{ "uniprot_canonical_ac": "C7FZW5-1", "uniprot_ac": "C7FZW5", "uniprot_id": "C7FZW5_DICDI", "mass": { "chemical_mass": 31907.0, "monoisotopic_mass": 31907.0 }, "refseq": { "ac": "XP_002649204", "name": "GNS1/SUR4 family protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002649204" }, "gene_names": [ { "name": "DDB_G0270312", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/C7FZW5", "id": "C7FZW5" } ], "protein_names": [ { "name": "Elongation of fatty acids protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "C7FZW5" }, { "name": "2.3.1.199", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "C7FZW5" }, { "name": "GNS1/SUR4 family protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002649204", "id": "XP_002649204" }, { "name": "Very-long-chain 3-oxoacyl-CoA synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "C7FZW5" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/C7FZW5", "locus": {} } ], "crossref": [ { "id": "DDB_G0270312", "url": "http://dictybase.org/gene/DDB_G0270312", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8617670", "url": "https://www.ncbi.nlm.nih.gov/gene/8617670", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002076", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0270312", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0270312", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WTYFTST", "url": "https://omabrowser.org/oma/group/WTYFTST/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157:SF126", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF126", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01151", "url": "http://pfam.xfam.org/family/PF01151", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-2046105", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-75876", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_002649204", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002649204", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "32727", "url": "https://www.rhea-db.org/rhea/32727", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C7FZW5-1", "url": "https://www.uniprot.org/uniprot/C7FZW5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFLVDYYNYLSERYDYYLTLRDERVLNWPLINRPHEMIYLVIGYFAIIFFGQKIMKKQKPFELRYPLIIHNVVCTLLSLYMTIEITYQAYSNNYSLMCNSVDYSEKGLGMAKVLWLFYFSKFIEFMDTFFMVLRKKDSQITVLHVYHHSTMPMLWIMGIWYAAGGDSYISALINSFIHTVMYSYYALSLFGFNIWWKKYLTQLQLIQFAMNLIFSMWSLYNDCKFIKWMHWGMIIYMISFLFLFGAFYKRSYSQPKKSTKKIQ", "length": 263, "header": "tr|C7FZW5-1|C7FZW5_DICDI Isoform 1 of Elongation of fatty acids protein OS=Dictyostelium discoideum OX=44689 GN= PE=3 SV=1 CANONICAL=C7FZW5-1" }, "isoforms": [ { "isoform_ac": "C7FZW5-1", "url": "", "sequence": { "sequence": "MFLVDYYNYLSERYDYYLTLRDERVLNWPLINRPHEMIYLVIGYFAIIFFGQKIMKKQKPFELRYPLIIHNVVCTLLSLYMTIEITYQAYSNNYSLMCNSVDYSEKGLGMAKVLWLFYFSKFIEFMDTFFMVLRKKDSQITVLHVYHHSTMPMLWIMGIWYAAGGDSYISALINSFIHTVMYSYYALSLFGFNIWWKKYLTQLQLIQFAMNLIFSMWSLYNDCKFIKWMHWGMIIYMISFLFLFGAFYKRSYSQPKKSTKKIQ", "length": 263, "header": "tr|C7FZW5-1|C7FZW5_DICDI Isoform 1 of Elongation of fatty acids protein OS=Dictyostelium discoideum OX=44689 GN= PE=3 SV=1 CANONICAL=C7FZW5-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0270312", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0270312", "resource": "KEGG Pathway" }, { "id": "R-DDI-2046105", "name": "Linoleic acid (LA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046105", "resource": "Reactome", "description": "Linoleic acid (LA) metabolism" }, { "id": "R-DDI-2046106", "name": "alpha-linolenic acid (ALA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046106", "resource": "Reactome", "description": "alpha-linolenic acid (ALA) metabolism" }, { "id": "R-DDI-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-75876", "resource": "Reactome", "description": "Synthesis of very long-chain fatty acyl-CoAs" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" }, { "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" }, { "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" }, { "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" }, { "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "fatty acid elongase activity", "id": "GO:0009922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "evidence": [ { "database": "UniProtKB", "id": "C7FZW5", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 93, "end_pos": 95, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32727", "name": "", "equation": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4A612-1", "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A0A1B0GWP1-1", "D3ZPX9-1", "D4ACH5-1", "A1L3X0-1", "Q9H5J4-1", "Q9GZR5-1", "Q9NYP7-1", "Q9HB03-1", "Q9NXB9-1", "Q9BW60-1", "Q920L5-1", "Q8BHI7-1", "O35949-1", "Q9EQC4-1", "Q9D2Y9-1", "Q9JLJ4-1", "Q9JLJ5-1", "P25358-1", "P39540-1", "P40319-1", "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1", "A8JNR0-1", "Q9VHX7-1", "A0A0B4KF65-1", "Q9VH58-1", "Q9VV87-1", "Q6NN18-1", "Q4V3H4-1", "A1ZBD2-1", "Q9VCY6-1", "Q5JZZ4-1", "Q9VH59-1", "Q9VCT3-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1", "Q8SXD1-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1" ], "evidence": [ { "id": "32727", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32727" } ] }, { "id": "R-DDI-2046083", "name": "Elongation of arachidonyl-CoA to docosatetraenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-113601", "R-ALL-2046053", "R-ALL-2046066" ], "output_participant_list": [ "R-ALL-162743", "R-ALL-159751", "R-ALL-2046060" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1" ], "evidence": [ { "id": "R-DDI-2046083", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046083" } ] }, { "id": "R-DDI-2046088", "name": "Elongation of stearidonoyl-CoA to eicosatetraenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046052" ], "output_participant_list": [ "R-ALL-2046051" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1" ], "evidence": [ { "id": "R-DDI-2046088", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046088" } ] }, { "id": "R-DDI-2046090", "name": "Elongation of docosapentaenoyl-CoA to tetracosapentaenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2046065" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1" ], "evidence": [ { "id": "R-DDI-2046090", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046090" } ] }, { "id": "R-DDI-2046094", "name": "Elongation of gamma-lenolenoyl-CoA to dihomo-gamma-lenolenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046042" ], "output_participant_list": [ "R-ALL-2046045" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1" ], "evidence": [ { "id": "R-DDI-2046094", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046094" } ] }, { "id": "R-DDI-2046095", "name": "Elongation of docosatetraenoyl-CoA to tetracosatetraenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2046048" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1" ], "evidence": [ { "id": "R-DDI-2046095", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046095" } ] }, { "id": "R-DDI-2046100", "name": "Elongation of eicosapentaenoyl-CoA to docosapentaenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046059" ], "output_participant_list": [ "R-ALL-2046057" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1" ], "evidence": [ { "id": "R-DDI-2046100", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2046100" } ] }, { "id": "R-DDI-548800", "name": "ELOVL1,2,3,5 elongate AA-CoA and Mal-CoA to 3ODCT-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-548819" ], "output_participant_list": [ "R-ALL-548816" ], "enzyme_list": [ "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1" ], "evidence": [ { "id": "R-DDI-548800", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-548800" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-113601", "participant_name": "NADPH [endoplasmic reticulum lumen]", "crossref": [ { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000221", "database": "HMDB Metabolite", "url": "" }, { "id": "3041", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00005", "database": "COMPOUND", "url": "" }, { "id": "000008215411", "database": "ZINC", "url": "" }, { "id": "8145663", "database": "PubChem Substance", "url": "" }, { "id": "16474", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-159751", "participant_name": "CO2 [endoplasmic reticulum lumen]", "crossref": [ { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" }, { "id": "C00011", "database": "COMPOUND", "url": "" }, { "id": "16526", "database": "ChEBI", "url": "" }, { "id": "HMDB0001967", "database": "HMDB Metabolite", "url": "" }, { "id": "11533283", "database": "PubChem Substance", "url": "" } ] }, { "participant_id": "R-ALL-162743", "participant_name": "CoA-SH [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" }, { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2046042", "participant_name": "GLA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" }, { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-2046045", "participant_name": "DGL-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" }, { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-2046048", "participant_name": "TTA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63548", "database": "ChEBI", "url": "" }, { "id": "63548", "database": "ChEBI", "url": "" }, { "id": "63548", "database": "ChEBI", "url": "" }, { "id": "63548", "database": "ChEBI", "url": "" }, { "id": "63548", "database": "ChEBI", "url": "" }, { "id": "63548", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046051", "participant_name": "ETA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" }, { "id": "63542", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046052", "participant_name": "SDA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" }, { "id": "63545", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046053", "participant_name": "AA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046057", "participant_name": "DPA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63541", "database": "ChEBI", "url": "" }, { "id": "63541", "database": "ChEBI", "url": "" }, { "id": "63541", "database": "ChEBI", "url": "" }, { "id": "63541", "database": "ChEBI", "url": "" }, { "id": "63541", "database": "ChEBI", "url": "" }, { "id": "63541", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046059", "participant_name": "EPA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63539", "database": "ChEBI", "url": "" }, { "id": "HMDB0060311", "database": "HMDB Metabolite", "url": "" }, { "id": "63539", "database": "ChEBI", "url": "" }, { "id": "HMDB0060311", "database": "HMDB Metabolite", "url": "" }, { "id": "63539", "database": "ChEBI", "url": "" }, { "id": "HMDB0060311", "database": "HMDB Metabolite", "url": "" }, { "id": "63539", "database": "ChEBI", "url": "" }, { "id": "HMDB0060311", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0060311", "database": "HMDB Metabolite", "url": "" }, { "id": "63539", "database": "ChEBI", "url": "" }, { "id": "63539", "database": "ChEBI", "url": "" }, { "id": "HMDB0060311", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-2046060", "participant_name": "DTA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63544", "database": "ChEBI", "url": "" }, { "id": "63544", "database": "ChEBI", "url": "" }, { "id": "63544", "database": "ChEBI", "url": "" }, { "id": "63544", "database": "ChEBI", "url": "" }, { "id": "63544", "database": "ChEBI", "url": "" }, { "id": "63544", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046065", "participant_name": "TPA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63543", "database": "ChEBI", "url": "" }, { "id": "63543", "database": "ChEBI", "url": "" }, { "id": "63543", "database": "ChEBI", "url": "" }, { "id": "63543", "database": "ChEBI", "url": "" }, { "id": "63543", "database": "ChEBI", "url": "" }, { "id": "63543", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046066", "participant_name": "Malonyl-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548816", "participant_name": "3ODCT-CoA [cytosol]", "crossref": [ { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" }, { "id": "63821", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548819", "participant_name": "AA-CoA [cytosol]", "crossref": [ { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" }, { "id": "57368", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KF65", "gene_name": "BcDNA:GH22993", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] } ] }, { "uniprot_ac": "A0A1B0GWP1", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] } ] }, { "uniprot_ac": "A1L3X0", "gene_name": "ELOVL7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] } ] }, { "uniprot_ac": "A1ZBD2", "gene_name": "Dmel\\CG17821", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] } ] }, { "uniprot_ac": "A8JNR0", "gene_name": "Elo68beta", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] } ] }, { "uniprot_ac": "C7FZW5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] } ] }, { "uniprot_ac": "D3ZPX9", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] } ] }, { "uniprot_ac": "D4A612", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] } ] }, { "uniprot_ac": "D4ACH5", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] } ] }, { "uniprot_ac": "D4ADY9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] } ] }, { "uniprot_ac": "O35949", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] } ] }, { "uniprot_ac": "P25358", "gene_name": "ELO2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] } ] }, { "uniprot_ac": "P39540", "gene_name": "ELO1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] } ] }, { "uniprot_ac": "P40319", "gene_name": "ELO3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] } ] }, { "uniprot_ac": "Q4V3H4", "gene_name": "Dmel\\CG9459", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] } ] }, { "uniprot_ac": "Q54CJ4", "gene_name": "eloA", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] } ] }, { "uniprot_ac": "Q54TC9", "gene_name": "sre1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] } ] }, { "uniprot_ac": "Q555E8", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] } ] }, { "uniprot_ac": "Q55BY4", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] } ] }, { "uniprot_ac": "Q5JZZ4", "gene_name": "Elo68alpha", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] } ] }, { "uniprot_ac": "Q6NN18", "gene_name": "CT42569", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] } ] }, { "uniprot_ac": "Q7KWQ5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] } ] }, { "uniprot_ac": "Q86JM5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] } ] }, { "uniprot_ac": "Q8BHI7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] } ] }, { "uniprot_ac": "Q8IMY2", "gene_name": "Dmel\\CG31141", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] } ] }, { "uniprot_ac": "Q8SXD1", "gene_name": "CG12138", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] } ] }, { "uniprot_ac": "Q920L5", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] } ] }, { "uniprot_ac": "Q920L6", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] } ] }, { "uniprot_ac": "Q920L7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] } ] }, { "uniprot_ac": "Q95T98", "gene_name": "CG9798", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] } ] }, { "uniprot_ac": "Q9BW60", "gene_name": "ELOVL1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] } ] }, { "uniprot_ac": "Q9D2Y9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] } ] }, { "uniprot_ac": "Q9EQC4", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] } ] }, { "uniprot_ac": "Q9GZR5", "gene_name": "ELOVL4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] } ] }, { "uniprot_ac": "Q9H5J4", "gene_name": "ELOVL6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] } ] }, { "uniprot_ac": "Q9HB03", "gene_name": "ELOVL3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] } ] }, { "uniprot_ac": "Q9JLJ4", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] } ] }, { "uniprot_ac": "Q9JLJ5", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] } ] }, { "uniprot_ac": "Q9NXB9", "gene_name": "ELOVL2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] } ] }, { "uniprot_ac": "Q9NYP7", "gene_name": "ELOVL5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] } ] }, { "uniprot_ac": "Q9VCT3", "gene_name": "Dmel\\CG6660", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] } ] }, { "uniprot_ac": "Q9VCY5", "gene_name": "CG13844", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] } ] }, { "uniprot_ac": "Q9VCY6", "gene_name": "sit", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] } ] }, { "uniprot_ac": "Q9VCY7", "gene_name": "bond", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] } ] }, { "uniprot_ac": "Q9VCZ0", "gene_name": "Dmel\\CG5326", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] } ] }, { "uniprot_ac": "Q9VH55", "gene_name": "CT26802", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] } ] }, { "uniprot_ac": "Q9VH57", "gene_name": "Dmel\\CG16904", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] } ] }, { "uniprot_ac": "Q9VH58", "gene_name": "eloF", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] } ] }, { "uniprot_ac": "Q9VH59", "gene_name": "Dmel\\CG8534", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] } ] }, { "uniprot_ac": "Q9VHX7", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] } ] }, { "uniprot_ac": "Q9VV87", "gene_name": "Baldspot", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 93, "end_pos": 95 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }