{ "uniprot_canonical_ac": "A8MTL0-1", "uniprot_ac": "A8MTL0", "uniprot_id": "IQCF5_HUMAN", "mass": { "chemical_mass": 18048.0, "monoisotopic_mass": 18048.0 }, "refseq": { "ac": "NP_001138531", "name": "IQ domain-containing protein F5", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138531" }, "gene_names": [ { "name": "IQCF5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8MTL0", "id": "A8MTL0" }, { "name": "IQCF5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138531", "id": "NP_001138531" } ], "protein_names": [ { "name": "IQ domain-containing protein F5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A8MTL0" }, { "name": "IQ domain-containing protein F5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138531", "id": "NP_001138531" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "28.92", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "26.53", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "22.58", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "21.77", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "21.85", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "20.9", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MTL0", "url": "https://www.uniprot.org/uniprot/A8MTL0" } ], "common_name": "Human" } ], "gene": [ { "name": "IQCF5", "url": "https://www.uniprot.org/uniprot/A8MTL0", "locus": { "chromosome": "3", "start_pos": 51873721, "end_pos": 51875601, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000214681", "url": "https://www.ensembl.org/id/ENSG00000214681" } ] } } ], "crossref": [ { "id": "ENSG00000214681", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214681", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IQCF5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IQCF5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "389124", "url": "https://www.ncbi.nlm.nih.gov/gene/389124", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "35159", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=35159", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A8MTL0", "url": "https://www.ebi.ac.uk/intact/interactors/id:A8MTL0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039887", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039887", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:389124", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:389124", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_A8MTL0", "url": "https://www.nextprot.org/entry/NX_A8MTL0", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "HSRGFIQ", "url": "https://omabrowser.org/oma/group/HSRGFIQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4641637at2759", "url": "http://www.orthodb.org/?query=4641637at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21633", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21633", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21633:SF24", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21633:SF24", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00612", "url": "http://pfam.xfam.org/family/PF00612", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A8MTL0", "url": "https://pharos.nih.gov/targets/A8MTL0", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A8MTL0", "url": "http://purl.obolibrary.org/obo/PR_A8MTL0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001138531", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138531", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A8MTL0", "url": "https://www.uniprot.org/uniprot/A8MTL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MTL0-1", "url": "https://www.uniprot.org/uniprot/A8MTL0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGPEEKTIMTERSAAVFIQAWWRGMLVRRTLLHAALRAWIIQCWWRQVLEKLLAKRRRMVLEFYVQQEWAAVRLQSWVRMWCVRQRYCRLLNAVRIIQVYWRWHSCHSRVFIEGHYELKENQLNIQLEISLGLQACKVQQCIPLPLKE", "length": 148, "header": "sp|A8MTL0-1|IQCF5_HUMAN Isoform 1 of IQ domain-containing protein F5 OS=Homo sapiens OX=9606 GN=IQCF5 PE=2 SV=2 CANONICAL=A8MTL0-1" }, "isoforms": [ { "isoform_ac": "A8MTL0-1", "url": "", "sequence": { "sequence": "MGPEEKTIMTERSAAVFIQAWWRGMLVRRTLLHAALRAWIIQCWWRQVLEKLLAKRRRMVLEFYVQQEWAAVRLQSWVRMWCVRQRYCRLLNAVRIIQVYWRWHSCHSRVFIEGHYELKENQLNIQLEISLGLQACKVQQCIPLPLKE", "length": 148, "header": "sp|A8MTL0-1|IQCF5_HUMAN Isoform 1 of IQ domain-containing protein F5 OS=Homo sapiens OX=9606 GN=IQCF5 PE=2 SV=2 CANONICAL=A8MTL0-1" }, "locus": { "chromosome": "3", "start_pos": 51875531, "end_pos": 51873736, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000446461.2", "url": "https://www.ensembl.org/id/ENST00000446461.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000394653.1", "url": "https://www.ensembl.org/id/ENSP00000394653.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "hsa:389124", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:389124", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZE78-1", "protein_name": "IQ motif containing F5", "gene_name": "Iqcf5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLQGPEETTALTEKSAAVRIQAWWRGTLLRRSLLHAALNAWIIQCWWRKTMMTMQGKKRRMALELYVRKTWAIVKLQSCFRMWHIRQRYCRLLNAVRIIQVYWRWHSCHTRGFIRGNYEIKENRLNIQLEISLGSQACKVEQCITLPIKE", "length": 150 }, "evidence": [ { "id": "A8MTL0", "url": "https://omabrowser.org/oma/group/A8MTL0/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9DAL7-1", "protein_name": "IQ domain-containing protein F5", "gene_name": "Iqcf5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGPEKSTAMTETSAAVRIQAWWRGTLLRRTLLHAALSAWIIQCWWRKIMIMLQGKKRRMALELYARKTWAIVKLQSWFRMWHIRHRYCRLLNAVRIIQVYWRWHSCHTRGFIQGNYEIKENRLNIQLEISLGSQACKVEQCITLPIKE", "length": 148 }, "evidence": [ { "id": "45934165", "url": "http://www.informatics.jax.org/homology/45934165", "database": "MGI" }, { "id": "A8MTL0", "url": "https://omabrowser.org/oma/group/A8MTL0/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "calmodulin binding", "id": "GO:0005516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005516", "evidence": [ { "database": "UniProtKB", "id": "A8MTL0", "url": "https://www.uniprot.org/uniprot/A8MTL0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }