{ "uniprot_canonical_ac": "A6NEC2-1", "uniprot_ac": "A6NEC2", "uniprot_id": "PSAL_HUMAN", "mass": { "chemical_mass": 53747.0, "monoisotopic_mass": 53747.0 }, "refseq": {}, "gene_names": [ { "name": "NPEPPSL1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NEC2", "id": "A6NEC2" } ], "protein_names": [ { "name": "Puromycin-sensitive aminopeptidase-like protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NEC2" }, { "name": "3.4.11.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A6NEC2" } ], "function": [ { "annotation": "Aminopeptidase with broad substrate specificity to several peptides.", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "common_name": "Human" } ], "gene": [ { "name": "NPEPPSL1", "url": "https://www.uniprot.org/uniprot/A6NEC2", "locus": {} } ], "crossref": [ { "id": "cd09601", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09601", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "A6NEC2", "url": "https://www.ebi.ac.uk/intact/interactors/id:A6NEC2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001930", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001930", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014782", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014782", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027268", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027268", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034016", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034016", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042097", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042097", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A6NEC2", "url": "https://www.nextprot.org/entry/NX_A6NEC2", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PTHR11533", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11533", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11533:SF285", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11533:SF285", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01433", "url": "http://pfam.xfam.org/family/PF01433", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17900", "url": "http://pfam.xfam.org/family/PF17900", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NEC2", "url": "https://pharos.nih.gov/targets/A6NEC2", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NEC2-1", "url": "https://www.uniprot.org/uniprot/A6NEC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NEC2-2", "url": "https://www.uniprot.org/uniprot/A6NEC2-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NEC2-3", "url": "https://www.uniprot.org/uniprot/A6NEC2-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSPINCSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDERAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVTSTYLVAFVVGEYDFVETRSKDGVCVCVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWDLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLRLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAAAGNL", "length": 478, "header": "sp|A6NEC2-1|PSAL_HUMAN Isoform 1 of Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3 CANONICAL=A6NEC2-1" }, "isoforms": [ { "isoform_ac": "A6NEC2-1", "url": "", "sequence": { "sequence": "MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSPINCSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDERAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVTSTYLVAFVVGEYDFVETRSKDGVCVCVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWDLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLRLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAAAGNL", "length": 478, "header": "sp|A6NEC2-1|PSAL_HUMAN Isoform 1 of Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3 CANONICAL=A6NEC2-1" }, "locus": {} }, { "isoform_ac": "A6NEC2-2", "url": "", "sequence": { "sequence": "MNVIDRKPYPDDENLVEVKFARTPVTSTYLVAFVVGEYDFVETRSKDGVCVCVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWDLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLRLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAAAGNL", "length": 263, "header": "sp|A6NEC2-2|PSAL_HUMAN Isoform 2 of Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3 CANONICAL=A6NEC2-1" }, "locus": {} }, { "isoform_ac": "A6NEC2-3", "url": "", "sequence": { "sequence": "MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSPINCSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSY", "length": 163, "header": "sp|A6NEC2-3|PSAL_HUMAN Isoform 3 of Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3 CANONICAL=A6NEC2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" }, { "name": "peptide catabolic process", "id": "GO:0043171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043171", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" }, { "name": "peptide binding", "id": "GO:0042277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042277", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" }, { "name": "metalloaminopeptidase activity", "id": "GO:0070006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070006", "evidence": [ { "database": "UniProtKB", "id": "A6NEC2", "url": "https://www.uniprot.org/uniprot/A6NEC2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 62, "end_pos": 64, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 62, "end_pos": 64 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }