{ "uniprot_canonical_ac": "A0A455ZAR2-1", "uniprot_ac": "A0A455ZAR2", "uniprot_id": "PNT87_HUMAN", "mass": { "chemical_mass": 9607.0, "monoisotopic_mass": 9607.0 }, "refseq": {}, "gene_names": [ { "name": "LINC-PINT", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2", "id": "A0A455ZAR2" } ], "protein_names": [ { "name": "Transcriptional regulator PINT87aa", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A455ZAR2" } ], "function": [ { "annotation": "Enhances the binding of the PAF1 complex to target gene promoters and plays a role in negative regulation of transcription (PubMed:30367041). May function as an anchor to keep the PAF1 complex on target gene promoters, sequentially pausing RNA polymerase II-induced mRNA elongation (PubMed:30367041). Inhibits FOXM1-mediated transcription of PHB2 (PubMed:33754036).", "evidence": [ { "database": "UniProtKB", "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2#function" }, { "database": "PubMed", "id": "33754036", "url": "https://glygen.org/publication/PubMed/33754036" }, { "database": "PubMed", "id": "30367041", "url": "https://glygen.org/publication/PubMed/30367041" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2" } ], "common_name": "Human" } ], "gene": [ { "name": "LINC-PINT", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2", "locus": {} } ], "crossref": [ { "id": "LINC-PINT", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LINC-PINT", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "26885", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26885", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A0A455ZAR2", "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A455ZAR2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "PR_A0A455ZAR2", "url": "http://purl.obolibrary.org/obo/PR_A0A455ZAR2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A455ZAR2-1", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK", "length": 87, "header": "sp|A0A455ZAR2-1|PNT87_HUMAN Isoform 1 of Transcriptional regulator PINT87aa OS=Homo sapiens OX=9606 GN=LINC-PINT PE=1 SV=1 CANONICAL=A0A455ZAR2-1" }, "isoforms": [ { "isoform_ac": "A0A455ZAR2-1", "url": "", "sequence": { "sequence": "MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK", "length": 87, "header": "sp|A0A455ZAR2-1|PNT87_HUMAN Isoform 1 of Transcriptional regulator PINT87aa OS=Homo sapiens OX=9606 GN=LINC-PINT PE=1 SV=1 CANONICAL=A0A455ZAR2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A peptide encoded by circular form of LINC-PINT suppresses oncogenic transcriptional elongation in glioblastoma.", "journal": "Nature communications", "date": "2018-10-26", "authors": "Zhang Maolei, Zhao Kun, Xu Xiaoping, Yang Yibing, Yan Sheng, Wei Ping, Liu Hui, Xu Jianbo, Xiao Feizhe, Zhou Huangkai, Yang Xuesong, Huang Nunu, Liu Jinglei, He Kejun, Xie Keping, Zhang Gong, Huang Suyun, Zhang Nu", "evidence": [ { "database": "UniProtKB", "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2" } ], "reference": [ { "type": "PubMed", "id": "30367041", "url": "https://glygen.org/publication/PubMed/30367041" } ] }, { "title": "Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated PHB2.", "journal": "Theranostics", "date": "2021", "authors": "Xiang Xiaohong, Fu Yunong, Zhao Kun, Miao Runchen, Zhang Xing, Ma Xiaohua, Liu Chang, Zhang Nu, Qu Kai", "evidence": [ { "database": "UniProtKB", "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2" } ], "reference": [ { "type": "PubMed", "id": "33754036", "url": "https://glygen.org/publication/PubMed/33754036" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A455ZAR2", "url": "https://www.uniprot.org/uniprot/A0A455ZAR2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }