{ "uniprot_canonical_ac": "B7ZLF3-1", "uniprot_ac": "B7ZLF3", "uniprot_id": "B7ZLF3_HUMAN", "mass": { "chemical_mass": 22424.0, "monoisotopic_mass": 22424.0 }, "refseq": {}, "gene_names": [ { "name": "LOC402624", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B7ZLF3", "id": "B7ZLF3" }, { "name": "LOC728743", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B7ZLF3", "id": "B7ZLF3" }, { "name": "LOC728743", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B7ZLF3", "id": "B7ZLF3" }, { "name": "tcag7.1196", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B7ZLF3", "id": "B7ZLF3" } ], "protein_names": [ { "name": "C2H2-type domain-containing protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B7ZLF3" } ], "function": [ { "annotation": "May be involved in transcriptional regulation.", "evidence": [ { "database": "UniProtKB", "id": "A0A286YF50", "url": "https://www.uniprot.org/uniprot/A0A286YF50#function" }, { "database": "UniProtKB", "id": "ARBA00003767", "url": "https://www.uniprot.org/uniprot/ARBA00003767#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "B7ZLF3", "url": "https://www.uniprot.org/uniprot/B7ZLF3" } ], "common_name": "Human" } ], "gene": [ { "name": "LOC402624", "url": "https://www.uniprot.org/uniprot/B7ZLF3", "locus": {} } ], "crossref": [ { "id": "ENSG00000284691", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000284691", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "LOC728743", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LOC728743", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "VEKEFKC", "url": "https://omabrowser.org/oma/group/VEKEFKC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4569115at2759", "url": "http://www.orthodb.org/?query=4569115at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23226", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23226", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23226:SF352", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23226:SF352", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24390", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24390", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24390:SF197", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24390:SF197", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "http://pfam.xfam.org/family/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A286YF50", "url": "https://www.uniprot.org/uniprot/A0A286YF50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286YF50-1", "url": "https://www.uniprot.org/uniprot/A0A286YF50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZLF3", "url": "https://www.uniprot.org/uniprot/B7ZLF3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZLF3-1", "url": "https://www.uniprot.org/uniprot/B7ZLF3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTELASSGGGSPAGDGEEGLGDERGLVIHHPAEEQPYRCPLCGQTFSQQPSLVRHQKAHAGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFPCPECGRCFSLKQNLLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPAPHPRRPGVFGERRPYFCPRCGKSFAREGSLKTHQRSHGHGPEGQAAHLGRVL", "length": 203, "header": "tr|B7ZLF3-1|B7ZLF3_HUMAN Isoform 1 of C2H2-type domain-containing protein OS=Homo sapiens OX=9606 GN=LOC402624 PE=1 SV=1 CANONICAL=B7ZLF3-1" }, "isoforms": [ { "isoform_ac": "A0A286YF50-1", "url": "", "sequence": { "sequence": "MTELASSGGGSPAGDGEEGLGDERGLVIHHPAEEQPYRCPLCGQTFSQQPSLVRHQKAHAGAGRAAAFVCPECGKAFSVKHNLELQSGQDLKTR", "length": 94, "header": "tr|A0A286YF50-1|A0A286YF50_HUMAN Computationally mapped isoform of C2H2-type domain-containing protein OS=Homo sapiens OX=9606 GN=LOC728743 PE=1 SV=1 CANONICAL=B7ZLF3-1" }, "locus": { "chromosome": "7", "start_pos": 150410189, "end_pos": 150407612, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000641717.1", "url": "https://www.ensembl.org/id/ENST00000641717.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000493012.1", "url": "https://www.ensembl.org/id/ENSP00000493012.1" } ] } }, { "isoform_ac": "B7ZLF3-1", "url": "", "sequence": { "sequence": "MTELASSGGGSPAGDGEEGLGDERGLVIHHPAEEQPYRCPLCGQTFSQQPSLVRHQKAHAGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFPCPECGRCFSLKQNLLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPAPHPRRPGVFGERRPYFCPRCGKSFAREGSLKTHQRSHGHGPEGQAAHLGRVL", "length": 203, "header": "tr|B7ZLF3-1|B7ZLF3_HUMAN Isoform 1 of C2H2-type domain-containing protein OS=Homo sapiens OX=9606 GN=LOC402624 PE=1 SV=1 CANONICAL=B7ZLF3-1" }, "locus": { "chromosome": "7", "start_pos": 150410796, "end_pos": 150410188, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000642087.2", "url": "https://www.ensembl.org/id/ENST00000642087.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000493097.1", "url": "https://www.ensembl.org/id/ENSP00000493097.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "Q8BIN3-1", "protein_name": "Expressed sequence AI854703", "gene_name": "AI854703", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTELVSSRGGSPTGDGEEGLGDDQGLVIHHPAEEQCHRCPLCGQTFSQQPSLVRHQKAHVGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFACPECGRCFSLKQNLLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPTPHPRRPGVFGERRPYFCPRCGKSFAREGSLKTHQRSHGHGPESQAAHLSRVL", "length": 203 }, "evidence": [ { "id": "B7ZLF3", "url": "https://omabrowser.org/oma/group/B7ZLF3/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "B7ZLF3", "url": "https://www.uniprot.org/uniprot/B7ZLF3" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "B7ZLF3", "url": "https://www.uniprot.org/uniprot/B7ZLF3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "B7ZLF3", "url": "https://www.uniprot.org/uniprot/B7ZLF3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }