{ "uniprot_canonical_ac": "A0A286YF01-1", "uniprot_ac": "A0A286YF01", "uniprot_id": "SCGR7_HUMAN", "mass": { "chemical_mass": 8951.0, "monoisotopic_mass": 8951.0 }, "refseq": {}, "gene_names": [ { "name": "SCYGR7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A286YF01", "id": "A0A286YF01" }, { "name": "KRTAP28-7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A286YF01", "id": "A0A286YF01" } ], "protein_names": [ { "name": "Small cysteine and glycine repeat-containing protein 7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A286YF01" }, { "name": "Keratin-associated protein 28-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286YF01" } ], "function": [ { "annotation": "In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.", "evidence": [ { "database": "UniProtKB", "id": "A0A286YF01", "url": "https://www.uniprot.org/uniprot/A0A286YF01#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A286YF01", "url": "https://www.uniprot.org/uniprot/A0A286YF01" } ], "common_name": "Human" } ], "gene": [ { "name": "SCYGR7", "url": "https://www.uniprot.org/uniprot/A0A286YF01", "locus": { "chromosome": "2", "start_pos": 227728625, "end_pos": 227728335, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000284718", "url": "https://www.ensembl.org/id/ENSG00000284718" } ] } } ], "crossref": [ { "id": "ENSG00000284718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000284718", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "SCYGR7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SCYGR7", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "34226", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=34226", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "NX_A0A286YF01", "url": "https://www.nextprot.org/entry/NX_A0A286YF01", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "GDNCKCC", "url": "https://omabrowser.org/oma/group/GDNCKCC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A286YF01", "url": "http://purl.obolibrary.org/obo/PR_A0A286YF01", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A286YF01", "url": "https://www.uniprot.org/uniprot/A0A286YF01", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286YF01-1", "url": "https://www.uniprot.org/uniprot/A0A286YF01-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGCCGCGSCGGCGGGCGGCGGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCGSCGCGCGKGCCQQKGCCQKQCCC", "length": 96, "header": "sp|A0A286YF01-1|SCGR7_HUMAN Isoform 1 of Small cysteine and glycine repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=SCYGR7 PE=1 SV=1 CANONICAL=A0A286YF01-1" }, "isoforms": [ { "isoform_ac": "A0A286YF01-1", "url": "", "sequence": { "sequence": "MGCCGCGSCGGCGGGCGGCGGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCGSCGCGCGKGCCQQKGCCQKQCCC", "length": 96, "header": "sp|A0A286YF01-1|SCGR7_HUMAN Isoform 1 of Small cysteine and glycine repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=SCYGR7 PE=1 SV=1 CANONICAL=A0A286YF01-1" }, "locus": { "chromosome": "2", "start_pos": 227728622, "end_pos": 227728335, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000641700.1", "url": "https://www.ensembl.org/id/ENST00000641700.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000493152.1", "url": "https://www.ensembl.org/id/ENSP00000493152.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Molecular evolution of the keratin associated protein gene family in mammals, role in the evolution of mammalian hair.", "journal": "BMC Evol. Biol.", "date": "2008", "authors": "Wu DD, Irwin DM, Zhang YP", "evidence": [ { "database": "UniProtKB", "id": "A0A286YF01", "url": "https://www.uniprot.org/uniprot/A0A286YF01" } ], "reference": [ { "type": "PubMed", "id": "18721477", "url": "https://glygen.org/publication/PubMed/18721477" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A1Y7VIU2-1", "protein_name": "RIKEN cDNA A030005L19 gene", "gene_name": "A030005L19Rik", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGCCGCGGCGGCGCGGCGCGGCGGCGCGGCGCGGCGCGCGCGGCGGCGCGGCGCGGCGCCGGCCGCCKPTVVCCCRRSCCRSCGCGSCGCSCGCGKGCCQQKCCCQQKCGCKK", "length": 113 }, "evidence": [ { "id": "A0A286YF01", "url": "https://omabrowser.org/oma/group/A0A286YF01/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "intermediate filament", "id": "GO:0005882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005882", "evidence": [ { "database": "UniProtKB", "id": "A0A286YF01", "url": "https://www.uniprot.org/uniprot/A0A286YF01" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }