{ "uniprot_canonical_ac": "D6RBM5-1", "uniprot_ac": "D6RBM5", "uniprot_id": "U17LN_HUMAN", "mass": { "chemical_mass": 20302.0, "monoisotopic_mass": 20302.0 }, "refseq": {}, "gene_names": [ { "name": "USP17L23", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/D6RBM5", "id": "D6RBM5" } ], "protein_names": [ { "name": "Putative ubiquitin carboxyl-terminal hydrolase 17-like protein 23", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "D6RBM5" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "60.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "16.34", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "14.44", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "29.24", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "18.86", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "17.71", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "D6RBM5", "url": "https://www.uniprot.org/uniprot/D6RBM5" } ], "common_name": "Human" } ], "gene": [ { "name": "USP17L23", "url": "https://www.uniprot.org/uniprot/D6RBM5", "locus": { "chromosome": "4", "start_pos": 9272914, "end_pos": 9272364, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000250913", "url": "https://www.ensembl.org/id/ENSG00000250913" } ] } } ], "crossref": [ { "id": "ENSG00000250913", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000250913", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "USP17L23", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=USP17L23", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "44451", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=44451", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR001394", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001394", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018200", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018200", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028889", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028889", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038765", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038765", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_D6RBM5", "url": "https://www.nextprot.org/entry/NX_D6RBM5", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CIMETHV", "url": "https://omabrowser.org/oma/group/CIMETHV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24006", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24006", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24006:SF651", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24006:SF651", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00443", "url": "http://pfam.xfam.org/family/PF00443", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "D6RBM5", "url": "https://pharos.nih.gov/targets/D6RBM5", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "D6RBM5", "url": "https://www.uniprot.org/uniprot/D6RBM5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBM5-1", "url": "https://www.uniprot.org/uniprot/D6RBM5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRHKGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGHKQV", "length": 183, "header": "sp|D6RBM5-1|U17LN_HUMAN Isoform 1 of Putative ubiquitin carboxyl-terminal hydrolase 17-like protein 23 OS=Homo sapiens OX=9606 GN=USP17L23 PE=5 SV=1 CANONICAL=D6RBM5-1" }, "isoforms": [ { "isoform_ac": "D6RBM5-1", "url": "", "sequence": { "sequence": "MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRHKGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGHKQV", "length": 183, "header": "sp|D6RBM5-1|U17LN_HUMAN Isoform 1 of Putative ubiquitin carboxyl-terminal hydrolase 17-like protein 23 OS=Homo sapiens OX=9606 GN=USP17L23 PE=5 SV=1 CANONICAL=D6RBM5-1" }, "locus": { "chromosome": "4", "start_pos": 9272912, "end_pos": 9272364, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000506619.2", "url": "https://www.ensembl.org/id/ENST00000506619.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000424077.2", "url": "https://www.ensembl.org/id/ENSP00000424077.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "D6RBM5", "url": "https://www.uniprot.org/uniprot/D6RBM5" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "D6RBM5", "url": "https://www.uniprot.org/uniprot/D6RBM5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "D6RBM5", "url": "https://www.uniprot.org/uniprot/D6RBM5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 92, "end_pos": 94 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }