEGGDIGLCCLSPGSLSDTPAVFAVGSSAATTH", "length": 134, "header": "tr|A0A087WUM3-1|NDUCR_HUMAN Computationally mapped isoform of NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 OS=Homo sapiens OX=9606 GN=NDUFC2-KCTD14 PE=1 SV=1 CANONICAL=E9PQ53-1" }, "locus": { "chromosome": "11", "start_pos": 78079744, "end_pos": 78038667, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000612612.5", "url": "https://www.ensembl.org/id/ENST00000612612.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000478766.1", "url": "https://www.ensembl.org/id/ENSP00000478766.1" } ] } }, { "isoform_ac": "A0A087WY27-1", "url": "", "sequence": { "sequence": "MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGGDIGLCCLSPGSLSDTPAVFAVGSSAATTH", "length": 86, "header": "tr|A0A087WY27-1|A0A087WY27_HUMAN Computationally mapped isoform of NDUFC2-KCTD14 readthrough OS=Homo sapiens OX=9606 GN=NDUFC2-KCTD14 PE=1 SV=1 CANONICAL=E9PQ53-1" }, "locus": { "chromosome": "11", "start_pos": 78079744, "end_pos": 78038667, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000614236.2", "url": "https://www.ensembl.org/id/ENST00000614236.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000481472.1", "url": "https://www.ensembl.org/id/ENSP00000481472.1" } ] } }, { "isoform_ac": "E9PQ53-1", "url": "", "sequence": { "sequence": "MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG", "length": 114, "header": "sp|E9PQ53-1|NDUCR_HUMAN Isoform 1 of NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 OS=Homo sapiens OX=9606 GN=NDUFC2-KCTD14 PE=1 SV=1 CANONICAL=E9PQ53-1" }, "locus": { "chromosome": "11", "start_pos": 78079744, "end_pos": 78017239, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000530054.1", "url": "https://www.ensembl.org/id/ENST00000530054.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000432614.1", "url": "https://www.ensembl.org/id/ENSP00000432614.1" } ] } }, { "isoform_ac": "E9PRQ4-1", "url": "", "sequence": { "sequence": "MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATADVYCCGAERRG", "length": 66, "header": "tr|E9PRQ4-1|NDUCR_HUMAN Computationally mapped isoform of NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 OS=Homo sapiens OX=9606 GN=NDUFC2-KCTD14 PE=1 SV=1 CANONICAL=E9PQ53-1" }, "locus": { "chromosome": "11", "start_pos": 78079744, "end_pos": 78017239, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000528251.1", "url": "https://www.ensembl.org/id/ENST00000528251.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000435967.1", "url": "https://www.ensembl.org/id/ENSP00000435967.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "hsa:100532726", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100532726", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6I691-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 subunit C2", "gene_name": "Ndufc2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMNGRPGHEPLRFLPDEARRLPPPKLNDPRLVYIGFLGYCTGLMDNMMRMRPVMKAGLHRQLLYVTSFFFAGYFYLKRQNYLYAVRDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR", "length": 120 }, "evidence": [ { "id": "45931526", "url": "http://www.informatics.jax.org/homology/45931526", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O95298-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 subunit C2", "gene_name": "NDUFC2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR", "length": 119 }, "evidence": [ { "id": "45931526", "url": "http://www.informatics.jax.org/homology/45931526", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CQ54-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 subunit C2", "gene_name": "Ndufc2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR", "length": 120 }, "evidence": [ { "id": "45931526", "url": "http://www.informatics.jax.org/homology/45931526", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex I", "id": "GO:0005747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747", "evidence": [ { "database": "UniProtKB", "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial electron transport, NADH to ubiquinone", "id": "GO:0006120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006120", "evidence": [ { "database": "UniProtKB", "id": "E9PQ53", "url": "https://www.uniprot.org/uniprot/E9PQ53" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 59 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }