{
    "uniprot_canonical_ac": "A0A286YF18-1",
    "uniprot_ac": "A0A286YF18",
    "uniprot_id": "SMI44_HUMAN",
    "mass": {
        "chemical_mass": 16072.0,
        "monoisotopic_mass": 16072.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "SMIM44",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A286YF18",
            "id": "A0A286YF18"
        }
    ],
    "protein_names": [
        {
            "name": "Small integral membrane protein 44",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "A0A286YF18"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A286YF18",
                    "url": "https://www.uniprot.org/uniprot/A0A286YF18"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "SMIM44",
            "url": "https://www.uniprot.org/uniprot/A0A286YF18",
            "locus": {
                "chromosome": "19",
                "start_pos": 3482110,
                "end_pos": 3483441,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000284638",
                        "url": "https://www.ensembl.org/id/ENSG00000284638"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000284638",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000284638",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "SMIM44",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SMIM44",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "55815",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=55815",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "DLADCMF",
            "url": "https://omabrowser.org/oma/group/DLADCMF/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4268898at2759",
            "url": "http://www.orthodb.org/?query=4268898at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_A0A286YF18",
            "url": "http://purl.obolibrary.org/obo/PR_A0A286YF18",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A286YF18",
            "url": "https://www.uniprot.org/uniprot/A0A286YF18",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A286YF18-1",
            "url": "https://www.uniprot.org/uniprot/A0A286YF18-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MPGLAAEGEAEGWSPSPPLYEEYRPPPLDSIRLPRYVLYLLLAALVVVAVAYAIVGHLIKDLAHDLADWAFGPKPDQEAAPRELRPSLTGEDLEGLDLQLALAWQGEEDAGGGGEGAPSEPPPPPEPRRPSIAFKDPPSRSSFWKLMAT",
        "length": 149,
        "header": "sp|A0A286YF18-1|SMI44_HUMAN Isoform 1 of Small integral membrane protein 44  OS=Homo sapiens OX=9606 GN=SMIM44 PE=3 SV=1 CANONICAL=A0A286YF18-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A286YF18-1",
            "url": "",
            "sequence": {
                "sequence": "MPGLAAEGEAEGWSPSPPLYEEYRPPPLDSIRLPRYVLYLLLAALVVVAVAYAIVGHLIKDLAHDLADWAFGPKPDQEAAPRELRPSLTGEDLEGLDLQLALAWQGEEDAGGGGEGAPSEPPPPPEPRRPSIAFKDPPSRSSFWKLMAT",
                "length": 149,
                "header": "sp|A0A286YF18-1|SMI44_HUMAN Isoform 1 of Small integral membrane protein 44  OS=Homo sapiens OX=9606 GN=SMIM44 PE=3 SV=1 CANONICAL=A0A286YF18-1"
            },
            "locus": {
                "chromosome": "19",
                "start_pos": 3483403,
                "end_pos": 3482807,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000641816.2",
                        "url": "https://www.ensembl.org/id/ENST00000641816.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000493273.1",
                        "url": "https://www.ensembl.org/id/ENSP00000493273.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0A1Y7VJ29-1",
            "protein_name": "Predicted gene, 48552",
            "gene_name": "Gm48552",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAGSVDEKEAEDWSPAPPMYEEYRPPALDAIRLPRYALYLLMAAILVVAVAYAIVGHLIKDLAHDLADWAFGPKPDQEEEGSRELRASLAAEDLEELDLQLALAWRGEDDPARAPRRTSIAFKDPPVQTNFWRLD",
                "length": 135
            },
            "evidence": [
                {
                    "id": "A0A286YF18",
                    "url": "https://omabrowser.org/oma/group/A0A286YF18/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A286YF18",
                                "url": "https://www.uniprot.org/uniprot/A0A286YF18"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}